BYKdb

Dataset for cluster tadcd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

745 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1T5MMH4      ------------------------------------MELAKNNIHHQPLPSEGIDFNKLK
A0A2W4R1L8      ---------------------------------------METGTFKSGNSIEGIDFSKLR
A0A2E5CV79      --------------------------------------------------------MELM
A0A2D4ZVH1      ------------------------MHFNGNSSNGYNSGYSPLENETDSYIEKEIDLIKVF
A0A0K8QSK7      --------------------------------MEDPRLEIPGLPFFPEFEQSESMIKPFL
A0A1V6CN82      --------------------------------MTEYNDTDRTQDSAAQEELPVFNYKRLV
A0A1M4XZ45      --------------------------------MTQSEINKN-NQINSSSDDDTIDLKKII
A0A399D319      --------------------------------MTQMDINKNGHQINQSQDDDSIDLKKII
A0A1V5IPN7      --------------------------------------MDQNNQPSTVPQPEEIKISDYL
A0A1M6GR99      ------------------------------------------MNQQKLPEQNILNIQDIF
A6EBM4          -------------------------------------MTGESRKGQRGPSHREVDLLKIT
A0A7C5M4P4      --------------------------------MKLNPAESEAPLSSNVEAQQALDFTKLL
A0A1M6TTV4      --------------------------MNFSPEHNVLNQTNNQNADSSGSPLDDLDFDKIK
A0A4Q8RX32      ---------------------------------------------MALYDGQIDDFNVIF
K0X1U5          ----------------------------------------MEEKYTSERKNDNIDIVALW
R5EXK3          ----------------------------------------MEEKYTSERRNDNIDIVALW
A0A401UAP7      -------------------------------------MDKGFTNESE-----TIDFSKLK
A0A1W2GF52      ---------------------------MNPRNVHIPQDIRSHHNPENDGAFENFDFEKFR
A0A2G5L7B8      -----------------------------MRPIHGGQN----HNQSEGDPLSNIDFDKLN
A0A523GAC0      ----------------------------MTNQTFDIEKDNFVVRGQHSYLGGEIDIEKLH
L8JW09          -------------------------------------MENKNIYSDTEKPTEGIDLDKAL
A0A364XUP5      ----------------------------------MMLESNKIGPPVALPNTEGIDINKLR
A0A1M5RLA9      -----------------------------------MLETPKNIQPQQSQANEALDLNKLK
A0A385SFR9      -----------------------------------MLEIPKNIPPQQSPANEPLDLNKLK
A0A5M4A9J4      --------------------------------MKEQQPQPQPVFMPFFEQEEKIDFKKYF
A0A5M4B1C7      ----------------------------------MKEKQPQLVSVPFFEEEEKIDFRKYF
A0A0D3LFR6      ----------------------------MKEDTTYVEYTDAPDEQPEGGPLQSIDFDKLF
M7N6D4          ----------------------------MKEETTYVEYTEGQDTK-GWLPIHNIDFDKLY
A0A4D7K1D4      -----------------------------------------------------MDWEKLA
A0A5C7MX19      ------------------------------------------------------------
A0A1Q3ZMZ7      ------------------------------------------------------------
A0A2D8JJW3      ---------------------------------------------MATQSNKQFSIYDFL
A0A2W2AFF7      ---------------------------------MQDKNYTNHIVAAEQQEEGSLNVHKLI
R7PCR1          ----------------------------------MANNTVSSTVNQAELKEESINFQQII
A0A1G9E2A9      ----MV---------EPTEIQHLGRPIDNE---------------EEESFLSVIDWPKLL
A0A098LL25      ---------------MSLLEDEDKRSLNGSGQRVSFADDSE----EEDDVFGDFDFAKLL
A0A6J4H627      ----MSAFNG-----RSMDFPESVSSPGNQE--------------EEDDVLGGLDFIKIL
A0A6C0GJI1      ----MSINNGKGPDVEEPQMISFNRQAEQE---------------EEDTLLGGLDLIRLY
A0A2T2YJE8      ----MTNK-------ESIVLEELENNYAAAVEV------------EEDSGGSDIDFIMLL
A0A127B287      ----MSVK-------TGNNLDELDYHTSNADI-------------EEEDSGSSIDLVTLW
A0A6P1P2P6      ----MSVK-------AGNNLDELDYHTGNAEL-------------EEEDSGSSIDLVTLW
A0A3M9N829      ----MSVK-------AANDLDELDHRLGSDEG-------------EEEDGGASIDFVTLL
A0A0P0CSF9      ----MSVK-------TVNDLDELDHRLGSGED-------------EDDDGGTSIDFVTLL
A0A5M8QQB8      ----MSVK-------TANDLDELDHRLGSGED-------------EEDDGGTSIDFVTLL
A0A3M9MNC3      ----MSVR-------TVNDLDELDHRLGGVED-------------EEDDGGANIDFVTLL
A0A5B6TAX2      ----MSVK-------TVNDLDELDHRLGGVED-------------EEDDGGTSIDFVTLL
A0A5N1IQ33      ----MAVD-------KDAELEELIRTAGGEEGT-------------EDDAGAGLDLATLL
A0A512AYT3      ----MALE-------KFADIDEL-NSRVADTES-------------EEEGGSDVDFVILL
A0A5M6CYN7      ----MALE-------KFADIDEL-NSRVTDTDS-------------EEEGGSDVDFVTLL
A0A369QP10      ----MANK-------ESIVLEELDNS-----------NYASTIEVEEESRGSDIDFIMLL
A0A126PDF2      ----MAVN-------ENAELEALIRNAIDGGTEPPTAA--TVGAAADDEADGGLDLSTLA
A0A2Z3GKA1      ----MAVN-------ENAELEALIRNAIDGGTEPPTAA--TVGAAADEEADDGLDLSTLA
A0A502GZP7      ----MAIN-------ENAELESLIRNAIDGGAEQPAAA--TAGGAADEEGSEGLDLSTLA
A0A519SBU8      ----MALS-------ENAELEELIRRATGETASQLPPT-GAAAAADEEDLGGGFDIGTLV
A0A4Q3JNZ3      ----MALS-------ENAELEELIRRATGETAGQLPPTQGPTVGDEPEDLGGGLDLNTLV
A0A519Q9V3      ----MAVS-------ENAELEELIRKATGDTAGQLPPTSGPVLAAEQDDTGSSLDLNTLV
A0A0M3RW20      ---------------------------------MNTPE--P----ESETEGSGLDLSTLV
A0A495VFX4      ----MAKN-------ENTELEDLIRNSLGNQPTVSVPE--P----ESETENSGLDVSTLV
A0A1S9B3W0      ----MAVN-------ENAELEELIRNATS-GGVNTPAP--PASESDDDNVGGGLDLPLLL
A0A1W1VRL3      ----MAAK-------EETELEELIRNA---NGIETEDK--E----DE---GDGLDITTLL
A0A1M6R305      ----MAVN-------ENAELEELIRNATGSGGASTVSA--ESEVVEE---GGGLDFDTLL
A0A4Z0PHK3      ----MAVN-------ENAELEELIRNA---GGTETNAA--E----DE---GDGIDITTLL
A0A2M9B9H9      ----MAVN-------ENAELEELIRSA---GGAEPNAV--E----DE---GGGLDLTTLL
A0A4Z0QCY9      ----MAVN-------ENAELEELIRNA---GGAEPNAA--E----DE---DGGLDIATLL
A0A418R9X5      ----MAAK-------EDAELEELIRNA---GG--EPEE--E----EE---GGGLDLTTLL
A0A428JSJ3      ----MAAK-------EDAELEELIRSA---GG--EPEE--E----ED---GGGLDLSTLL
A0A428KI59      ----MAAK-------EDAELEELIRNA---GA--EPEE--E----EE---GGGLDLTTLL
W8F1I6          ----MAAK-------EDAELEELIRNA---GA--EPEE--E----EE---GGSLDLTTLL
A0A246FQC0      ----MATK-------EDAELEELIRNA---GG--EEVE--E----DD---GGGLDLTTLL
A0A372E5P8      ----MAVK-------EDAELEELIRQA---GGGEPTED--E----DD---GGGLDLTTLL
A0A1H3EMW1      ----MAAK-------EDAELEELIRNA---GR--ESEE--Q----ED---GGGLDLTTLL
A0A1H9ZSN3      ----MAAK-------EDAELEELIRNA---GG--EPEE--E----DD---GGGLDLTTLL
A0A5N1J2M4      ----MMPT-------QSTELDELE-------------VKPAIVDAEEESSGSDFDLVTLV
A0A519S476      ------------------------------------------------------------
A0A4Q3JRW8      ----MAVS-------ENAELEELIRKATGEAAVQLPPTASSASTPELEDIGGGLDLNTLV
A0A519M923      ----MALS-------ENAELEELIKRATSDTAGQLPAAQNQPQSAEPEDLGGGLDLNTLV
A0A4Z0ENW1      ----MAST-------ENAELEELIRRASASGET--TPPTGPSFAEEEAEDGDNFDLSTLV
A0A519UDB4      ----MAMS-------ENAELEELIRRTTTGADS--SSSISAATSEEEAE--DSFDISTLV
A0A3S0QKV1      ----MAVN-------ENAELEELIRNATGGSGA----AAPTASAPEAEEAGSGLDLPLLL
A0A328BL48      ----MAVN-------ENAELEELIRNATSGGAA----PTAPAAESEDDSVGGGLDLPLLL
A0A5R8WLY4      ----MAVN-------ENAELEELIRNATSGGAA----PTAPAAESEDDSVGGGLDLPLLL
A0A1I5WSL8      ----MAIN-------ENTELEELIRNATGGSAA--PPETPASSGADPEDDSASLDISTLV
A0A0U3JVM7      ----MAIN-------ENTELEELIRNATGGTAS--PPEAPSASGGDADDDAPGLDIATLV
A0A1G1SSV2      ----MATN-------ENRELEELIRNATGGTAS--LPEAPTVGASEPEDESASLDITTLV
A0A1G1SXV7      ----MATN-------ENRELEELIRNATGGTAF--PSEAPAVGTGETEEESASLDITTLV
A0A6G8CBJ6      ----MAAK-------EETELEEMIRNAGGM-------EAEE-----KEDAGDGLDLTTLL
A0A0W8EDI5      ----MAVN-------KEAELEELIRASG---------EET------DDVAESSFDVATLL
A0A3B7RBP8      ----MAID-------KEAELEELIRSAGST-------EGQ------EEETDTAFDISTLL
A0A3R9P8H7      ----MAAN-------EDAELEEMIRNAGGN-------ESD------GEDDGGGIDFTTLL
A0A238WIA7      ----MAVN-------EEVELEDLVRNAGGE-------A--------DEDDGGGLDLTTLI
A0A212UCJ7      ----MAVN-------EDIELEELIRGAGGD-------A--------EEDQGGGLDLTTLL
A0A4Z0MQE1      ----MALN-------EEADLEELVRGAGGE-------A--------DEDQGGGLDLTTLV
A0A4Z0PCF4      ----MALN-------EEAELEDLVRSAGGE-------A--------DEDQGGGLDLTTLV
A0A6M6BED0      ----MALN-------EEAELEELVRNAGGE-------A--------DEDEGGGLDLTTLA
A0A5D6VDG1      ----MAIN-------ENAELEDLIRNSGGT-------PPVE---VQAEEENTGIDTTTLL
A0A6H1CVS0      ----MAIN-------ENAELEELIRNSGGT-------APVE---VESEEENTGIDTTTLL
A0A243WHR7      ----MAVN-------ENAELEELIRNAGGN-------EAEV-----EDDEGAGLDLVTLL
A0A5B8A0P6      ----MALK-------EEAELEELIRNSGGV-------DAEA-----ADEDSEGFDITTLL
A0A076HRT9      ----MAVN-------ENAELESLIRNATGG-------VSAVPVESEPADDGGGLDFDTLL
A0A4Z0PVM7      ----MAVN-------ENAELEELIRSAGGA-------EPTA-----EDEDG-GLDIATLL
A0A1M6DHW8      ----MAIN-------ENAELEELIRNAGGG-------DTEA-----EGEEGSGLDIATLL
A0A4Q5LC61      ----MAVN-------ENAELEDLIRNAGGG-------DVEA-----EGEDDPGFDIATLL
A0A2N5YXE2      -------------------------------------MENKIPIFNQ-----KFDPRTFF
K0XJ09          -------------------------------------MELIQETKNDKKNEGGVTLRDIV
R5EUZ0          -------------------------------------MELIQETKNDKKNEGGVTLRDIV
W0EQS0          -------------------------------------MELIQETKNEKKNEGGITLRDIV
A0A1Y3WE15      -------------------------------------MELIQETKNEKKNEGGITLRDIV
A0A1Y4GUK3      -------------------------------------MELIQENKNEKKNEGGITLRDIV
A0A2U1FKU2      --------------------------MPTEEKRITPYGGASRS--ESGEDISFFSVEEFL
A0A0A2F954      --------------------------MNLNEGSQNTFTRQGRSYISDTEDTAFFSLEEFF
A0A0A2FW91      --------------------------MNLNEGSQNTFTRQGRSYISDTEDTAFFSLEEFF
A0A2D2N2N1      --------------------------MNLNEDSKNTFTRQSRSYISDTEDTAFFSLEEFF
Q7MWZ2          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFF
T2NDT6          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFF
W1R7P9          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFF
A0A1R4AFZ0      --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFF
A0A1R4DVZ7      --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFF
A0A7C0WKI7      ----------------------------------------MQESWNNQLEEKPVRLTDYL
A0A2A8CVM9      MNDKNLSRFDSGDMTPAPLRNGHASNRMNGSAHHGGGSSGSSSEANA-----GIDVAEIL
A0A5M4B212      ------------------------------MDALNSNSANQMTTIVR-----QRNYRKYL
A0A3D1KEX9      -----------------------------MAEQYIEGAQQLQQEENE-----EMDIFSIL
A0A358Y7S2      ----------------------------------MSTGPIKKRVLNK-----EFNPLILE
A0A1X7J248      --------------------------MSNQQTRYQRNLEGNNSHRPQNQETEVVDFFKLK
E4TQD2          --------------------------MSNQQTRYQRNLEGNTSQKPQNQESEVVDFYKLK
A0A2J6HHN3      -------------------------------------MKQKIAKFND-----EFDFKLFL
A0A1Y3WMT8      -----------------------------------MEENYTSERRND-----SVDVLALW
A0A1Y4GQU1      -----------------------------------MEENYTSERRND-----SVDVVALW
A0A6A0R272      ---------------------------------------MNKNILAD-----KLELANFI
A0A1V5W8T5      -------------------------------------------MFND-----SFDVSKLI
A0A2T8HKA9      ----------------------------------MLKDTNIAGAEDK-----SINVLDLL
A0A2I0QZ80      -----------------------------------MEVNKKKLFVNT-----TFDTNILK
A0A3E1F1A3      -----------------------------------MINQKGKIFVNT-----TLDFKVLK
A0A2U2XBJ3      -----------------------------------MINQRGKIFVNT-----TFDLKVLK
A0A4Q4KU94      -----------------------------------MNSQKGKIFVNT-----TFDLKVLK
A0A3B8INU3      --------------------MAETNQEDYRARIQGGYPGERLEPFGNSSVLDKIDTEKIA
A0A2W1NDY9      ------------------------------MNNFHINNENAISSLNK-----DIDIDILK
A0A5C8AQR5      -----------------------------------MGSSERKIIINK-----EYNPHILS
A0A1G0CI31      ----------------------------------MNGAQQPSLLINR-----EYNPLIAA
A0A556N0M0      -----------------------------------MNSSNSSIFINK-----DYNPIIVN
F2IKD6          -----------------------------------MNNSNTSIFINK-----DYNPIIAQ
A0A1I7BM74      -----------------------------------MNSSKNRFFVNT-----EFDLDIIR
A0A2G2FJ17      -----------------------------------MEKRNNSIYVNT-----NFDTDILR
A0A2E3R1D0      MIDQPYPTAADRGA---------------------PGAPVRGEDPFYYGDRDGIDLRALL
A0A2T2USC0      --------------------------------------MNGQVGGMPAPQEDEITLQEII
A0A2T2V0F3      MHDGSAPSGNGHSNRWNSMN---------------PVNGQSQPSGEHGARDDEITLQELV
A0A2T2S682      -----MPRSSSFEYAGDGHPGNGRSAPDDEPSLY-DSAPDGPTGVD--------RLRALL
D5H561          --------MAHLQRRDPDQNGQG-----DIVRSW-EGGTNGAAGPSSGRQGIKGQIEELL
A0A2H3NWA9      -MASPSLPPNGQNGRHDAAPTPWPAQGQLYDEVY-HPEGNGVS-----------QLREMA
A0A2A8CVB6      MSPSSNMSSNGHRP--AGGPVNGIAGASLF---Y-DDNPQRGS-----------QLHELL
A0A2P6C1S6      -----MASTNGHPG-----SSQSVSVEDLL---YEDTTSRRSS-----------QLHDLI
A0A2T2UTM4      -----MASTNGYPSGEEGPGSRSLAVEDLL---Y-DNSDRRSS-----------QLHDLI
A0A414ZBF2      -------------------------------MRKDKFEDFDFIDFNESRSEESTVMADMI
A0A1Q3Q573      -----------------------MENKLDLTGSGGSAPKGQQTNFAE-----GFNLGLLI
A0A662BAY3      ---------------------------MTNNDNSGPVLRNLSSQTSE-----DYEIKKIL
A0A4U3L369      -----------------------------MEYNLNGNGAASNGSISHTDDADIFDIKKVI
A0A357YNR3      ------------------------------MSMYSEVEYEFNKLADK-----PVDVLSIL
A0A5E8AX52      -----------------------------MTENSNTSGSGLGADVNESDAFNDLDVEKLL
F4KK08          --------------------------------MEYQTASTQQEPIRSSEEVSTFSLRDIL
A0A6B5PK86      -----------------------------------MAENQNSFIINK-----SYDSLLFR
A0A2G2F510      -------------------------------------MSNKSFIINK-----NYDPLILR
A0A316JZ08      -------------------------------------MAKQKLFINT-----SYDPLILR
A0A496LCF9      --------------------------------MKNINSDNHSNPIFDEEDNPSFNILEWI
A0A5P2G2A9      ------------------------------MAENLLSNSGKGENAEE-----AIDFEKIL
A0A3C0ZQC7      ----------------------------------MNIGKGDIERIHRDGISQEPTFQDYV
A0A419VXB7      -----------------------------------MDRKEELLKLLLQKEEQPQNIKDFL
A0A0B0BTJ4      -----------------------------MTENNKDIIDGRKEEENK-----SITLRDIF
A0A3B9CNN6      -----------------------------MTENNKDIIDGRKEEENK-----SITLRDIF
R5X290          -----------------------------MTENNKDIIDGRKEEENK-----SITLRDIF
A0A1Q6E6I7      -----------------------------MTENNQDIIDGRKEEENK-----SITLRDIF
C3J7R8          ------------------------MEYRESETKSIEQELKRPSLVEAASFITLSDIGL--
A0A1G8BVM8      --------------------------------MSKNSEQFDFVDFNDGNSNDNTAIADLL
A0A1I1FXP9      ----------------------MLQNAEAINNALVELEEEEELRAEK-----GINSDKLL
A0A3N4H5N3      --------------------------------MYMKRVLGNKMGNEE-----PIDLSVVF
A0A2P8EAX2      ----------------------------------MNQNKARNKGAGE-----PIDLFKSV
A0A4V2F6N9      ----------------------------------MSHNRTKNKGAGE-----PIDLMRSV
A0A3B9FXJ0      ---------------------------MSNNAKFQAAPQQESTSGSS-----GVDLQLLL
R5GSU5          ------------------------------MANQNYINPPAVQQETE-----DIDWLSIV
A0A2A3UE91      -------------------------MFNPQVESANNQLKDITEKFNS-----GFDIGVIA
A0A0A2G557      ------------------------------MNNNLYTNPEEGFIENNLSEEQMISLSDIF
A0A2N2WFW8      ------------------------------------MAEYKKSKLND-----DFDFKLFL
A0A1F3IU95      ------------------------------------MTDSRKIKFND-----EFDFKLFL
A0A3D0VUF6      ------------------------------------MTDSRKIKFND-----EFDFKLFL
A0A1T4PT95      ----------------------------MNSNPYSNSSDVIMEKHQEIPEENMISLSDIF
A0A6I6JYY3      ----------------------------------MTTQRFQNNGIEHNNDEDSIDLKKLV
A0A2A4PYG9      -----------------------MYNQTTSGTDNVNAYQDRMSNFSQ-----EFDLGVFI
A0A1F3K695      ------------------------------------MEEKKIPLINE-----KFDLGLFL
A0A353KZR1      ------------------------------------MEEKKIPLINE-----KFDLGLFL
A0A2N2WYB5      ------------------------------------MYQGKIPLIND-----KFDFAIFM
A0A1F3K4G0      ------------------------------------MYQGKIPIIND-----KFDLAIFL
A0A356H8Y3      ------------------------------------MYQGKIPIIND-----KFDLAIFL
A0A351HSA6      ------------------------------------MYQGKIPIIND-----KFDLAIFL
A0A1F3Q014      ----------------------MLQEDISKTNDNFERYKERISNFSG-----EFELGLFI
A0A2D5KD44      ----------------------MQEQLSPHELEKLKQSQSSLSSFNT-----DFDLGLFL
A0A6N9NIX1      -----------------------------------MDENSNLSSPNTVNSSNEFDLGLLL
A0A2A4YXP3      ------------------------MEENTSSNNLNEERARKRSNLNT-----ESDPILFF
A0A1F3R158      ----------------------------MSEEYRDKQNNEAISNFNT-----ELDIILLL
A0A2M8ADX2      ----------------------------MNDEFNNKENKETVSNFNT-----ELDIILLL
A0A1J5B2H0      ------------------------------------MQPKKFSIINE-----EIDPKLFL
A0A1V5N756      ------------------------------------MANIKISYLND-----EFDLKLLL
A0A651GU15      ----------------------MIDENISKVNQSYEGYKERLTNFGS-----QFELGLFL
A0A3Q9FR88      ---------------------------MTDFDKEWDDLNNEGDNLSN-----NIDFDKLE
A0A553GEX3      ---------------------------MTDFDKEWDDHDNDGDNLSN-----NIDFDKLE
A0A150ADJ9      ---------------------------MTDFDKEFDDFDREDGNIAD-----SIDFDKLE
A0A1B1FWQ4      ---------------------------MSDFEKEWEDLENNEESSAN-----DIDFDKLE
A0A1S1Z228      ---------------------------MSDFEKEWEDLDNNEESSAN-----DIDFDKLE
A1ZKR2          --------------------------MTDQSNIPNINTPSEDDDFLN-----ALDLEKVW
A0A1Q3GX01      --------------------------MEEQNHILPNNNSSENDDFFS-----SIDLEKIW
A0A349DQI4      --------------------------MEERNHILPTNNDSENDDFLS-----NIDLEKIW
A0A4P5TMD1      ------------------------------MLEKKIILSPMQKILGE-----DFNPGLLM
A0A2N3IIZ0      -------------------MAQYLTEEERFRRLLQTDDIDSGESPLE-----AIDFAKIL
A0A1F3SJM1      ------------------------------------MSNKKSLIINK-----SYDPLILR
A0A2G2EB96      -------------------------------------MSSKGIIINT-----SYDPLILR
A0A2G6PRA9      -------------------------------------MNNKGLIINK-----SYDPLILR
A0A497D5Z2      ---------------------------MTPPNQRNNKPVSGKSASNE-----DMDVRRLV
A0A662B170      ---------------------------MTPPNQRNNKPVSGKSASNE-----DMDVRRLA
A0A2A5FYT6      ---------------------------METSSFSNNNEHNAFAKQQS-----DFDFGLLL
A0A2E6SYP1      ------------------------------------MEKEKLSILND-----EFDLGLAL
A0A2E5RLE8      ------------------------------------MEKEKLSILND-----EFDLGLAI
A0A2E7TQF6      ------------------------------------MEKEKLSILND-----EFDLGLAI
A0A2E6GVY9      ------------------------------------MEKEKLSILND-----EFDLSLAI
A0A350JJ90      --------------------------------MTEETNTNNLGVHSS-----QFDLGLLL
A0A3M1CDV2      -------------------------MLVANTDNEYHSYKQRLENFSN-----NLDIGLLI
A0A6C1QGZ7      ---------------------------------MTNPSLKKISTIND-----EIDIKLFL
A0A4P5U6G4      -----------------------------MQEEKKIILSPLQKLIGS-----DFNPGLLF
A0A2E2TFD1      ----------------------MIQDAREEQNESLDLYKERLTKFSQ-----DFEIGLFI
A0A2E4ELE6      ----------------------MIHEDTSRNNENLDKYKERLTNFSQ-----EFEIGLFV
A0A522EYA6      ----------------------MLADQFSNSSNSFSQYKERVSNLSQ-----EFEIGLFI
A0A2E3XZI5      ----------------------MKQENFVQTEENINRYKENITSLTQ-----DFELGLFL
A0A6I7QXV0      ------------------------------MSRGNSILSILQNFLGK-----DFNLSLLV
A0A2M7NLQ9      ---------------------MSDFDENPFINPAQAADASNEENFLA-----DFDVSKLI
I4AFR0          ---------------------MSDFDENPFINTVPTAETSNEENMLA-----DFDVSKLI
A0A2N2Y3E5      ------------------------------------MEERRIPILNE-----TFDIPLFL
A0A2D9D7T6      ----------------------------------MSSLNQRKLIVNK-----DYNPLILG
A0A1F3PPL5      -------------------------------------MQKKIPLINE-----TFDVRIFT
A0A357QK06      -------------------------------------MQKKIPLINE-----TFDVRIFT
A0A662AEA4      ------------------------------------MQQNKIPIINE-----KFDLQIFL
A0A0S2HYK8      ------------------------------------MQNRKIPIIND-----TFDIITFK
A0A2N5ZWN6      ------------------------------------MQKNKIPIIND-----TFDITTFK
A0A2E0FJ09      ----------------MIEEEISKRNDSFER------YRERLTNFSS-----EFEIGLFL
A0A1F3FZ62      -------------------------------------MAAKISQINT-----EFDLGLLF
A0A1F3K211      -------------------------------------MAAKISQINT-----EFDLGLLF
A0A1V6I2U9      ------------------------------------MDENKTSLFNQ-----KFDARTFL
A0A2H0B957      ------------------------------------MEQKNIPILNE-----KFDFNISL
A0A1F3CFW6      ------------------------------------MEQKRIPILNE-----KFDVNIFL
A0A2M7E2T8      ------------------------------------MEQKRIPILNE-----KFDVNIFL
A0A2M7NC69      ------------------------------------MEQKRIPILNE-----KFDVNIFL
A0A1F3KLL5      ----------------------------MKQ------QQRLIPVIND-----KFDLPIFL
A0A359D1M1      ----------------------------MKQ------QQRLIPVIND-----KFDLPIFL
A0A0F2NS19      -----------------------MQEDQFAH------KKEVVSNFNT-----ELDIILLL
A0A2A5H8X6      -----------------------MQEDQFAH------KKEVVSNFNT-----ELDIILLL
A0A2H0GAU8      -----------------------MEEEQFSN------KREPISNFNT-----ELDIILLL
A0A2M8FTK1      -----------------------MEEEQFSN------KREPISNFNT-----ELDIILLL
A0A2A5B3B0      -----------------------MEENNSSNNINEE-KTRKRSNLNT-----ESDPILFF
A0A5C6RXM7      -----------------------MESNNQINSNQDVIKNRKHSTFNT-----ESDPILLL
A0A1F3C1M2      ------------------------------M------SEKKIPLINE-----KFDIGLFV
A0A1F3DS87      ------------------------------M------TEKKIPLINE-----KFDFALFI
A0A6A0R6K9      ----------------MYNQIEKNEIENVNR------YKDRLSNINK-----DFDIGLFI
A0A2E7CT70      ----------------MIPEEIKNTEDNLLR------YRERIANFSK-----DFEIGLFL
A0A2D5V560      ----------------MESENFKXVEXNFQR------YKENVADLTQ-----EFELGLFL
A0A2D7K5A8      ------MVNHYSNQSIMGAEEFKGAEENIQR------YKENVSDLTQ-----EFELGLFL
A0A2E1XQ82      ------MVNHYSNKSIMGVEDFKGTEDSIQR------YKENVADLTQ-----EFELGLFL
A0A5C8A5B4      -------------------------------------MNVAPSADT-------IDLRAIF
A0A4Y9ITE2      -------------------------------MKEINITSNKGKDKK-------IDIIELL
A0A5M8NYX7      --------------------------------METTNMQAEQSGEE-------GSLADIF
A0A3D5KRY6      ---------------------------------------------------------FIK
A0A0E3V905      ---------------------------MSANTYTYTQHQLVESDGL-------NIRALLS
A0A553ETH6      ---------------------------------MNSINENNQEYEG-------IDLDKAQ
A0A640Q161      -----------------------------MAVNSREELNVGVFENE-------TIDIAHY
A0A640QU49      -----------------------------MAVNSREEFHNGMFENE-------TIDVAHY
A0A1Q3PII2      ------------------------------MLATKIPSTDLALSRD-------WTANPLW
A0A351BXT2      ----------------------MNKPSLNGKSNHTAVNSPELRESK-------DNFKIYL
A0A2K8Z965      --------------------------MTNESNYSYTTHQVVESEGL-------NLRNLIS
A0A418M8U8      --------------------------MNNQFQHSYVPYKMMEPEEL-------RVSDLLP
I2GTA4          --------------------------MNNQFNHSYVPYKMMEPEEL-------RVSDLLP
A0A2K8ZAJ2      ---------------------------MNMNPNVYTPYQTADVESK-------YNLGTLL
A0A368JPA3      --------------------------MKSSNMYSYPMYPQGEINSS-------DGQGTLK
A0A5N1JI29      --------------------------MKSSNMYSYPMYPQGEINSS-------DAKGTLK
A0A3P1BT12      --------------------------MKSSNMYGYPMYPQGEITSS-------DVPGTLK
A0A3P1CI15      --------------------------MKSANMYNYPMYPQGEMSSS-------DGKGTLK
A0A4R8CUK1      --------------------------------MHTNPINLRRKISS-------SDGRGAW
A0A3D0MYJ7      --------------------------MNKNQDIFIDETKSGTETTI-------NDIRFYF
A0A662AH13      -----------------------------MNSGYNNNNSGFEIEET-------NSLKDYI
A0A5C7QA01      ----------------------------------MNQNQNTHTEDT-------IDLKELF
A0A3D3LS70      ----------------------------MSDKSNNIPSVLKKDKEI-------DNLHLFL
A0A1G1TM36      ------------------------------------------------------------
A0A1G7ZF38      ------------------------------MLANKTQIAD---FQD-------WTKNPFW
C6VS52          ------------------------------MLTTKGPTNDYPPFQD-------WANHPLW
A0A7C1LGX3      ------------------------------MTETPFNLDYDQKQDR-------FDLGEIL
A0A2A4G4B1      ------------------------------MISSGSPLKHDDEME--------IDLQELL
A0A0P7X1V8      -------MTDTNGHNTNGYNGRYRGEEIANQYSGQAGLQREDNDDE-------IDLLQIF
A0A6P1P355      ----------------------------------MTDNNQTTQEE--------SLFDSLA
A0A5C8KAD6      ------------------------------------------------------MFLDLV
A0A5N1J695      --------------------------------MLQVNKDIPNSEE--------SMFSSLM
A0A3B0C2S4      ------MPILGCLFKIVSVFLPHIFNLKKRMAESPFSLDYDETEES-------VNLWEVA
A0A3N2M1H3      --------------------------------MDNTKTKPEGISGFSD-----FSIKDYI
A0A4S2G8T2      --------------------------------MDNTKTKPEGISGFSD-----FSIKDYI
A0A212K7W5      -------------------------------------MKRNTEEDF-------IQIQDLW
F5IU11          -------------------------------------MKKNTEEDF-------IRIQDLW
A0A7C1QWC7      -------------------------------MSNKNDIRPDT-----------FNVKEFI
A0A352Z1R7      --------------------------MTSNVSIPPSQPLLRSGEN--------AHIYDYL
A0A3N2N6F7      ----------MQNNTQ--------QPLSQQMPVYQAAPVVSEEEDS-------INISDFL
A0A4P7VVU7      ----------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------FNLHDFF
A0A2V1ILM4      ----------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------FNLHDFF
A0A3N2L0E8      ----------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------FNLHDFF
A0A3N2LFC5      ----------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------FNLHDFF
A0A0A2F501      --------------------------MKQEENSRSAQGALAEQDSF-------LSLRDLW
R5B7P0          -----------------------------MENNINTDNNTRQQEET-------VQIGQLV
R5B0L5          ------------------------------MEEPTEHTPQQLSTTQ-------VKISDVI
A0A6I1TEC0      ------------------------------------MLRRNQGDDF-------LRLQDLF
A0A3R5XWG1      ------------------------------------MLRRNQGDDF-------LRLQDLF
A0A5P0Y910      ------------------------------------MLRRNQGDDF-------LRLQDLF
A0A414YFM3      ------------------------------------MLRRNQGDDF-------LRLQDLF
A0A6A7UIA7      ------------------------------------MLRRNQGDDF-------LRLQDLF
A0A6A7VPS3      ------------------------------------MLRRNQGDDF-------LRLQDLF
A0A374THP7      ------------------------------------MLRRNQADDF-------IRLQDLF
A0A6G1VND1      --------------------MIQNTTPANQPAQVNPLLRRNQADDF-------IRLQDLF
A0A0A2EVS5      -------------------------------MDEKVTTYKRNVEEY-------FSLKEIF
A0A1T4NAJ7      -------------------------------MDEKVTTYKRNVEEY-------FSLKEIF
A0A255T941      ------------------------------METNNNNQTNEQNDDF-------LRLQDLW
A0A3N2KCL3      ----------------------------MAETIKSEARKSVNAGSA-------VPLTDIL
A0A4P7VSV0      ----------------------------MAETIKSEARKSVNAGSA-------VPLTDIL
A0A2V1IJY1      ----------------------------MAETIKSEARKSVNAGSA-------VPLTDIL
A0A4P7VXK7      ----------------------------MAETIKSEVRKSVNAGSA-------VPLTDIL
A0A1Y4CHN5      -----------------------------MADNISANNQVKQSEDF-------ISIQDFL
A0A1M6I2S6      -------------------------------MIEKKTAVGKPADDF-------IRIQDLW
A0A1Y3V692      -------------------------------MIEKKTAVGKPADDF-------IRIQDLW
F3PXM2          -------------------------------MIENKNAVGKPADDF-------IRIQDLG
A0A174AHH7      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A174JCE8      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A3E4JMC4      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A412SND6      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A414IEQ9      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A6I0U0V8      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A6L5S9H7      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A0M1W8D8      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A3R6GKX5      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A7V4S1          -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
B0NU19          -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
D4V601          -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A4Q0U3M9      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A4R4H1Q2      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A6I0GII7      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A6I0KYU7      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A397WLT5      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A6A2J529      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A6L6P8N9      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A6N8DDD8      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A015XH67      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A078RZN2      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A4R4I3T9      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A6L0K5          -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A7ACT5          -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A6KY94          -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
A0A173UQR8      -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
A0A3R6HK75      -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
A0A412B7D1      -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
A0A412VNY9      -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
A0A414LTU9      -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
I9Q4U4          -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
A0A373ISF0      -------------------------------MIEKKAAAGKPADDF-------IRIQDLW
U6RF62          -------------------------------MIEKKAAAGKPADDF-------IRIQDLW
A0A662ZZD5      -MDQRRFIPHFVGCANIQVTFRKGITLYFYNMTEKKTTASKPADDF-------IRIQDLW
A0A3A5TI83      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A415NEB6      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A6I0I238      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A7AJ60          -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A6A2JF01      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A6I0Y2Y2      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A6I2Q447      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A395YYT3      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A015UXN7      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A5M5W148      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A6I2NTL0      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A016E4F9      -------------------------------MIEKKTIVGKSTDDF-------IRIQDLW
A0A4Q5CFJ7      -------------------------------MIEKKTIVGKPTDDF-------IRIQDLW
A0A6N3HG44      -------------------------------MIEKKTIVGKPTDDF-------IRIQDLW
A0A6H9P0U9      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A108TH71      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
I8VXH0          -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A412S0N6      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A412IIJ0      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A0P0FM97      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
R6KTP3          -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A139LU87      -------------------------------MVEKKTPVGNPADDF-------IRIQDLW
A0A1C6B3Y5      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A6L3KCD1      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
E2NMQ4          -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A412YDB9      -------------------------------MVEKKTPAGKPADDF-------IRIQDLW
R7DY01          -------------------------------MVEKKTPAGKPADDF-------IRIQDLW
A0A414LGK8      -------------------------------MVEKKTPAGKPADDF-------IRIQDLW
A0A415IPQ4      -------------------------------MVEKKTPAGKPADDF-------IRIQDLW
A0A3E5BRW7      -------------------------------MVEKK----KPADDF-------IRIQDLW
K9DXS6          -------------------------------MVEKK----KPADDF-------IRIQDLW
A0A1M6KFV3      -------------------------------MVEKK----KPADDF-------IRIQDLW
A0A1Q6G7L3      -------------------------------MVEKK----KPADDF-------IRIQDLW
A0A413H235      -------------------------------MVEKK----KPADDF-------IRIQDLW
A0A1M5B2J8      ------------------------------MATIQKKIQVHNTQDF-------IRIQDLL
A0A255RCT5      ------------------------------MATIQKKTQVQNTQDF-------IRIQDLL
A0A1Y4GLF5      ------------------------------MAINKDTTKNKQTDDF-------LRIQDLF
A0A1H3XSC0      ------------------------------MSINQK--RPTQTDDF-------IRVQDLL
A6LE40          -----------------------------MMTINPKNTKPGQQDDF-------LRIQDLL
A0A4Y1VPX5      -----------------------------MMTVNQKNIKPGQQDDF-------LRIQDLL
A0A6N2XMM4      -----------------------------MMTVNQKNIKPGQQDDF-------LRIQDLL
B3JI46          -----------------------------MMTVNQKNIKPGQQDDF-------LRIQDLL
A0A358R8U0      ------------------------------MEMTQNTSPAEPMDDS-------IQIKDLL
R6WSB6          ------------------------------MEMTQNTSPAEPMDDS-------IQIKDLL
A0A401LPX7      ------------------------------MATIQNKSTVQNMQDF-------ITIQDLF
A0A6G0GNY9      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A6I1BFM0      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A3A5Z900      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A285TGL6      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A3A5RFX4      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A1Q6IUW9      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A413XDP6      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A6N8CVT6      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
K6AP24          ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A6I2NHV3      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A662ZYI7      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A078RYI7      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
C7XEQ8          ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
D7INX6          ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
K5ZG55          ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A3N2N9B8      -------------------MAELLDLSSAPASPSATTRKKTAASNT-------LPISDIL
A0A3N2NMI0      -------------------------MAENNATAPAQRRKKTPESTP-------VPIVDII
A0A359I8H7      ------------------------------MSDNINVTQESEAAEE-------FSLKDFL
A0A3N2KA63      ------------------------------MSDNINVTQESEAAEE-------FSLKDFL
A0A4Q0IMT7      ------------------------------MSDNINVTQESEAAEE-------FSLKDFL
A0A3B9FAU3      ------------------------MATNNSLESEKNYSATAENNELENGG---FNLRMLL
A0A3C1E5L7      ------------------------MATNNSLESEKNYSATAENNELENGG---FNLRMLL
A0A4Q0UAV1      -------------------------------MPTKMQAAPKRPADS-------INIKELL
A0A354SN68      -------------------------MYTNMDNNENTSLSTEKVEDE-------FVLKDFL
A0A6L5XFL0      -----------------------MAEDYYYGQDQDKNENQS------------LNIQDFL
A0A3N2N595      ---------------------------MAEVNKIQSNKKSGAAGA--------VPLSDII
A0A0A2DUD9      -------------------------MIQNTTTVVEKPAAEGQQENF-------FSLQDLW
A0A3P1ZBJ5      ------------------------------MVENEVNAPQNEQTTG-------VDIQDIL
R5FHS9          --------------------------MPNNQIQSQQPQQNQQSDDS-------VVITDFL
A0A413TW79      -------------------------------MQNAPGRRPQQAEDF-------IRLQDLM
A0A3E5E9M7      -----------------------MIQNNQATMQNVLVRRPQQAEDF-------IRLQDLM
A0A3E4SK73      -----------------------MIQNNQATMQNVPGRRPQQAEDF-------IRLQDLM
A0A415GGC6      -----------------------MIQNNQATMQNVPGRRPQQAEDF-------IRLQDLM
A0A413DBH9      -----------------------MIQNNQATMQNVLVRRPQQAEDF-------IRLQDLM
A0A1Y4PQK7      -------------------------------MTIQNNTKPGQADDF-------LRIQDLF
A0A1Y4IH41      -------------------------------MAIQNNTKPGEADDF-------LSIQDLF
A0A3A6AAP4      -------------------------------MAIQNNTKPGQADDF-------LRIQDLF
A0A6I0ZRD2      -------------------------------MAIQNNTKPGQADDF-------LRIQDLF
A0A1Y4DYA7      -------------------------------MNENNTKSDLFLQES-------LNLKDLL
A0A1Y3X4I9      ------------------------------MSTLSDKETELFLDELEKSSSSGINFKDLM
A0A1Y4FNK8      ------------------------------MATQNNPARPKQADDL-------IRIQDLF
A0A355FD59      -----------------------------MALSQNNNVKQKQPEDF-------IRIQDLF
A0A359CEZ9      -----------------------------MALSQNNNVKQKQPEDF-------IRIQDLF
A0A353Q7B4      -----------------------------MALSQNNNVKQKQPEDF-------IRIQDLF
F8X3A5          -----------------------------MTSVQHNKTERKQTEDL-------IRLQDLL
A0A1M3KVR9      -----------------------------MTPVQHNKTEQKQTEDL-------IRLQDLL
A0A4Y9IJS3      -----------------------------MTSVQHNKTEQKQTEDL-------IRLQDLL
A0A495WI87      ------------------------------MAAVQNNPKSKQSEEF-------MRIQDLL
A0A354M4S6      ------------------------------MAAVQNNPKSKQSEEF-------MRIQDLL
R7DH52          ------------------------------MAAVQNNPKSKQSEEF-------MRIQDLL
A0A4Q5E7L5      ------------------------------MTINQKNTKPGQQNDF-------LRIQDLL
A0A4P8LP09      ------------------------------MAVNQKNTRPGQADDF-------LRIQDLL
A0A4R4GZU7      ------------------------------MAVNQKNTRPGQADDF-------LRIQDLL
A0A016CWA4      ------------------------------MAVNQKNTRPGQADDF-------LRIQDLL
A0A1C6H117      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A0M1W0V2      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A139KA16      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A174VQ92      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A1Q6HCG0      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A1Y4JYM9      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A3A5QW67      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A3A5RQE6      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A3A6BP07      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A3E5E153      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A3Q9IP20      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A412WV15      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A413ICP6      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A414KYB9      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A5B3FWR2      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A6L4P3V7      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
E5WX00          ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
K0X3P3          ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A415TAH7      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A078T2W6      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A6I1AQV4      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A5C6L2P1      ------------------------------MTVNQKNIKPGQQDAF-------LRIQDLL
A0A412MJT7      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3E4WKT5      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3A5YY33      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A078TAH2      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A1E9CFZ7      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A373FYU5      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3A5TZ72      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3A5XBP2      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3A6MEG9      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3E4JP35      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3E4KP40      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3E4NX82      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3E4XFU8      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A412RG70      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A412TD37      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A413GAA4      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A414M7I4      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A496BTA0      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A496D2V6      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A4Q5G1P5      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A5C6KCA6      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A5M5AHM5      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I0KZV6      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I0Y5K7      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I1BFB8      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I2P5W5      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6N8DC51      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
E5UZA2          ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A069SMG6      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6A2RTB3      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I0VY00      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A1M4YZ07      ------------------------------MSINQKNTKPGQPDDF-------LRIQDLL
A0A0P0FQW1      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A5M5C0W6      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I0H151      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A642LZ22      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I0HI59      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A642NJ89      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I0HI52      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6L3JTQ2      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6L4EED9      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I0YVB5      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6L5RHE2      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6N3AEV2      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6L3KG29      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6G0G4T5      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I0HFG9      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A4Q5E5M7      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6L4F5W0      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
C3RFN5          ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A3A5Z014      ------------------------------MTINQKNIKPGQQDDF-------LRIQDLL
A0A6I0ING7      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A6L5S265      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A078S3Q8      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A069SJV7      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A3E5DXI5      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A3E5EM98      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A3E5F453      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A6N2YYD4      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
I9T3G6          ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A3E4SYU0      ------------------------------MAINQKNTKPGQPDDF-------LRIQDLL
A6LGY1          ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
K5ZSH4          ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A1H4ADG3      -----------------------------MQTTTLDQLVPVKETK--------FDFTKIF
A0A5B8VUR8      -----------------------------MHTNTLDRLVPIKESK--------FDFTKVI
A0A0D3L8Q3      ----------------------------MTDQDNLL---LEDSEQ--------INFKEII
A0A2N3U785      -----------------------------MNKKDIF---LAEPEN--------FDLRGVL
A0A5B6TJH8      -------------------------MQRLAGTEELFPLKAEKKDN--------NDIRNTF
A0A519U664      -----------------------------MDNKELFPLSSEQPES--------KDFKRII
A0A519MA34      ----------------------------MDNNKELFPLSSEQPES--------KDFRRMI
A0A519UCX0      ----------------------------MDNNKELFPLASEQPES--------RDFKRVL
A0A0E3ZG78      -----------------------------MMDKELFPLSSERAGE--------KDIRRIL
A0A1I6BRK6      -----------------------------MDSQELFSSDLSQAKA--------GDLKNIV
A0A243WAB1      -----------------------------MNTRELFPLNSEQVEE--------KDIKRMV
A0A6G8C8X6      -----------------------------MENKELFPLSSEQTEA--------KDIRGLI
A0A416GA42      -----------------------------MEQQNKQNVS-GSGLE--------LNPMDLL
A0A1T3IYP5      ---------------------------MDTIKQKNYIIENKKEQS--------INVLDLL
A0A1T5K9D4      ---------------------------------MENGNNQKNSGQ--------INLVDIF
A0A077ENE7      ---------------------------MNTINQKGYTIGDKKEHS--------INLLDIL
A0A6I5UW06      ---------------------------MNTINQKGYTIGDKKEHS--------INLLDIL
T0NN57          ---------------------------MNMASQKINMTKESKEQF--------INVLDLL
X5K347          -----------------------------MASQKINMTKESKEQF--------INVLDLL
A0A060RD97      -------------------------------MVENKINNEQDPKS--------LTARQVV
A0A3C1ITV0      -------------------------MKEDYNSIGAAETE-DQKNE--------FQLSDMI
R7HN19          -------------------------MKEDYNSIGAAETE-DQKNE--------FQLSDMI
A0A350IHV0      --------------------MALENNNIDNRPALRNANGEEDGDI--------LSLTEIW
R5RVP0          -----------------------MPIDNNLDNRPSQVRNEEENDL--------LNLADLW
R6A0L2          -----------------------------METKSINPQE-QQDEE--------MQLIPLL
R7LG80          ------------------------------MNNVPDTFK-RDEEE--------MQIIPLL
A0A2L2WX98      -------------------------------MENTNNAT-IEKEE--------AQLIPLL
A0A6N8KXI9      --------------------------MSNTANNYQPIEGLNAHKT--------INLLDIV
G5GD56          --------------------------------MSGSVQNKNKEED--------IQLIPLF
R5KD55          -----------------------------METNPVTQQTEETTEE--------ISIRDIL
A0A174QNT3      ---------------------------METNKTTDLKRTEN---V--------VTLRDLL
A0A4S2FGS1      ---------------------------METKKTTTSSPKEN---V--------ITLRDIV
R9I0H0          ---------------------------METKKTTTSSPKEN---V--------ITLRDIV
K5BUT9          ---------------------------MEYIQENERTLKKDEG-G--------INLRDVV
A0A174FPA3      ---------------------------MEYIQENERTPKKDEG-G--------INLRDVV
R6S9Y6          ---------------------------MEYIQENERTPKKDEG-G--------INLRDVV
A0A642LIH6      ---------------------------MEYIQENERTPKKDEG-G--------INLRDVV
C9KX15          ---------------------------MEYIQENERTPKKDEG-G--------INLRDVV
A0A6H0KRK1      ---------------------------MEYTQENNEKTVKESGFN--------INLRDIV
R6DAG6          ---------------------------MEYTQENNEKTVKESGFN--------INLRDIV
A0A3L8AAP1      ---------------------------MEYTQENNEKTVKESGLN--------INLRDIV
A0A4S2AYX2      ---------------------------MEYTQENNEKTVKESGLN--------INLRDIV
A0A4Y9H477      ---------------------------MEYTQENNEKTVKESGLN--------INLRDIV
A0A0E2M2Y7      ------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------FSIEEYL
A0A0K2J6Z0      ------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------FSIEEYL
B2RKZ8          ------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------FSIEEYL
A0A212GC82      ------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------FSIEEYL
A0A254MU12      ------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------FSIEEYL
R6CQ93          --------------------------------MQNNNLSGKNEQS--------INLVDLF
A0A3D1NQW3      ----------------------MTPNNINPNSANSDTKQ-EEHIT--------FSVHDLI
B0MT10          ----------------------MTPNNINPNSANSDTKQ-EEHIT--------FSVHDLI
R7JGW9          ----------------------MTPNNINPNSANSDTKQ-EEHIT--------FSVHDLI
A0A3D2BF46      -----------------------MEE-NRNVNNVPAEGN-EDSIN--------FSIHDLI
A0A358R538      -----------------------MTE-RTINPQ---PAE-ETTGN--------VTLHDIL
A0A1Y4AAB8      -----------------------MIEQTPNTQHAPQNET-SEAGM--------FSLHDLI
A0A1Y3WWY9      -----------------------MIEQQPNNIPQQAFND-DQAGT--------INLHDII
A0A1Y4U5L4      -----------------------MIEQQPNNIPQQAFND-DQAGA--------INLHDII
A0A1Y3VCJ1      -----------------------MAE-IQFNTQTRDKIH-DQTPA--------IDLHDII
A0A1Y3QTW7      -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
R6XWY7          -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
A0A4Y1X9Y9      -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
A0A4Y1WM66      -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
A0A6N4GYT3      -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
A0A174AVF1      -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
A0A656Q4F4      -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
A0A1Q6EIY0      -----------------------MTE-QNINPHLLNGES-ENTNG--------ITLHDLI
A0A5B5VN71      -----------------------MTE-QNINPHLLNEES-ENTNG--------ITLHDLI
E4M8L3          -----------------------MTE-QNINPHLLNEES-ENTNG--------ITLHDLI
I3YQ50          -----------------------MTE-QNINPHLLNEES-ENTNG--------ITLHDLI
R5UEY8          -----------------------MTE-QNINPHLLNEES-ENTNG--------ITLHDLI
A0A1H4D866      -----------------------MTE-QQINSPQQQGND-EMTGA--------VTLHDII
A0A5B3G4Y7      -----------------------MAE-QQINSQIQTNNE-ELTNT--------ITLHDII
A0A374A9J5      -----------------------MAE-QQINSQIQTNNE-ELTNT--------ITLHDII
A0A5B3GQN5      -----------------------MAE-QQINSQIQTNNE-ELTNT--------ITLHDII
A0A1Q6E9S3      -----------------------MAE-QQINSQIQTNNE-ELTNT--------ITLHDII
D4IJ36          -----------------------MAE-QQINSQIQTNNE-ELTNT--------ITLHDII
A0A414Q925      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A415PUS9      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A108TCU0      ---------------------MGKDRFEDLDFIDFNDNR-RQEGT--------V-IADML
A0A413BA42      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
S3Y344          ---------------------MRKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A4Q5G8Y8      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A412TGL3      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A413VJ33      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A414L0W6      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------M-IADML
A0A412DP39      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADVL
A0A413ZSE8      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
B0NP84          ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
R6AK43          ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A412N2D9      ---------------------MGKDRFEDLDFIDFNDSR-QQEST--------V-IADML
A0A1Y4JYS9      ---------------------MGKDRFEDLDFIDFNDSR-QQEST--------V-IADML
R6LHA4          ---------------------MGKDRFEDLDFIDFNDSR-QQEST--------V-IADML
A0A3E5HPT8      -----------------------------------MALT-EEEKS--------INIVDLF
C6IJ48          -----------------------------------MALT-EEEKS--------INIVDLF
Q8A3U2          -----------------------------------MALT-EEEKS--------INIVDLF
A0A3R6S1H6      -------------------------------MKNEELIE-DGTNA--------LNLIDLW
A0A3R6SD81      -------------------------------MKNEELIE-DGTNA--------LNLIDLW
A0A354WXN6      -MVVCSIRLGGCSLLNCHIIQQITQSTVMEQQENNKNIE-QEEQE--------LNILDLV
R5IP14          -------------------------MAKEQQEIYGQQVEESTDNG--------LSLRDIL
A0A316SZX7      ---------------------------MSEQNINQPQQNAPAEEE--------INLRDIL
A0A1Y4AIY1      ---------------------------MKVENPSNGPRWNEANSG--------VTLGDIF
A0A0J6CIR2      -----------------------------------MNLR-REENE--------LNLSDLF
A0A3D8HG59      ---------------------------MEPNQELENLQQ-QEENE--------LNLGDII
A0A3R6S408      ---------------------------MEPNQELENLQQ-QEENE--------LNLGDII
F3ZRU7          ---------------------------MEQQNLDNKIQQEHTEQE--------IDLVEIG
A0A1C5Q1F3      --------------MDLRDFGFNFNCHLNIGCEMTNRKNTQSDHT--------LHVGDWL
R7A239          --------------MDLRDFGFNFNCHLNIGCEMTNRKNTQSDHT--------LHVGDWL
A0A3R6HIK7      ---------------------------MSTEYNPENNIRIEEESV--------LNLWDLF
K5ZVW7          ---------------------------MSTEYNPENNIRTEEEST--------LNLWDLF
A0A1Y4D5Z0      -------------------------MIDNRENTQRDYAQ-ENENT--------LNLWDLL
A0A413VXJ7      ---------------------MSTEQNINKESKT-SKNS-KQEEE--------ISIADIL
I9RSN9          ---------------------MSTEQKINKESKA-SKSS-EKEEE--------INIADIL
U6RJK5          ---------------------MSTEQKINKESKA-SKSS-EKEEE--------INIADIL
A0A1Q6GA32      ---------------------MSTEQKINKESKA-SKSS-EKEEE--------INIADIL
I9RPU6          ---------------------------MNTEYKN-NDVR-KQEPE--------INITDIL
I8YFS5          ---------------------------MSIESQN-SELR-EKESE--------ISIVDIF
A0A6L3FCC6      ---------------------------MSIESQN-SELR-EKESE--------ISIVDIF
I8Y597          ---------------------------MSIESQN-SELR-EKESE--------ISIVDIF
A0A1Q6GBF5      ---------------------------MNTEQKN-NNNP-GQESE--------INITDIF
I8YFZ3          ---------------------------MSAEYKN-NDIR-KQESE--------INITDIF
A0A1Q6GDH2      ---------------------------MNTEYKN-TDVR-KQEPE--------INITDIL
U6RSB0          ---------------------------MNTEYKN-NDVR-KQEPE--------INITDIL
I9SIK1          ---------------------------MNTEYKN-NDVR-KQESE--------INISDIF
I9GXM2          ---------------------------MNTEYKN-NDVR-KQESE--------INISDIF
I9TP59          ---------------------------MNTEYKN-NDAR-KQESE--------INISDIF
R5S343          --------------------------MKNTEQDL-FEFE-EEKSG--------LTLRDMI
A0A1M6K7I9      ---------------------------MNEEQKVQSNMT-AQEEQ--------INIADLL
A0A5M6A8C8      ---------------------MKSEQQMNEEQKVQTNMA-VQEEQ--------INIVDLL
A0A6L3FBE6      ---------------------------MNTESQNNNDIR-EQDLE--------INLIDIF
A0A6L3FNG1      ---------------------------MNTEPQNNNEIR-DQESE--------ISIVDIF
A0A3R5ZMK1      ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
A0A6L6NFJ9      ---------------------------MNTEQET-N-TR-VEENE--------LNLEDIL
A0A1Y3ZIA4      ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
K5Y1A4          ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
A0A4Q5CIT0      ---------------------------MNTEQET-N-IR-MEENE--------LNLGDIL
A0A6L6NWL9      ---------------------------MNIEQET-N-IR-MEENE--------LNLGDIL
A0A3R6K8X4      ---------------------------MNIEQET-N-IR-MEENE--------LNLGDIL
A0A6N8D6C8      ---------------------------MNIEQET-N-IR-MEENE--------LNLGDIL
A0A3R6BKI7      ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
A0A6N8CW60      ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
A0A412M2W1      ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
K5ZX55          ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
A0A415BDM7      ---------------------------MNTEQET-N-IR-MEENE--------LNLGDIL
A0A6L6MX19      ---------------------------MNTEQET-N-IR-MEENE--------LNLGDIL
A0A1Q6I3T6      ---------------------------MNTEQET-N-IR-MEENE--------LNLGDIL
A0A414XX40      ---------------------------MNTEQET-N-IR-MEENE--------LNLGDIL
A7AEU7          ---------------------------MNTEQET-N-IR-MEENE--------LNLGDIL
A0A5F0U645      ---------------------------MNPEQET-NMLR-EEENE--------LNLIDMY
K5ZBN2          ---------------------------MNPEQET-NMLR-EEENE--------LNLIDMY
A0A0J6CKW3      ---------------------------MNPEQET-NMLR-EEENE--------LNLIDMY
A0A0F5IQM7      ---------------------------MNPEQET-NMLR-EEENE--------LNLIDMY
A0A496CDT3      ---------------------------MNPEQET-NMLR-EEENE--------LNLIDIY
A0A6G1ZKM3      ---------------------------MNPEQET-NMLR-EEENE--------LNLIDMY
S0GLB0          ---------------------------MNPEQET-NMLR-EEENE--------LNLIDMY
A0A3R6NLC1      ---------------------------MNPEQET-NMLR-AEENE--------LNLIDIY
A0A416WYC9      ---------------------------MNPEQET-NMLR-AEENE--------LNLIDIY
A0A0F5IT40      ---------------------------MNSEQET-INLR-REENE--------LNLSDLF
A0A496CX20      ---------------------------MNSEQET-INLR-REENE--------LNLSDLF
A0A5F0UBI0      ---------------------------MNSEQET-INLR-REENE--------LNLSDLF
A0A6G1ZHG0      ---------------------------MNSEQET-INLR-REENE--------LNLSDLF
S0GSI7          ---------------------------MNSEQET-INLR-REENE--------LNLSDLF
K5YB65          ---------------------------MNSEQET-INLR-REENE--------LNLSDLF
A0A0F5IWP9      ---------------------------MNSEQET-TYLR-GEENE--------LNLKDLF
A0A0F5IZT8      ---------------------------MNSEQET-TYLR-GEENE--------LNLKDLF
A0A417LKQ2      ---------------------------MNSEQET-TYLR-EEENE--------LNLRDLF
A0A416TME1      ---------------------------MNSEQET-TYLR-EKENE--------LNLNDLF
A0A416XPE8      ---------------------------MNSEQET-TYLR-EKENE--------LNLNDLF
L8JI02          -----------------------------------------MNDK--------INIKGIV
A0A4Q5WS95      ------------------------------------MINRPDQKS--------TPFVEAF
A0A501VZX6      ----------------------------------------MPSSE--------NNIFSSL
A0A399SH26      ---------------------------------MSSSINNAPNNE--------ENLLTVL
A0A501W1A9      ------------------------------------MDKNKSTKE--------DNLFGAI
A0A0E3ZGV6      ------------------------------------MDKNKVNAE--------DNLVASL
A0A1I2N4S1      ------------------------------------MDKNKTNSE--------DNLAVAL
A0A2T5YE44      ------------------------------------MDKNKTNSE--------DNLAVAL
A0A1M5BA90      ---------------------------------MEPKRHAT-EKE--------KNAVEAF
A0A512B879      ---------------------------------MEAKRPIILKKE--------KGVVERF
A0A559PPI3      -----------------------------------MSYNNKSAKN--------ENLFSSM
A0A1T5CS78      -----------------------------------MKYNSNTGKE--------DNLFRYI
A0A0Q9Z8F1      -----------------------------------MKYNSKTGKE--------DNLFRYI
A0A2N0U0M7      -----------------------------------MKYNSKTGKE--------DNLFRYI
A0A1V9FHD0      -----------------------------------MQTHKKTGNE--------MNIISLA
A0A4V4H170      -----------------------------------MQTNKKTGNE--------MNIVSVA
A0A1V9F098      -----------------------------------MQTNKKTGNE--------MNIISVV
A0A4R2VU64      -----------------------------------MQTNKKTGSE--------MNIISVV
A0A4S8HY23      -----------------------------------MITNKKTGNE--------MNFVSVA
A0A1V9F383      ---------------------------------MQPNIN--TKNE--------KNIGSLI
G8TRZ6          ---------------------------------MQTNINSKSKSE--------KNIGSLI
A0A4R5DL69      ------------MASYLENITSIESGS--------TVNHTLTQTI--------RRLISLW
A0A1M4YED3      ---------------------------------MSAPKHTQEPQE--------ENILSIL
A0A2H3NSN0      ------------MNTNDQNALDIRRKKVEQIGLSRSDNSDTESNA--------VDLNTIW
A0A2P6C324      ------------MNDTSQNLTPYRKQA-EKIGLQSSNSGS-DDNT--------LDLGALW
A0A7C2DZI7      ------------MARYRHHSLIVARGG-QAGGLHPNGAERHDEGR--------INFAEIW
A0A1M6XHU0      ------------MAHYRHHSLIVARGG-QRGGLPPASSETRDEGR--------INFAEIW
G2SF81          ------------MAHYRHHSLIVARGG-QRGGLPPASGETRDEGR--------INFAEIW
A0A5S9EYW1      ------------MAHYRHHSLIVARGG-QRGGLPPASDEKRDEGR--------INFAEIW
D0MHQ9          ------------MAHYRHHSLIVARGG-QRGGLPPASDEKRDEGR--------INFAEIW
A0A126PFG0      ------------MEPFNGQVSTFYTAA-------------TASQP--------LNLRAVL
A0A3M1N7Z3      --------------------------M-------------PIQQE--------WDLRRVL
                                                                            

A0A1T5MMH4      V----I----VRNNLVWIALIFLVIN-LTAYLI-IRY-TQDRYESFSEIKLDVK-DE---
A0A2W4R1L8      T----I----IRNNRLWILAIFVVIN-LLTYLLFIRY-SPDLYESHSEIKLDIR-NE---
A0A2E5CV79      G----I----LRFHYKLILTITLFGI-MIFTYR-TYT-IHPVYRSTSSIIIKEK-PGT--
A0A2D4ZVH1      N----I----LLLHKWALIGITVLFT-VVAIIF-AQL-QTPIFQSTGTLIVSES-KNR--
A0A0K8QSK7      L----K----LLGKWYWFVLSVVLFL-AAAWLL-TRY-SMPVYQSSSSLLILER-SGGSP
A0A1V6CN82      S----E----LISHWYLFVLFMGIGL-AGAWLY-NRY-TTTMYSARASIMILEE--GSTT
A0A1M4XZ45      F----K----LLHNWYWFVLSIIVAL-SLAFLY-NRY-TTPVYEIKASMLVEEG-KASSP
A0A399D319      F----R----FLRNWYWFAFVVAITL-GMAFLY-NRY-TTPIYEISSSLLVEEE-KAGSP
A0A1V5IPN7      R----I----LLQYRYLIILIFVVVL-AGTIIY-TLR-QPRIYSASGRILMENQ-SSGAD
A0A1M6GR99      K----L----FFKNIWIVISCIIVAL-GIAYFY-NWY-SIPTFKVSATLLLKDN------
A6EBM4          M----V----LFSRWYIIASTTLICL-IAAYAY-LWY-TPKTYATTAILKFEEQ-KTALS
A0A7C5M4P4      I----V----LRKSIPWLLLLLLGCL-TAGYLV-YRY-TKPLYESYSEIKLDQE-NQ---
A0A1M6TTV4      Q----V----FVKNVIWMLLILLLIN-ASTVLY-VRY-TKPIYSSESILKLDIK-SE---
A0A4Q8RX32      R----K----LAKYWKVFPISILFFV-SLGVIY-NKL-AEPIYEIGAKVVVHER-QRNI-
K0X1U5          R----A----ACRKWYLFAGSVVVCV-ALVVCY-LKI-AKPVYEVSADILVNED-EKKGG
R5EXK3          R----A----ACRKWYLFVGSIVVCV-ALVVCY-LKI-AKPVYEVSADILVNED-EKKGG
A0A401UAP7      S----I----LLKNTVWILLLFILCN-LSAYLY-IRY-TKNVYEAEAEIKLEVN-NE---
A0A1W2GF52      Q----V----FASGWPWVLGILITTM-SLSFLY-MRY-TKPIYSAESILKLDIK-ND---
A0A2G5L7B8      Q----V----FIKNLPWIILILILFN-AGTFLY-LRY-TKPIYSSESILKLDIK-SD---
A0A523GAC0      T----V----LGKSWLWIMLIVLSTN-LTAYLV-IRW-TKPLFESYSDIKLNVK-KD---
L8JW09          T----V----LRKSIPWILLIFIVTN-LSAYLY-IRW-TKPLYESESELKLDVK-SD---
A0A364XUP5      V----T----IWDNILWILLIFVVTN-TAAYLV-IRY-SKDIYQSVSELKLDIK-NE---
A0A1M5RLA9      T----T----LKRNWLWLIILFLVIN-SVAYLK-VRY-TKNLYESSSELKLDIK-NE---
A0A385SFR9      I----I----FKRNWLWLVVLFLVIN-SIAYLK-VRY-TKNVYESSSELKLDIK-KE---
A0A5M4A9J4      F----L----FLSNWYWFVLAVFFTI-GAAWVY-HRF-TNPLYAVSASLLINED-KGSNP
A0A5M4B1C7      S----I----YRSYWYVFALTAGIAL-ITAWFY-HKL-TNPQYAVSASLLVNES-KGNNP
A0A0D3LFR6      S----V----LKKSLPIIVVIFLVCN-MGAYLY-IRY-TKPLFQSNSELQLTEN-KP---
M7N6D4          N----V----MKKSLPIIIVIFLVCN-LSAYLY-LRY-TKPLYRSDSELQLGVN-KQ---
A0A4D7K1D4      S----I----SRKSIPFIILIFALTI-SAAIFY-VRY-IPPLFESSSELKLDVK-DE---
A0A5C7MX19      ---------------LWIIVLTIITI-IISLVY-LRY-APKIYESNATMLFSTE-KK---
A0A1Q3ZMZ7      ----------------------------MGYIY-LRY-TKSVYESSAIIQIQDN-DQGK-
A0A2D8JJW3      Y----F----LKRNYIYILIITLFCF-LVGCFL-TLR-IKPIYSSYAEIEIVKD-DN---
A0A2W2AFF7      G----I----VMSHWVWFAVSLFLTL-ILSFVL-LRY-STPAYKINATVLINDD-QKAGN
R7PCR1          GICIVI----LQKHWMWFLTSVVLFV-VLAFVY-SRT-QPQVYQRTAVLEIEDN-NDSGS
A0A1G9E2A9      S----I----VNRSIVWVLLFVALGV-LAAWIS-LRY-IKPVYESASLLKLEVK-RN---
A0A098LL25      V----I----ANKSLVWVILLVVLSI-TGAFLY-VRY-TKPVYESSSILKLDLK-SE---
A0A6J4H627      S----I----VRKNIIWILLIPALCL-FGGYMY-LRY-TSPVYESSSSIKLEIK-QK---
A0A6C0GJI1      H----I----LKRNIFWLILIPMISL-LGGYLY-LRY-TKPLYESSSSIKLEVK-RE---
A0A2T2YJE8      S----I----IRKSLIWVSLLIVLGL-IGAFLF-LRY-TKPLFKSSSTLKIDEQ-SE---
A0A127B287      H----V----VRRSIPWVILLVLLGL-TGSYLF-LRY-TKKVYESSSVIKLEEQ-TE---
A0A6P1P2P6      H----V----VRRSIPWVLLLVLLGL-TGSYLF-LRY-TKKVYESSSVIKLEEQ-TE---
A0A3M9N829      D----V----VKRSILWVVLLILLGG-AGAYLY-LRY-TKKVYESSSTIKLDEQ-SE---
A0A0P0CSF9      H----V----AKRSIPWIILLVLLGI-GGSYLY-LRY-TKKVYESSSTIKLDEQ-SQ---
A0A5M8QQB8      H----V----VKRSIPWVLLLILLGA-GGSYLY-LRY-TKKVYESSSTLKLDEQ-SE---
A0A3M9MNC3      H----V----VRRSIPWVLLLVLLGV-SASYVY-LRY-TKKVYESSSTIKLDEQ-SE---
A0A5B6TAX2      H----V----VRRSIPWVLLLVLLGG-SASYLY-LRY-TKKVYESSSTIKLDEQ-SE---
A0A5N1IQ33      M----V----TRRSLPWMVFLILLGV-TAAWLY-LRY-TPPIYQSSSTLKIDQK-SQ---
A0A512AYT3      A----V----ARKSLIWVVLLIMLGL-AASYLF-LRY-TKPVYKSSSIIKIDEQ-SQ---
A0A5M6CYN7      A----V----ARKSLVWVILLILLGL-TASYLF-LRY-TKPIYKSSSIIKIDEQ-SQ---
A0A369QP10      S----L----VRKSLIWVALLIVLGL-IGSFLF-LRY-TKPLYKSSSTLKIDEQ-SE---
A0A126PDF2      L----V----ARRSLLWLLLLLALGG-SAAWLY-LRY-TKPVYKSTSLLKIDQR-SE---
A0A2Z3GKA1      L----V----ARRSLLWLLLLLALGG-SAAWLY-LRY-TKPVYKSTSLLKIDQR-SE---
A0A502GZP7      L----V----ARRSLLWVLLLLVLGG-SASWLY-LRY-TKPVYKSTSLLKIDQR-SE---
A0A519SBU8      M----V----ARRSLVWVALLLALGF-TASWLF-LRY-TKPVYKSASLLKLDEH-SE---
A0A4Q3JNZ3      M----V----ARRSLVWVALLLALGF-TSSWLF-LRY-TKPVYKAASLLKLDEH-SE---
A0A519Q9V3      L----V----ARQSLVWVVLLLALGF-TGAWLF-LRY-TKPIYKAASILKLDER-SE---
A0A0M3RW20      M----V----VRKSLPWMLLFILLGL-LTSWTY-LRY-TKPVYKSSSILKIDEK-QE---
A0A495VFX4      M----V----VRKSLPWMILFILLGL-LTSWTY-LRY-TRPLYKSSSILKIDEK-QE---
A0A1S9B3W0      S----V----TRRSLPWMILLILLGL-GASWTY-LRY-TKPIYQSSSTIKIDEK-TE---
A0A1W1VRL3      Q----V----ARKSLPWIALLIALGL-TSSWLF-LRY-TKPVYQSSSVLKIDEK-TE---
A0A1M6R305      M----V----VRRSLIWLLLLIGLGI-TGSWLF-LRY-TKPVYKSSSLLKIDEK-TE---
A0A4Z0PHK3      L----V----ARRSLLWIVLLIALGL-SASWLL-LRY-TKPVYKSSSLLKIDEK-TE---
A0A2M9B9H9      L----V----ARRSILWIILLIALGL-SASWLL-LRY-TKPVYKSSSLLKIDEK-TE---
A0A4Z0QCY9      L----V----ARRSLLWIVLLIALGL-SASWLL-LRY-TKPVYKSSSLLKIDEK-TE---
A0A418R9X5      M----V----ARRSLPWMVLLIMIGL-TASWLF-LRY-TPPVYRASSTLKIDEK-SE---
A0A428JSJ3      M----V----ARKSLPWMLLLIALGV-TASWLF-LRY-TPPLYKASSTLKIDEK-SE---
A0A428KI59      M----V----ARKSLPWMLLLIALGV-TASWLF-LRY-TPPLYKASSTLKIDEK-SE---
W8F1I6          M----V----ARKSLPWMLLLIVLGV-TASWLF-LRY-TPPLYKAASTLKIDEK-SE---
A0A246FQC0      M----V----VRKSLPWMVLLIALGL-TASWLF-LRY-TPPLYKSTSALKIDEK-SE---
A0A372E5P8      T----V----ARRSLPWIILLVALGL-TAAWLF-LRY-TPPLYKSSSTLKIDEK-TE---
A0A1H3EMW1      A----V----ARKSLPWMVLLIGLGL-TAAWLF-LRY-TPPLYKSTSTLKIDEK-TE---
A0A1H9ZSN3      T----V----ARRSLPWMVLLVVLGL-TASWLF-LRY-TPPLYKSTSTLKIDEK-TE---
A0A5N1J2M4      Q----V----TRKSLVWVLLLIMLGL-FGAYMV-IRY-TPKLYDSTSLIKIDEK-KE---
A0A519S476      M----V----ARRSLIWVVLLLALGF-TSSWLF-LRY-TKPVYQSASLLKLDEK-SE---
A0A4Q3JRW8      M----V----ARRSLVWMLLLLALGF-TASWLI-LRY-TKPIYKAASVIKLDER-SE---
A0A519M923      L----V----ARRSLVWVVLLLALGF-TASWLF-LRY-TKPVYRAASLLKLDER-SE---
A0A4Z0ENW1      L----V----ARRSLLWVIVLLALGI-TASWLY-LRY-TKPIYEATSILKIDDR-SD---
A0A519UDB4      L----A----VRRSLPWAALLILLGL-TSSWLY-LRY-TKPIYRASSILKIDER-SN---
A0A3S0QKV1      S----V----TRRSLPWMLLLLLLGL-AASWTY-LRY-TKPVYQSSSTIKIDEK-RQ---
A0A328BL48      S----V----ARRSLPWMILLVLIGL-AASWSY-LRY-TKPLYRSSSTIKIDEK-QQ---
A0A5R8WLY4      S----V----ARRSLPWMILLVLIGL-AASWSY-LRY-TKPLYRSSSTIKIDEK-QQ---
A0A1I5WSL8      L----V----ARRSLLWLILLIALGL-TASWLY-LRY-TKPVYKSQSLLKIDER-NE---
A0A0U3JVM7      L----V----ARRSLLWMLLLVGLGV-TASWLY-LRY-TKPVYKSASLLKIDER-NE---
A0A1G1SSV2      L----V----ARRSLLWMLLLIMLGT-TASWLY-LRY-TKPVYKSASLLKIDER-NE---
A0A1G1SXV7      L----V----ARRSLLWMLLLITLGL-TASWLY-LRY-TKPVYKSASLLKIDER-NE---
A0A6G8CBJ6      Q----V----ARKSLPWIALLIALGL-TGAWLF-LRY-TKPVYQSSSVIKIDER-TE---
A0A0W8EDI5      M----V----TRRSLPWMVLLIALGL-TAAWLY-LRY-TQPVYQSASTLKIDQK-TQ---
A0A3B7RBP8      M----V----VRRSLPWMILLVLLGV-TAAWLY-LRY-TQPIYQSSSTLKIDQK-TQ---
A0A3R9P8H7      T----V----ARKSLPWMLLLIALGL-TAAWLF-LRY-TPPLYQSSSTLKIDEK-TE---
A0A238WIA7      M----V----ARKSLPWVLLLVMLGL-LTSWLF-LRY-TRPVYQSSSVLKIDEK-TE---
A0A212UCJ7      M----V----ARKSLPWVLLLISLGL-LASWLF-LRY-TSPVYQSSSTLKIDEK-TE---
A0A4Z0MQE1      M----V----ARKSLPWVLLLVILGL-LSSWLF-LRY-TSPVYQSTSLLKIDEK-TE---
A0A4Z0PCF4      M----V----ARKSLPWVLLLVILGL-LSSWLF-LRY-TSPVYQSSSVLKIDEK-TE---
A0A6M6BED0      M----V----ARKSLPWVLLLVALGL-LCSWLF-LRY-TSPVYQSSSTLKIDEK-TE---
A0A5D6VDG1      M----V----ARRSLPWMMLLILLGL-AAAWTF-LRY-TKPLYKSSSTLKIDEK-ED---
A0A6H1CVS0      M----V----ARRSLPWMVLLILLGI-TAAWTF-LRY-TKPLYKSSSTLKIDEK-ED---
A0A243WHR7      L----V----ARRSLIWVVLLIVLGL-TGSWLY-LRY-TKPVYQSLSILKIDEK-TE---
A0A5B8A0P6      T----V----ARKSLPWIVLLIALGL-TGSWLF-LRY-TKPVYKSSSLLKIDER-TE---
A0A076HRT9      M----V----VRRSLLWLLLLIGLGL-TGSWLF-LRY-TKPVYKSSSLLKIDEK-TE---
A0A4Z0PVM7      L----V----ARRSLLWIILLIALGL-SASWLM-LRY-TKPVFKSSSLLKIDEK-TE---
A0A1M6DHW8      L----V----ARRSLIWIVLLIALGL-TASWLF-LRY-TKPIYKSTSLLKIDEK-TE---
A0A4Q5LC61      L----V----ARRSLIWIVLLIALGL-TASWLF-LRY-TKPVYKSTSLLKIDEK-TE---
A0A2N5YXE2      T----I----FKKNFWLILIIFVVSL-AAGYAY-FRY-TRPVYKTTTVLQIKNE-NKT--
K0XJ09          E----L----VFDNWYWIVLSVVICM-SVAWFY-LAM-QTPLYKRSAVMLVKSE-NKSGN
R5EUZ0          E----L----VFDNWYWIVLSVVICM-SVAWFY-LAM-QTPLYKRSAVMLVKSE-NKSGN
W0EQS0          E----L----IFDNWYWIVLSIAVCV-SVAWLY-LAM-QTPLYKRTAVMLVKSE-NKSSN
A0A1Y3WE15      E----L----IFDNWYWIVLSVAVCV-LVAWLY-LAK-QTPLYKRSAVMLVKAE-NKSNN
A0A1Y4GUK3      E----L----IFDNWYWIVLSVAVCV-SVAWFY-LAM-QTPLYKRSAVMLVKAE-NKSNN
A0A2U1FKU2      F----S----LLSSWKWIVGSVVACA-LIAYIY-VQN-QSPVYHAQATVLIKSA-EKNGV
A0A0A2F954      L----G----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
A0A0A2FW91      L----G----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
A0A2D2N2N1      L----S----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
Q7MWZ2          L----S----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
T2NDT6          L----S----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
W1R7P9          L----S----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
A0A1R4AFZ0      L----S----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
A0A1R4DVZ7      L----S----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
A0A7C0WKI7      R----V----LYGGKWIIIFSFIIVV-AATAYF-TFT-TPPVYEAESSVIISQK-GGIE-
A0A2A8CVM9      D----M----LRRGKWIIAATTIVVV-ALVGAY-TYT-VDPVYEAKSIVKIDLG-AQ---
A0A5M4B212      F----L----LLSHWYWFAIAIVLTS-IGTWLY-YRY-AHPTYAVSATMLIHEQ-QNQSP
A0A3D1KEX9      RICVAV----FLRNWKWFLLSVVACL-LFALLF-VKK-QPRVYSRQSTLLIENN-DNNGK
A0A358Y7S2      E----I----LKRHWRAPIFYSTIFL-IFAYLY-IRY-SVPIYQTKALVQVVEE-NK-T-
A0A1X7J248      T----I----LKKNLPWAILLIIIAV-FVAFLY-VRY-TNVKFQSYAELKLNKR-SE---
E4TQD2          T----I----LKKNLPWAILLIAIAV-FVAFIY-VRY-TNVKFQSYAELKLNKR-SE---
A0A2J6HHN3      Y----I----AKRNLKRIILFFIVLF-LFLFLY-LRY-TQPIYESSTIVQLNSD-DK---
A0A1Y3WMT8      R----A----ARKRWYLFAGSVFICV-VLVACY-LKI-AKPQYAISADILVNED-DKQGG
A0A1Y4GQU1      R----A----ICRKWYLFVGSVVVCV-ALVACY-LKI-AKPQYEVLADILVNED-EKKGS
A0A6A0R272      N----Q----VKLKLPWLLLFLFIGL-SSGYLV-SKY-KKQVFSAKATIKIDDK-SSNV-
A0A1V5W8T5      H----I----LRQNFIFYIIFGLIAG-ISAFTY-LRY-TPPIFDAYTVIQINEE-QN---
A0A2T8HKA9      K----Y----LFVHWKWFLLSVLFFG-GYYYYQ-YSK-TPFVYSKAAILMIKTP-QN-TN
A0A2I0QZ80      I----V----IKRNWYWCVLIFSLFI-VLGFLY-LRY-TKPVYESRMLIQINSE-NQ-G-
A0A3E1F1A3      I----V----IKRNWYWCVLISLILG-ILAFSY-VRY-TKPIYESKMLIQINSE-NQ-G-
A0A2U2XBJ3      I----V----IKRNWYWCALISILLV-VSAFIY-VRY-TKPVYESSMLIQLNSE-NQ-G-
A0A4Q4KU94      I----V----IKRNWYWCAIISILFF-VFAFIY-VRY-TKPVYESKMLIQLNSE-NQ-G-
A0A3B8INU3      S----V----LRRSIVWVVLIIVGAV-ASAYLV-VRY-TKPLYESVSDIKLNFK-SE---
A0A2W1NDY9      T----V----FKKNWIWLLLCVIIGV-SIAFVY-LRY-TKPIYESRAIIQRSLK-DE-G-
A0A5C8AQR5      S----V----LRRNWYWPLAFIFLFF-CFAFLY-LRY-TKAIYSSNTLIQIENK-DQ-A-
A0A1G0CI31      T----I----VKRYWWWTLLFVTCFT-AIAFVY-LRY-TKPIYDSSMVIQLGEK-DQ-G-
A0A556N0M0      V----V----LRRYWWWVLLLILFFL-GVAFFY-LRY-TKPVYDSTMVIQLVEK-DQ-A-
F2IKD6          V----I----LRRYWWWVLLLIIFFM-SVAFFY-LRY-TKPVYDSTTLIQLVEK-DQ-G-
A0A1I7BM74      N----V----LKKNFLFALLIIAFFG-ALSFLY-LRY-TKPVYQSQMVIQIDNE-DQ-G-
A0A2G2FJ17      I----V----IRKNWIWLMLIATILL-SSAFLY-LRY-TKPVYESKMLIQISNE-DQ-G-
A0A2E3R1D0      D----I----LLRGKWIILGAVLALT-IPVMVY-SML-SPSKYRSYAILLVDKT-DTDLA
A0A2T2USC0      G----M----LWGGKWVILATFVVVV-ALGAAY-TFT-QTPIYESSNLVLVEKQ-QRQVS
A0A2T2V0F3      G----M----LWGGKWVILATFAVVL-ALGAAY-TFS-QTPIYETSSLVLVEKQ-GEGVS
A0A2T2S682      S----T----LWGGKWILLTVFVLVV-GTVAVY-TYT-RTPQYKTSTLLLVDLG-QSR-S
D5H561          D----L----LRRRKWLIVLVCLATV-AGAALY-TYT-QVPVYRTSSLVLVEKG-QQS-G
A0A2H3NWA9      G----L----LWAHKWIILGVFVVVM-AAAGVY-TYT-LPNQYQTSSLLLIKPD-SPS-T
A0A2A8CVB6      G----T----LWRGKWIILGVLIVVL-AAGTAY-TLS-IPTTYRTSSLLLVDKQ-SQSGG
A0A2P6C1S6      Q----T----LWEGKWIILGVVTAVV-LAAAAY-MYT-IPTTYRTSSLLLVDRN-QQS-S
A0A2T2UTM4      Q----M----LWDRKWIILGIVAVAV-LSAAVY-TYT-IPATYRTSSLLLVDRE-GQT-S
A0A414ZBF2      G----V----LAHHRKWFILSVAVCL-LVGFIY-VRS-TPKTFSRTATILVKDE-QGGGN
A0A1Q3Q573      Y----I----LNKSILWIILIVAITV-FASFIY-LRY-TPRIYEATTKMILQLE-KS---
A0A662BAY3      K----R----LLSYWYWFLICIILAV-SIAYVY-NRY-ATPIYEITSSLLLEVG-NSNSP
A0A4U3L369      G----N----IIANWYYFVLGLVLML-VLAFLY-VRY-TEPVYQVNAGIMVEDQ-SGGSS
A0A357YNR3      M----K----YLIHWKWFLVSIFICI-FLAVVY-VYF-TLPKYMIQTSILFNDD-QK---
A0A5E8AX52      Q----V----VRSSILYVVAIFAVAG-TASYAF-LRY-TKPVYESESQLKLNIQ-NE---
F4KK08          M----I----LKANWLFILLSFLVCL-ALGFLY-IKS-SSHQYSRSASLLIKSE-TSIN-
A0A6B5PK86      T----V----LRRFWWLVPIFMAFFF-FVAIIY-LRY-TKPVYESQLILQIENE-DN-A-
A0A2G2F510      T----I----LKRYWWWPLTFILLFS-ALAFTY-LRY-TKPVYESAMILQLSEK-DT-A-
A0A316JZ08      T----I----VRRYWLWVLGFVGIFV-VLAYFY-LRY-TKPVYESSLMLQISNQ-DK-A-
A0A496LCF9      M----R----FIKYWYLFVISVLIFM-AVAYYQ-NRS-FVPTYNSTLRMLLKQE-SGSL-
A0A5P2G2A9      A----D----IIDHWKWFVIGVVLMI-ILGLLY-IQH-SAPRYNVNATVMVDDD-QKGGM
A0A3C0ZQC7      Q----I----VLRGKWMILASFLLVL-AGTAVF-TFT-TSPVYESTATVLVDTK-GQ-QS
A0A419VXB7      F----K----LLYHWKWFVLTVVVGV-GIAFVF-NRY-TPATYRVKSLLFIKDK-ESSG-
A0A0B0BTJ4      D----F----IVFNWYWFALSAIAFA-GIGIVY-ALS-RPDVYRSSAMVLIDEQ-YNRSS
A0A3B9CNN6      D----F----IVFNWYWFALSAIAFA-GIGIVY-ALS-RPDVYRSSAMVLIDEQ-YNRSS
R5X290          D----F----IVFNWYWFALSAIAFA-GIGIVY-ALS-RPDVYRSSAMVLIDEQ-YNRSS
A0A1Q6E6I7      D----F----IVFNWYWFALSAIAFA-GIGIVY-ALS-RPDVYRSSAMVLIDEQ-YNRSS
C3J7R8          -----I----LRSNWYWFAITLCVAI-GGASAY-LLH-TPNVYKREASILVKDK-MDAS-
A0A1G8BVM8      G----I----LWRNRFWFALSIIIAV-SIAVFY-VRS-TPKTYSRTATILIKDD-KKGGG
A0A1I1FXP9      S----I----LNKSLWWIIMFVVVAT-LGAYTY-VRY-TRPTYEAYSVLKLDIK-QQ-A-
A0A3N4H5N3      K----S----LVKHWYLFIICVIIFL-GLAFLY-LRI-ATPVYEISGSVIIKEG-DR-P-
A0A2P8EAX2      R----L----LLPYWPYIIASILLFV-GLSFLY-LKS-ATPFYEITSSVLIREG-ER-A-
A0A4V2F6N9      K----V----VLPFWPYILASILLFV-GLSFLY-LKS-ATPYYEITSSVLIREG-ER-A-
A0A3B9FXJ0      L----F----TWKNRYIILLIMMLSL-LAGYMV-NKY-SVPRYSAKSVVQFKEF-DP---
R5GSU5          RACTGT----LRRQWRWFVFSIIVCG-CLAFLY-ERK-QPRVYQRQAVIEIEGA-DGSSG
A0A2A3UE91      F----L----FMKSRIYIVLFFVISF-SLAFLY-LRY-SQPIYESRAIIQINDA-NQ-A-
A0A0A2G557      Y----L----LRQNWYYFIACLLIAL-ICGYVY-IKS-TPNSYERTASVLVNTK-SDISG
A0A2N2WFW8      F----I----ARRNLKFILVFFALLF-ALIFMY-LRY-TLPVYEASSVVQINSD-DK-A-
A0A1F3IU95      N----I----TRKSLIYIIVFSALLF-TAVYVY-LRY-TQPVYESACIVQINTD-DK-A-
A0A3D0VUF6      N----I----TRKSLIYIIVFSALLF-TAVYVY-LRY-TQPVYESACIVQINTD-DK-A-
A0A1T4PT95      Y----L----LQQNWYYFIFWLIIAL-AGGYIY-IKS-TPNSYEKTASVLINTE-SNMSG
A0A6I6JYY3      F----K----LLSNWYWFILCIVVAV-GAAFLY-NRY-ATPVYELSTTVLVEED-KVTSP
A0A2A4PYG9      G----I----LKKQFKWIVLFFLLAG-IGAFLY-LRY-TPLLFEASALLQMTSQ-NT-A-
A0A1F3K695      F----V----FRKSILLIGIFLFLIV-AVMYAY-LRY-TPPLYRASSVIQINDQ-NQ-A-
A0A353KZR1      F----V----FRKSILLIGIFLFLIV-AVMYAY-LRY-TPPLYRASSVIQINDQ-NQ-A-
A0A2N2WYB5      Q----I----LKKSLWVSIVLILLSF-FAAFLY-LRY-TQPLYSTQTIIQINEN-DR-T-
A0A1F3K4G0      Q----I----VRKNYWAPILFVAVSF-VASFLY-LRY-TQPVYQTQSIIQINET-NN-T-
A0A356H8Y3      Q----I----VRKNYWAPILFVAVSF-VASFLY-LRY-TQPVYQTQSIIQINET-NN-T-
A0A351HSA6      Q----I----VRKNYWAPILFVAVSF-VASFLY-LRY-TQPVYQTQSIIQINET-NN-T-
A0A1F3Q014      F----I----ARKSFFWIILFFILAF-LGASAY-LRY-TTPIFESSSVLQIETT-NQ-A-
A0A2D5KD44      Y----I----IKKNLLWVMLTIGMSI-LGSFLY-IRY-TAPVYRASADIQIEKS-NQ-A-
A0A6N9NIX1      F----I----LRKNLVWIAVILLISF-IAIFLT-LRY-SVPTYRVSSVIQIEKN-DR-A-
A0A2A4YXP3      H----L----LKRNLLLFAVIIICCL-LVSLVY-LRY-TAPVYEAKLVYQVNSL-NT-A-
A0A1F3R158      Q----I----FKKNLLLFIAIIITTS-IVAFIY-LRY-TVPLYQSQLVLQVGSK-NT-A-
A0A2M8ADX2      Q----I----FKRNLFLFAAIILACA-VISFIY-LRY-TIPLYQSQLVLQVGSK-NT-A-
A0A1J5B2H0      F----L----VKRNLLLFAILFIMAI-AGSYIY-LRY-TPPIYETHSIIQLSSD-NE-A-
A0A1V5N756      S----I----VKKNIPYVLIIFAFFF-TLAFLY-LRY-TYPKYETSGTIQIYTE-EE-V-
A0A651GU15      Y----I----ARKSLKWIALLAVFTF-TFAYLY-LRY-NAPVYQASTIIQLSKS-DN-A-
A0A3Q9FR88      F----V----IKKKFIWVILILMMAG-ICAFLY-IRW-TPRIYEASTLNQIKLT-SSSQD
A0A553GEX3      F----V----IKKKFIWVILILMMAG-MCAFLY-IRW-TPRIYEASTLNQIKLT-SSSQD
A0A150ADJ9      Y----V----VKKNIVWVLLLISLTT-ICAYLY-IRW-SPRIYEATTLNQIKLT-SSSQE
A0A1B1FWQ4      F----V----VKKNIIWVILLLILSG-VAAYLY-IRW-TPEIYQANTLNQVKLT-SSSQE
A0A1S1Z228      Y----V----VKKNIIWVILLLMLSG-IAAYLY-IRW-TPEIYQAHTLNQVKLT-SSSQE
A1ZKR2          E----I----FRKSIIWMLLLPLFTI-SIGHLW-LRY-TKPVYKSSSTLKLAIK-DE-G-
A0A1Q3GX01      E----I----LKKSILWMLLLPLLTL-SVAHIW-LRY-TKPIYESSSNLKLAIK-DE-G-
A0A349DQI4      E----I----LKKSILWMLILPLLTL-SVAHIW-LRY-TKPVYESSSSLKLAIK-DE-G-
A0A4P5TMD1      I----I----TRKSLIWCILIVLLTV-STSILY-LRY-TTPLYEVTAQIMIKQV-NTSSS
A0A2N3IIZ0      Y----I----LRKNWYWLIVFPLLSV-SLAYLY-LRY-TKPIFQSTANLKMEFK-DE---
A0A1F3SJM1      T----I----LRRYWWWPLTFVFIFG-LLAFSY-LRY-TKPIYESSMILQLSDK-DE-A-
A0A2G2EB96      T----V----LKRYWWWAALLVMAFA-SFAYIY-LRY-TKPTFESSMVLQLGDQ-DS-A-
A0A2G6PRA9      T----V----LRRYWWWAALLVLTFA-ACAWVY-LRY-TKPTYESSMVLQLGDK-DN-A-
A0A497D5Z2      I----S----VLRNWYWFILAVVVAL-AIAFLY-NRY-TTPLYKICSSILIEEK-NTGSP
A0A662B170      I----S----VLRNWYWFILAVVVAL-AIAFVY-NRY-TTPLYKICSSILIEEK-NTGSP
A0A2A5FYT6      Y----I----TQRNIFWIIAILIVAG-TAAYFY-IRY-TPPIYESIGIIQVRTD-NT-A-
A0A2E6SYP1      L----I----IRRNLFLTILLILMGA-GFAFFV-NRY-TTPTYYASSVVKISEK-ND-V-
A0A2E5RLE8      L----I----IRKNLISILFSISIGF-CVAFFI-NRY-TTPQYSASSIVKISEK-ND-V-
A0A2E7TQF6      L----I----IRKNLISILFSISIGF-CVAFFI-NRY-TTPQYSASSIVKISEK-ND-V-
A0A2E6GVY9      L----I----IRKNLLFIVLSIFLGF-CIAFFI-NRY-TTPQYYSSSIVKISEK-ND-V-
A0A350JJ90      M----I----TSKSLIWIVSIILLLG-GLAFTY-VYY-TQPKYESTSIIQIINE-NQ-A-
A0A3M1CDV2      D----I----TLKSKWWYVLFFSIAG-ISVFLY-LRY-SERIYSSQSIIQIVNS-D--A-
A0A6C1QGZ7      Y----I----AKKNILFPIIFILIAV-AGAWIY-LRY-TPPVFQTSAIIQMEGQ-FQ-A-
A0A4P5U6G4      I----I----IKKSFIWCVLIVLITM-SSSLLY-LRY-TPPLYEVGSTLMIKPE-N--T-
A0A2E2TFD1      H----L----IQKSFIWILLFVSLAF-GGAYLY-LRY-YQPMYQSTSILQLKES-NQ-A-
A0A2E4ELE6      H----L----AQKSLLFVLAFFVIAF-ISSSLY-LRY-TQPIYSSSSILQLKEQ-NR-A-
A0A522EYA6      F----L----IKKSFLWIILFFSVSF-AAAFIF-LRY-TPEVFESRTILQVNND-NQ-A-
A0A2E3XZI5      Y----L----INKIKWVLITILIIFL-LGSRIY-LRY-KPEIYKTETRLQLAVK-DE-P-
A0A6I7QXV0      S----I----IRKTFGWFLLILFITV-LSVWLF-LRY-TQPIYETSSEIIQKTE-K--T-
A0A2M7NLQ9      R----V----VKKKLIYVIFLLIICV-VASWIV-LRY-TKRVYSSSSTLKLEMK-G--T-
I4AFR0          R----V----VKKNIIYVILLLIICV-AASWVV-LRY-THRIYNSSSTLKLEMK-G--T-
A0A2N2Y3E5      L----V----FRKSLLYFTIIAVLCG-AGAYAY-LRY-TQPLFQASAIIQLKDE-ADKT-
A0A2D9D7T6      E----I----LRKHWFAPILFIVFFS-TVAFFY-LRY-TKPIFQSKAVIQIVEE-DR-V-
A0A1F3PPL5      Y----I----IKKSMFLVAIIMGISI-VGAFLY-LRY-TPPLYQSITVLQISNN-NN-A-
A0A357QK06      Y----I----IKKSMFLVAIIMGISI-VGAFLY-LRY-TPPLYQSITVLQISNN-NN-A-
A0A662AEA4      L----I----LKKNVWLTFLFIILSL-FGTFIF-LRY-TPPVYKSVSIIQINNE-GSKA-
A0A0S2HYK8      R----I----LYRSVWIGLFIILLAL-GAGFLK-IRY-TAPLYEAKSVIQIQED-KK-T-
A0A2N5ZWN6      R----I----FIRSFWMGIIIMMLVI-GGAFLK-IRY-TSPVFEAKSVLQIQED-NK-N-
A0A2E0FJ09      Y----L----TRQIWVWMLLIVIVCF-GLGFLY-IRY-TPPQYKAKALIQRTSQ-DN-A-
A0A1F3FZ62      K----I----IQKTILPIFILFIISS-TIAFLY-LRY-THPVFEASSVIQLSSS-NS-A-
A0A1F3K211      K----I----IQKTILPIFILFIISS-TIAFLY-LRY-THPVFEASSVIQLSSS-NS-A-
A0A1V6I2U9      I----I----FKKNVWVVILLILISL-GAGFAY-HRY-STPRYKTSTIIQVKNE-NK-T-
A0A2H0B957      Q----V----FKKSIILSVLVFILAA-VGAFVY-LRY-TQLIYKSVSIIQLKNE-NTNA-
A0A1F3CFW6      Q----V----FKRSIILSIIIFFAAI-VGVYVY-LRY-TLPIYKSSSIIQLKNE-GTTA-
A0A2M7E2T8      Q----V----FKRSIILSIIIFFAAI-VGVYVY-LRY-TLPIYKSSSIIQLKNE-GTTA-
A0A2M7NC69      Q----V----FKRSIILSIIIFFAAI-VGVYVY-LRY-TLPIYKSSSIIQLKNE-GTTA-
A0A1F3KLL5      M----I----IRKSIWWIVIIFILAL-FSAFAF-LRY-TPPIYQSNSILQINEQ-NQ-T-
A0A359D1M1      M----I----IRKSIWWIVIIFILAL-FSAFAF-LRY-TPPIYQSNSILQINEQ-NQ-T-
A0A0F2NS19      K----V----FKKTFIYFVGIIAICV-TLSLIY-LRY-TVPIYQSKLVLQVGSE-NT-A-
A0A2A5H8X6      K----V----FKKTFIYFVGIIAICV-TLSLIY-LRY-TVPIYQSKLVLQVGSE-NT-A-
A0A2H0GAU8      K----I----FKRNLFLFIAIITICV-VVSFVY-LRY-TIPIYQSQLVLQVGSE-NT-A-
A0A2M8FTK1      K----I----FKRNLFLFIAIITICV-VVSFVY-LRY-TIPIYQSQLVLQVGSE-NT-A-
A0A2A5B3B0      H----L----LKQNLLSFAIIIAVCL-MGAFIY-LRY-TTPIYESVLVYQVSSL-NT-A-
A0A5C6RXM7      H----L----LRSHLKWFFVIILFCL-LSSYLY-LRY-TIPVYQSNLIFQVGSL-NT-A-
A0A1F3C1M2      Y----I----VKKSLILIGLLIGIAA-VSVFAY-LRY-TLPTYKSSSIIQINTK-NQ-T-
A0A1F3DS87      Y----I----IKKSAILIGLLIGIAI-FSVFAY-LRY-TLPTYKSSSIIQINTK-NQ-T-
A0A6A0R6K9      Y----I----TKKNSLWILLTIILMV-LAAFLY-LRY-TAPIFSSQSIIQIKKS-NQ-A-
A0A2E7CT70      Y----L----LKKSRFTIILILLSAF-SLGFLY-LRY-TPKTYQTSATLQINIK-DK-A-
A0A2D5V560      Y----L----LNKIKWYAITLIILCI-TSAFIY-IRY-TPKTYQTSSIIQVAVK-EQ-P-
A0A2D7K5A8      Y----L----LNKIKWYSIIIIIISI-SLAFLY-LRY-TPKTYQTGALIQVAVK-EQ-P-
A0A2E1XQ82      Y----L----LNKIKWYAIIILIISI-SLAFLY-LRY-TPKTYETGALIQVAVK-EQ-P-
A0A5C8A5B4      G----K----IRSRWWWFLITVPLAL-AVAIAY-VKT-TPKKFDVGAVMLLGNK-KRTGF
A0A4Y9ITE2      R----F----YSTKWKAILISVIIFM-ILGGIY-AYT-KSPVYEVQANVLITDN-DTKSD
A0A5M8NYX7      F----H----YLNYWKWFVASLFVCL-LISFIY-LRY-TTREYSVSSRALIKDE-QKGRT
A0A3D5KRY6      A----T----LLKNWYWLAAFSFAGM-VGGYAY-NKV-VLPYYRISTTVLVHDE---SKT
A0A0E3V905      -----K----YSKLWPWFILSTVLML-AIGHIY-ISN-KQPIYKIQASLLVQDQ---QKG
A0A553ETH6      A----V----LKKNWIWIVIIFVISI-TSAYLV-IRW-TKPLYESTSELKLDVE------
A0A640Q161      L----G----IIKRYAFRIVSLAIAFTILVALL-VMR-MTPMFTSTTTILVEAD------
A0A640QU49      L----G----IIKRYAFRIVSLAIAFTILVTLL-VMR-MTPLYTSTATILVEAE------
A0A1Q3PII2      K----T----VRYHWYWFAISPLLSL-LLAWAF-LRY-QTPHYTIKASLLVRDD-SRGSD
A0A351BXT2      N----I----LRMNLIPMTIITLLCI-LLTIVY-VMY-AKDIYKSSATIKINRP---QGS
A0A2K8Z965      -----R----YIKRWPWFVVSIGLML-AGAYIY-LLD-KQPVYKIQASLLVQDQ---QKG
A0A418M8U8      -----K----FTRNWPWILFSVCVFL-VAAYTY-LAY-KQPVYKIQASLLIQDE---KKG
I2GTA4          -----K----FTRNWPWILFSVCVFL-VAAYTY-LAY-KQPIYKTQASLLIQDE---KKG
A0A2K8ZAJ2      I----R----YVRNWPWFMLSILLAQ-AAAYIY-LLY-QPLVYNVQASVLIKDE---RKG
A0A368JPA3      -----D----YLKHWKWFLISLITLI-VAGFVY-IWF-TEPIYRVQASLLVKDE-PPKSG
A0A5N1JI29      -----D----YLKHWKWFLISLIALI-VAGFVY-IWF-TEPIYRVQASLLVKDE-PPKSG
A0A3P1BT12      -----D----YLKHWKWFLISLITMI-VAGFVY-IWF-TEPIYRIQASLLVKDD---QKS
A0A3P1CI15      -----D----YLKHWKWILISLIAML-VAGFVY-IWF-TEPIYRIQASLLVKEG---KDN
A0A4R8CUK1      Q----D----YLKQWEWFLLSLITML-VAGFVY-IGF-TEPVYRIQASVLVQEE-PRIGA
A0A3D0MYJ7      F----S----ILKYKYIILITTIVGF-LVAFFF-ARS-LPNIYQSKVQINVEK-------
A0A662AH13      N----L----IKLNLIPILLITITGL-IVSIIF-ALM-AKDIYTATVAMKIQK--PSSGG
A0A5C7QA01      F----S----LIAQWKLIALCVFLSL-VCALLY-LRV-TPNTYSVDALIQVEDS-KGASS
A0A3D3LS70      N----L----VKSNWILILIVFIISA-VFTGLY-VFR-AKDIYKSSTSLLIQK---PQGS
A0A1G1TM36      ------------------MVGVALAL-LAAYAY-NQL-AQPTYEVQASILVEEG-NKQPG
A0A1G7ZF38      K----A----VRYRWYWFLISPLLSV-LLGFTF-LRY-KTPHYTITASLLVRDD-SRGSD
C6VS52          K----A----IQFRWYWLVVSPIVSL-LLGTAF-LRY-KTPRYQVTASLMVRDD-SRGSD
A0A7C1LGX3      K----K----YIKYWPWFAASFLLTL-AFAVFY-LLS-TAKIYESVAKIKIVDN-STDIG
A0A2A4G4B1      G----F----VLSQWKKMVLGGLIGA-LLAFGY-LKT-VNPKFRVETSVLLKSV-TNSIP
A0A0P7X1V8      G----L-----LWHNKWIIITLTLLG-GVSAYI-YAQSQIPIFESNGSLQITEA-GNRYS
A0A6P1P355      H----K----YVPYWPLFLLLFIFAM-AGAWAY-LQYLAVPTYKTSATIIIKDE-KKGVD
A0A5C8KAD6      Y----K----FTPYWPLFLTLLVISC-MAGWAY-LNYYATPVYEASASLLIKDE-KKGVN
A0A5N1J695      F----R----FLPYWPLFAGLLVVSL-FGAWGY-LRYLSVPTYEVSASLLIKDE-KKGIN
A0A3B0C2S4      Q----K----YLRYWPWFVLGILICL-GGAYAY-MRY-APIVYESSAKIKIIDE-AKEMD
A0A3N2M1H3      Q----A----CKSRWQWILLSLIICV-GAGVLY-ILC-QQPEYQRTEEVLIKDQ-EGGSG
A0A4S2G8T2      Q----A----CKSRWQWILLSLIICV-GAGVLY-ILC-QQPEYQRTEEVLIKDQ-EGGSG
A0A212K7W5      K----M----SVEKWHWFAISLTICL-IFAFLY-IAI-TSPVYTRMAAVLIKDN-SAKGG
F5IU11          K----M----SVEKWHWFVISLGICL-ISASLY-IAI-TPPVYTRMAAVLIKDN-SAKGG
A0A7C1QWC7      A----K----AFSYKFFYILCILLLV-AGAYLY-NRF-APTIYQVNSTIGPVEE-SRSSF
A0A352Z1R7      S----V----ILRRRKLFTLAFCAVF-FSVVLY-TYL-MKPIYEASSTLHIKKE-RGQGV
A0A3N2N6F7      S----L----CVRCWKWFAFSVAACL-IIGALY-VLT-SPKIYTRTAQVVVQDD-EAGSS
A0A4P7VVU7      I----L----CLNKWKWFVISIIIFL-GLGVLY-IMS-TPETYTRTASVMINED--TESG
A0A2V1ILM4      I----L----CLNKWKWFVISIIIFL-GLGVLY-IMS-TPETYTRTASVMINED--TESG
A0A3N2L0E8      I----L----CLNKWKWFVISIIIFL-GLGVLY-IMS-TPETYTRTASVMINED--TESG
A0A3N2LFC5      I----L----CLNKWKWFVISIIIFL-GLGVLY-IMS-TPETYTRTASVMINED--TESG
A0A0A2F501      A----M----CWARKFWFVLSLGLFL-GGAILY-ILI-TPPVYKRTATLLIKDD-SKGKG
R5B7P0          R----R----CLSRWYWFALSLAVCL-ALGALY-ILR-STPTYNTSADIQIKSN-TKGAS
R5B0L5          F----I----TLKRWPWILLSLAICV-GCAVLY-VLR-TPSMYTRSASIVIKSS-SQGAS
A0A6I1TEC0      Y----L----CLARWKWFVLSLFVTM-GAAGYY-LLS-TPNVYQRTASLLIKDE-SKGSS
A0A3R5XWG1      Y----L----CLARWKWFVLSLFVTM-GAAGYY-LLS-TPNVYQRTASLLIKDE-SKGSS
A0A5P0Y910      Y----L----CLARWKWFVLSLFVTM-GAAGYY-LLS-TPNVYQRTASLLIKDE-SKGSS
A0A414YFM3      Y----L----CLARWKWFVLSLFVTM-GAAGYY-LLS-TPNVYQRTASLLIKDE-SKGSS
A0A6A7UIA7      Y----L----CLARWKWFVLSLFVTM-GAAGYY-LLS-TPNVYQRTASLLIKDE-SKGSS
A0A6A7VPS3      Y----L----CLARWKWFVLSLFVTM-GAAGYY-LLS-TPNVYQRTASLLIKDE-SKGSS
A0A374THP7      Y----L----CLAKWRWFILSLAVTL-GIATYY-ILT-TPNVYQRTASLMIKDD-SKSQG
A0A6G1VND1      Y----L----CLAKWRWFILSLAVTL-GIATYY-ILT-TPNVYQRTASLMIKDD-SKSQG
A0A0A2EVS5      R----L----CLIRWKWILLSLLITV-GAATAY-LMI-TPVEYKRSASILIKES-DKPGA
A0A1T4NAJ7      R----L----CLIRWKWILLSLLITV-GAATAY-LMI-TPVEYKRSASILIKES-DKPGA
A0A255T941      G----L----CLPRWRWFVLSVLICA-SAAVLY-LLR-TPNIYTRTASILIKED-AKGKS
A0A3N2KCL3      Y----R----TLHHWPWVLLSLVVCV-GAAVVY-LLC-TPKVYTTTASIMIKDE-AAGKS
A0A4P7VSV0      Y----R----TLHHWPWVLLSLVVCV-GAAVVY-LLC-TPKVYTTTASIMIKDE-AAGKS
A0A2V1IJY1      Y----R----TLHHWPWVLLSLVVCV-GAAVVY-LLC-TPKVYTTTASIMIKDE-AAGKS
A0A4P7VXK7      Y----R----TLHHWPWVLLSLVVCV-GAAVVY-LLC-TPKVYTTTASIMIKDE-AAGKS
A0A1Y4CHN5      Y----M----CLSKWYWFAISLVVLI-ALALIY-IMR-TPPEYTRSASMLIKEE-GKGQS
A0A1M6I2S6      G----M----FVPRWHWFALSLFAAL-AIAAFY-LLS-TPNIYTRTAAILVKDD-TKSGS
A0A1Y3V692      G----M----FVPRWHWFALSLFAAL-AVAAFY-LLS-TPNIYTRTAAILVKDD-TKSGS
F3PXM2          S----M----FVPRWRWFALSLAVAL-SAAALY-LLR-TPAIYTRHAAILVKDD-SKGGA
A0A174AHH7      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A174JCE8      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A3E4JMC4      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A412SND6      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A414IEQ9      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A6I0U0V8      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A6L5S9H7      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A0M1W8D8      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A3R6GKX5      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A7V4S1          G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
B0NU19          G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
D4V601          G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A4Q0U3M9      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A4R4H1Q2      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A6I0GII7      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A6I0KYU7      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A397WLT5      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A6A2J529      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A6L6P8N9      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A6N8DDD8      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A015XH67      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A078RZN2      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A4R4I3T9      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A6L0K5          G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A7ACT5          G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A6KY94          G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
A0A173UQR8      G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
A0A3R6HK75      G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
A0A412B7D1      G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
A0A412VNY9      G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
A0A414LTU9      G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
I9Q4U4          G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
A0A373ISF0      G----L----FVPKWHWFVLSLFVTM-SVAVLR-LMS-TPSIYTRSAAILVKDD-SNSGS
U6RF62          G----L----FVPKWRWFVLSLFVTM-SVAVLR-LMS-TPSIYTRSAAILVKDD-SKSGS
A0A662ZZD5      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A3A5TI83      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A415NEB6      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A6I0I238      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A7AJ60          G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A6A2JF01      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A6I0Y2Y2      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A6I2Q447      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A395YYT3      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A015UXN7      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A5M5W148      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A6I2NTL0      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A016E4F9      G----M----FVPRWHWFVLSLFAAL-AVATFY-LLS-TPNIYTRTAAILVKDD-SKSGS
A0A4Q5CFJ7      G----M----FVPRWHWFALSLFAAL-AVATFY-LLS-TPNIYTRTAAILVKDD-SKSGS
A0A6N3HG44      G----M----FVPRWHWFALSLFAAL-AVATFY-LLS-TPNIYTRTAAILVKDD-SKSGS
A0A6H9P0U9      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A108TH71      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
I8VXH0          S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A412S0N6      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A412IIJ0      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A0P0FM97      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
R6KTP3          S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A139LU87      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A1C6B3Y5      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A6L3KCD1      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
E2NMQ4          S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A412YDB9      S----M----FVPKWYWFAVCLFITL-AIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
R7DY01          S----M----FVPKWYWFAVCLFITL-AIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A414LGK8      S----M----FVPKWYWFAVCLFITL-AIAVLY-LLS-TPPIYTRTAAILVKDN-SKSNS
A0A415IPQ4      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A3E5BRW7      G----M----FVPKWHWFAGSLLITL-AIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
K9DXS6          G----M----FVPKWHWFAGSLLITL-AIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A1M6KFV3      G----M----FVPKWYWFAGSLFVTL-TIAALY-LLS-TPPIYTRTAAILVKDN-SKSNS
A0A1Q6G7L3      G----M----FVPKWYWFAGSLFVTL-TIAALY-LLS-TPPIYTRTAAILVKDN-SKSNS
A0A413H235      G----M----FVPKWYWFAGSLFVTL-TIAALY-LLS-TPPIYTRTAAILVKDN-SKSNS
A0A1M5B2J8      Y----L----CLAKWHWFVLSLAVCL-GVAIAY-LLR-TPPVYTRSASILIKDD-SKGKS
A0A255RCT5      Y----M----CLAKWYWFVLSLAVCL-GVAIAY-LLR-TPPVYTRSASILIKDD-SKGKS
A0A1Y4GLF5      Y----L----CLAKWKWFVISLVVTC-GIAVLY-LLR-TPSVYTRTASVLIKED-SKGNS
A0A1H3XSC0      Y----L----CLSKWKWFVLSLAVTV-GIAVFY-LLR-TPPVYTQTASVLIKDD-SKGKS
A6LE40          F----L----CLAKWQWFVLSLVVTV-GAATVH-LLR-TPAVYTRTASVLIKED-SKGKS
A0A4Y1VPX5      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6N2XMM4      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
B3JI46          Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A358R8U0      Y----L----CLAKWKWFILSLLVTL-SLAFLY-LLK-TPSVYTRSATLLIKEN-TKGQS
R6WSB6          Y----L----CLAKWKWFILSLLVTL-SLAFLY-LLK-TPSVYTRSATLLIKEN-TKGQS
A0A401LPX7      Y----L----CLNKWHWFVISLVLCL-GGATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A6G0GNY9      Y----L----CLNKWHWFVISLVLCL-GVGTFY-LLK-TPSVYVRTASILIKDD-SKGKS
A0A6I1BFM0      Y----L----CLNKWHWFVISLVLCL-GGATFY-LLK-TPSVYVRTASILIKDD-SKGKS
A0A3A5Z900      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A285TGL6      Y----L----CLDKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A3A5RFX4      Y----L----CLDKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A1Q6IUW9      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A413XDP6      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A6N8CVT6      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
K6AP24          Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A6I2NHV3      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A662ZYI7      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A078RYI7      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
C7XEQ8          Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
D7INX6          Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
K5ZG55          Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A3N2N9B8      F----L----TLRKWPWIILSLTICV-GAALTY-ILR-TPTVYTRAAQIMIKDT-SKGKS
A0A3N2NMI0      F----L----TLRKWPWILLSLIVCV-GAAMIY-ILR-TPDVYTRATEIMIKEP-SKGKS
A0A359I8H7      A----R----CLSKWRWFAVSIVLFC-CLGVLY-VLR-QQPVYSRSMELLIKDQ-DGGGG
A0A3N2KA63      A----R----CLSKWRWFAVSIVLFC-CLGVLY-VLR-QQPVYSRSMELLIKDQ-DGGGG
A0A4Q0IMT7      A----R----CLSKWRWFAVSIVLFC-CLGVLY-VLR-QQPVYSRSMELLIKDQ-DGGGG
A0A3B9FAU3      D----I----VLGNWFWILQSVILFG-AAGWYY-LKI-TPNTYQRTALVVIKED-SPQRG
A0A3C1E5L7      D----I----VLGNWFWILLSVILFG-AAGWYY-LKI-TPNTYQRTALVVIKED-SPQRG
A0A4Q0UAV1      Y----Y----FLSKWYWFVISVAVCV-AFASYK-LMS-TRPTYVRTITVMFKTE-ESGNG
A0A354SN68      F----A----CLAQWKLFALSVAVCV-GATMLY-LSS-KSPVYMRRASVLMKED-NRRSA
A0A6L5XFL0      Y----L----CAAKWYWFLISFIVML-GLACLY-ILC-SQPVYTRQASILIKDE-DNNSS
A0A3N2N595      Y----R----TLHYWPLVLLSLFICV-GAAVMY-LLC-TPKIYTTSASILIKDN-AKSNT
A0A0A2DUD9      R----L----VCIRWYVIAISILLAL-GVAVLY-ILR-TPPVYKRTASVMIKAD-DKGKS
A0A3P1ZBJ5      Y----L----CLSKWYWFLLSLILSL-ALGVLI-ILR-TTPVYNRYTTIMIKEN-TKGGG
R5FHS9          Y----L----CLRKWWWFAIALIIAF-GVAIAY-ILR-TPPVYTRTESVVISNS-DDSRS
A0A413TW79      Y----L----CLVRWRWFVISLVVTL-GIATYY-LLS-TPGVYQRTASILIKED-GKSQS
A0A3E5E9M7      Y----L----CLVRWRWFVISLVVTL-GIATYY-LLS-TPSVYQRTASILIKED-GKSQS
A0A3E4SK73      Y----L----CLVRWRWFVISLVVTL-GIATYY-LLS-TPSVYQRTAFILIKED-GKSQS
A0A415GGC6      Y----L----CLVRWRWFVISLVVTL-GIATYY-LLS-TPSVYQRTASILIKED-GKSQS
A0A413DBH9      Y----L----CLVRWRWFVISLVVTL-GIATYY-LLS-TPSVYQRTASILIKED-GKSQS
A0A1Y4PQK7      Y----L----CAAKWKWFVLSLLVAF-GIGYYY-LLK-TPPVYTRTAELLVKRE-YRGRS
A0A1Y4IH41      Y----L----CAAKWQWFVLSLLVAF-GIGYYY-LLK-TPPVYTRTAELLVKRE-YRGRS
A0A3A6AAP4      Y----L----CAAKWQWFVLSLLVAF-GIGYYY-LLK-TPPVYTRTAELLVKRE-YRGRS
A0A6I0ZRD2      Y----L----CAAKWQWFVLSLLVAF-GIGYYY-LLK-TPPVYTRTAELLVKRE-YRGRS
A0A1Y4DYA7      F----S----LLKKWYWFVISILISI-TIAIFY-IMC-TPPIYTRSASLLIKED-NKSNS
A0A1Y3X4I9      Y----L----CLAKWYWFVISLVVLL-GFTALH-LLT-TPPVYTRSASLLIKED-SKGNS
A0A1Y4FNK8      Y----L----CLNKWYWFVISLAVTI-GVAVVY-LLT-TPPVYTRSASLLIKED-SKGNS
A0A355FD59      Y----L----CLAKWRWFVLSLFVTL-GIAVLY-LLT-TPAVYTRSASLLIKED-SKGKS
A0A359CEZ9      Y----L----CLAKWRWFVLSLFVTL-GIAVLY-LLT-TPAVYTRSASLLIKED-SKGKS
A0A353Q7B4      Y----L----CLAKWRWFVLSLFVTL-GIAVLY-LLT-TPAVYTRSASLLIKED-SKGKS
F8X3A5          Y----L----CLFRWRWFVISLFITL-SIATFY-ILT-TPPIYIRSASILIKED-SKSQS
A0A1M3KVR9      Y----L----CLFRWRWFVISLFITI-SIATFY-ILT-TPPIYIRSASILIKED-SKSQS
A0A4Y9IJS3      Y----L----CLFRWRWFVISLFITI-SIATFY-ILT-TPPIYIRSASILIKED-SKSQS
A0A495WI87      Y----L----CASNWYWFALSLMITL-GAAFLY-IKV-TPPVYTRSASILIKED-SKGKS
A0A354M4S6      Y----L----CASNWYWFALSLMITL-GAAFLY-IKV-TPPVYTRSASILIKED-SKGKS
R7DH52          Y----L----CASNWYWFALSLMITL-GAAFLY-IKV-TPPVYTRSASILIKED-SKGKS
A0A4Q5E7L5      Y----L----CLARWKWFVLSLAVTL-GIATFY-ILR-TPQVYTRTASVLIKED-AKGKS
A0A4P8LP09      Y----L----CLAKWKWFVLSLVVTT-GVAAVY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A4R4GZU7      Y----L----CLAKWKWFVLSLVVTT-GVAAVY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A016CWA4      Y----L----CLAKWKWFVLSLVVTT-GVAAVY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A1C6H117      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A0M1W0V2      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A139KA16      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A174VQ92      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A1Q6HCG0      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A1Y4JYM9      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A3A5QW67      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A3A5RQE6      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A3A6BP07      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A3E5E153      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A3Q9IP20      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A412WV15      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A413ICP6      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A414KYB9      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A5B3FWR2      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A6L4P3V7      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
E5WX00          Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
K0X3P3          Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A415TAH7      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A078T2W6      Y----L----CLARWKWFVLSLMVTI-GVATVY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6I1AQV4      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A5C6L2P1      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A412MJT7      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKDKS
A0A3E4WKT5      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3A5YY33      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A078TAH2      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A1E9CFZ7      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A373FYU5      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3A5TZ72      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3A5XBP2      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3A6MEG9      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3E4JP35      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3E4KP40      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3E4NX82      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3E4XFU8      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A412RG70      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A412TD37      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A413GAA4      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A414M7I4      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A496BTA0      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A496D2V6      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A4Q5G1P5      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A5C6KCA6      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A5M5AHM5      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6I0KZV6      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6I0Y5K7      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6I1BFB8      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6I2P5W5      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6N8DC51      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
E5UZA2          Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A069SMG6      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-PPAVYTRTASVLIKED-SKGKS
A0A6A2RTB3      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6I0VY00      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A1M4YZ07      Y----L----CLARWQWFVLSLVVTV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A0P0FQW1      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A5M5C0W6      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6I0H151      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A642LZ22      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6I0HI59      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A642NJ89      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6I0HI52      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6L3JTQ2      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6L4EED9      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6I0YVB5      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6L5RHE2      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6N3AEV2      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6L3KG29      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6G0G4T5      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6I0HFG9      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A4Q5E5M7      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6L4F5W0      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
C3RFN5          Y----L----CLARWKWFVLSLVVTI-GVATVY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3A5Z014      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6I0ING7      Y----L----CLARWKWFVLSLVVTV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A6L5S265      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A078S3Q8      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A069SJV7      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A3E5DXI5      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A3E5EM98      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A3E5F453      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A6N2YYD4      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
I9T3G6          Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A3E4SYU0      Y----L----CLARWKWFVLSLVVTI-GVATVY-LLR-TPAVYTRTASVLIKED-SKGKS
A6LGY1          Y----L----CLARWKWFVLSLVVTI-GVATVY-LLR-TPAVYTRTASVLIKED-SKGKS
K5ZSH4          Y----L----CLARWKWFVLSLVATI-GVATVY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A1H4ADG3      H----R----IRANWYYCVICAIVMV-GLAGIY-LYV-ANPTYKAMATVLIKDN--TGQN
A0A5B8VUR8      Q----R----IRANWLYAVLSAILMV-VLAVIY-LYV-TSPTYKAMATVLIKDN--DGKS
A0A0D3L8Q3      L----K----YLRYWYLFLLGTIICF-GLAYLY-LRY-TTPQYLITTSILIKSD-QQSGG
A0A2N3U785      T----K----YLRYWYLFAATLLLSL-AGAYTY-LRY-ATPQYLISSTLLIQDN-NKGAS
A0A5B6TJH8      I----Q----YSRYWYLFLLGALLSV-GAAFMY-LRYHTSVQYKVASRLLIKEN-QRGQG
A0A519U664      S----Q----YSRYWYLFVLGASIGL-GIAYLY-LRFYAIPQYVVSSTMLIKDD-KGGQG
A0A519MA34      H----Q----YTRYWYLFVLGAALGL-GAAYFY-LRYYAIPQYVVSSTMLIKDE-KGGQG
A0A519UCX0      Q----Q----YSRFWYLFVLGAILGS-GAAYLY-LRFYAIPQYVVSSTLMIKDD-KSTQG
A0A0E3ZG78      L----N----YLRYWYLFLIGAALGL-CGAFLY-LRYYTIPKYSVYSTVLIKDD-KSDSH
A0A1I6BRK6      L----Q----YTRYWYLFLLGAVLSI-SVAFFY-LRYYAVPQYIVSGTMLIKDD-KSGQS
A0A243WAB1      G----Q----YIRYWYLFLLGGMIGL-GITYFY-LRYYAVPQYHVYSTLLVKDD-KSGQS
A0A6G8C8X6      Q----Q----YVRYWPLLLLGTTLGL-ATAFLY-LRYYAVPQYWTESTLLIKDD-KSGQG
A0A416GA42      H----V----ALKKWYYYVGAVVCCL-LFAYIY-LHR-TAPMYQRMATVLIKDK-ESGTR
A0A1T3IYP5      K----Y----LLHHWKWFTLSILIFG-GFFYYQ-YSK-TPFIYNQSEVVMIKTPSNTPTT
A0A1T5K9D4      F----Y----LLNHWYWFVLCIGLAV-AFTSYR-YAK-TPFSYRSNATIIIKNP------
A0A077ENE7      K----Y----LLHHWKWFVLSILIFG-GYYYYQ-YSK-TPFVYNSSEIVMVKTP------
A0A6I5UW06      K----Y----LLHHWKWFVLSILIFG-GYYYYQ-YSK-TPFVYNSSEIVMVKTP------
T0NN57          K----Y----LLHHWKWFALSILIFG-GYFYYQ-YSK-SPFVYSRSEVVMIKTA------
X5K347          K----Y----LLHHWKWFALSILIFG-GYFYYQ-YSK-SPFVYSRSEVVMIKTA------
A0A060RD97      E----L----VLANWYWFAVSLLVAL-LLGGYL-YVK-SPLVFKRQASIMLKDK-SGSGQ
A0A3C1ITV0      S----W----TLCHKKFFAISIVICV-ALGLIY-AQR-AQRIYQRSASVMLRSD-NKGQA
R7HN19          S----W----TLCHKKFFAISIVICV-ALGLIY-AQR-AQRIYQRSASVMLRSD-NKGQA
A0A350IHV0      A----M----IWNNKWWYVLSLVVCI-FMAGFV-IYR-TAPKYTRTAKVIVDDS-NENSA
R5RVP0          S----M----IWDNKWWYVLSVAICL-CFSVFY-LYR-TASSYTRTAKVMIDDT-NENSA
R6A0L2          K----LCYHQFINHWAWFALSAVVCG-CIGWYY-QQC-QPRVYQRQAVMLIEDSNGSSTG
R7LG80          K----LCINQLLRNWYWFLLSIVICL-GLGWIY-RQS-QPSVFKQQSVILIEEADSDPRS
A0A2L2WX98      R----LCLGQLKAHWVWFLFSVIACA-ALGFLY-LQC-QPRIYQRQAVILLEDTDGRSAM
A0A6N8KXI9      N----Y----LLHYWKWYVLSILVFT-SYFYYQ-YSK-SPYVFRRAETVMIKTPENTPTS
G5GD56          K----MCWALFLANLKWFVLSVILCL-VLGYLY-QAR-QSRVYQRQAVILFEDNESGSGG
R5KD55          I----S----CASHWRWYVATVVVAL-AVAVLY-IKK-TQPVYKRDASIMVLERNDKPTV
A0A174QNT3      E----L----FLNNWYWFIASILFCV-GGAWLY-LSA-VSPVYQRTAVMLVKSD-NQNSQ
A0A4S2FGS1      E----L----FLNNWYWFAASAVACV-AMAWIY-LSA-TPPLYQRTAVMLVKGD-SQNSQ
R9I0H0          E----L----FLNNWYWFAASAVACV-AMAWIY-LSA-TPPLYQRTAVMLVKGD-SQNSQ
K5BUT9          E----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKDK-EKSA-
A0A174FPA3      E----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKDK-EKSA-
R6S9Y6          E----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKDK-EKSA-
A0A642LIH6      E----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKDK-EKSA-
C9KX15          E----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKDK-EKSA-
A0A6H0KRK1      E----L----IIANWYWFALSVFICL-SVAYLY-TRT-LVPVYQRQAVMLVKTG-GKNAN
R6DAG6          E----L----IIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKTG-GKNAN
A0A3L8AAP1      E----L----LIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKTG-GKTAN
A0A4S2AYX2      E----L----LIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKTG-GKNAN
A0A4Y9H477      E----L----LIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKTG-GKTAN
A0A0E2M2Y7      L----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKSA-EKSGA
A0A0K2J6Z0      L----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKSA-EKSGA
B2RKZ8          L----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKSA-EKSGA
A0A212GC82      L----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKSA-EKSGA
A0A254MU12      L----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKSA-EKSGA
R6CQ93          V----Y----LLSKWKWFVLSILFFG-GLAWYY-YAQ-SPLVFFRSVTVIIKDQ-SNKTS
A0A3D1NQW3      Q----T----VIANWYWFVISVFVCV-GCGYIY-ILR-TPKIYSRTANILVKDS-RKGGD
B0MT10          Q----T----VIANWYWFVISVFVCV-GCGYIY-ILR-TPKIYSRTANILVKDS-RKGGD
R7JGW9          Q----T----VIANWYWFVISVFVCV-GCGYIY-ILR-TPKIYSRTANILVKDS-RKGGD
A0A3D2BF46      Q----M----VIGNWFWFLLSTVVCL-SCALFY-IYT-APKVYNRTATILIKDG-KKGSE
A0A358R538      R----M----VAANWYWFVISAAVCL-GAAYYY-LAS-TPRIYSRTATILVKDS-RKGGD
A0A1Y4AAB8      Q----M----ILANWYWFAISVIVCL-GAGYLY-LAR-TPKVYSRKATILVKDD-RKGAN
A0A1Y3WWY9      R----M----ILMNWYWFVLSVLVCL-GVAYYY-LAK-TPKIYSRTATILVKDS-RKGGA
A0A1Y4U5L4      R----M----ILMNWYWFVLSVLVCL-GVAYYY-LAK-TPKIYSRTATILVKDS-RKGGA
A0A1Y3VCJ1      R----M----VIANWYWFILSILVCV-GAAYYY-LAK-TPKIYTRSATILIKDS-RKGGD
A0A1Y3QTW7      Q----M----VLANWYWFALSVLICL-GMAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
R6XWY7          Q----M----VLANWYWFALSVLICL-GMAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A4Y1X9Y9      Q----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A4Y1WM66      Q----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A6N4GYT3      Q----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A174AVF1      Q----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A656Q4F4      Q----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A1Q6EIY0      Q----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A5B5VN71      Q----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
E4M8L3          Q----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
I3YQ50          Q----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
R5UEY8          Q----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A1H4D866      R----M----VIANWYWFVLSALVCL-SLAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A5B3G4Y7      R----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A374A9J5      R----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A5B3GQN5      R----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A1Q6E9S3      R----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
D4IJ36          R----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A414Q925      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A415PUS9      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A108TCU0      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A413BA42      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
S3Y344          S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A4Q5G8Y8      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A412TGL3      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A413VJ33      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A414L0W6      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A412DP39      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A413ZSE8      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
B0NP84          S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
R6AK43          S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A412N2D9      S----A----VYRNRKWFILSVVVCV-LIGFLY-LKS-SPEIFLRTATVLVKDE-QKGGG
A0A1Y4JYS9      S----A----VYRNRKWFILSVVVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
R6LHA4          S----A----VYRNRKWFILSVVVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A3E5HPT8      I----Y----LIAHWKWFVLSILLFG-GYFWYS-YCE-TPFVYSRTAIVMIKTP------
C6IJ48          I----Y----LIAHWKWFVLSILLFG-GYFWYS-YCE-TPFVYSRTAIVMIKTP------
Q8A3U2          I----Y----LIAHWKWFVLSILLFG-GYFWYS-YCE-TPFVYSRTAIVMIKTP------
A0A3R6S1H6      Y----M----FKRYWYWFVLSVMVFL-GGAVYY-VKS-TAKIYTCVASVLIKND-SKGTS
A0A3R6SD81      Y----M----FKRYWYWFVLSVMVFL-GGAVYY-VKS-TAKIYTCVASVLIKND-SKGTS
A0A354WXN6      K----I----AWANWYWFVISIVLCL-SIAFVY-LKW-APKVYTRTASVLIKDD-KKGGG
R5IP14          E----I----GLANWKWFALSVIVCL-SIAYVY-VQT-LPYIYTRSASVIIKDN-KSGG-
A0A316SZX7      D----L----LISQWKWFALSICICL-GIAFLY-LKQ-ATPIYTRTASVMIKDD-RRGGA
A0A1Y4AIY1      Q----I----VKAKWYWFALSIGICL-GIAYIY-LLQ-APKVYTRSASVLIKED-RRSSR
A0A0J6CIR2      H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKG-G
A0A3D8HG59      Q----I----VRANWYWFALSVVVCM-SAAFVY-LQW-APKQYTRTASVLIKDD-TKGSG
A0A3R6S408      Q----I----VRANWYWFALSVVVCM-SAAFVY-LQW-APKQYTRTASVLIKDD-TKGSG
F3ZRU7          T----M----LMRHWLWYIVAVALAL-VLGFLY-IKS-TPKTYERHASVLIKDDKASGGA
A0A1C5Q1F3      H----I----ALANWKWFVLSLVVCM-GASFWY-IKR-SPDIYSRSASVLIKDE-TRGAQ
R7A239          H----I----ALANWKWFVLSLVVCM-GASFWY-IKR-SPDIYSRSASVLIKDE-TRGAQ
A0A3R6HIK7      Q----I----FKANWYWFVLSVILCV-GAGYLY-LLQ-APRVYTRTASVLVKEE-QRKSR
K5ZVW7          Q----I----FKANWYWFVLSVILCV-GAGYLY-LLQ-APRVYTRTASVLVKEE-QRKSR
A0A1Y4D5Z0      Q----I----LKANWYWFVLSVVACL-GLAYLY-LKQ-APLVYTRSASVLIKEE-NRWGR
A0A413VXJ7      Q----L----IWSNRYWFALSIILCI-GIAFFY-IQS-TSKVYSRKATVLIRDD-SKGGG
I9RSN9          Q----L----IWSNRYWFILSIFLCV-GIAFFY-LQS-SSKIYSRKASVLIRDD-SKGGG
U6RJK5          Q----L----IWSNRYWFILSIFLCV-GIAFFY-LQS-SSKIYSRKASVLIRDD-SKGGG
A0A1Q6GA32      Q----L----IWSNRYWFILSIFLCV-GIAFFY-LQS-SSKIYSRKASVLIRDD-SKGGG
I9RPU6          H----L----IWVNWYWFVLSVLVCG-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGG
I8YFS5          H----L----VIANWYWFVLSILICA-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGS
A0A6L3FCC6      H----L----VIANWYWFVLSILICA-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGS
I8Y597          H----L----VIANWYWFVLSILICA-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGS
A0A1Q6GBF5      R----F----VLANWYWFVLSVLVCT-GIAYFY-VKS-SSKIYSRKASVLIRDD-SKGGA
I8YFZ3          H----L----ILVNWYWFVLSVLVCG-GVAFFY-LKS-SSKVYSRKASVLIRDD-SKGGG
A0A1Q6GDH2      H----L----IWVNWYWFVLSVLVCG-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGG
U6RSB0          H----L----IWVNWYWFVLSVLVCG-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGG
I9SIK1          H----L----ILANWYWFVLSVLVCG-GVAFFY-LKS-SSKIYSRKASVLIRDD-SKGGG
I9GXM2          Y----L----VLANWYWFILSVLVCG-GVAFFY-LKS-SSKVYSRKASVLIRDD-SKGGG
I9TP59          H----L----VLANWYWFVLSVLVCG-GVAFFY-LKS-SSKVYSRMASVLIRDD-SKGGG
R5S343          G----I----VWMHKWWFTASLVVCI-ILASGY-LMW-MPNVYTRTASVLIKDS-NKGGA
A0A1M6K7I9      L----I----LRNNWKWFAASIFVCM-ALAFVY-LKS-TPKTYSRKATVLIRDD-KKGGG
A0A5M6A8C8      L----I----LRNNWKWFAASIFVCM-ALAFVY-LKS-TPKTYSRKATVLIRDD-KKGGG
A0A6L3FBE6      R----L----IFVNWYWFVLSVLICI-GFAFFY-LKS-SSKVYSRKASVLIRDD-SKGGN
A0A6L3FNG1      H----L----VLANWHWFTLSILVCV-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGS
A0A3R5ZMK1      Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A6L6NFJ9      Q----V----VLANWHWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A1Y3ZIA4      Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
K5Y1A4          Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A4Q5CIT0      Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A6L6NWL9      Q----T----VLANWYWFVLSVVVCA-GTTFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A3R6K8X4      Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A6N8D6C8      Q----T----VLANWYWFVLSVVVCA-GTTFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A3R6BKI7      Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A6N8CW60      Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A412M2W1      Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
K5ZX55          Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A415BDM7      Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A6L6MX19      Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A1Q6I3T6      Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A414XX40      Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A7AEU7          Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A5F0U645      R----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
K5ZBN2          R----V----VRANWYWFLLSVAVCC-AVAALY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A0J6CKW3      R----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A0F5IQM7      R----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A496CDT3      R----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A6G1ZKM3      R----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
S0GLB0          R----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A3R6NLC1      R----V----VRANWYWYLLSVVVCC-AIAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A416WYC9      R----V----VRANWYWYLLSVVVCC-AIAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A0F5IT40      H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKGGG
A0A496CX20      H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKGGG
A0A5F0UBI0      H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKGGG
A0A6G1ZHG0      H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKGGG
S0GSI7          H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKGGG
K5YB65          H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKGGG
A0A0F5IWP9      H----I----VLANWYWFLLSVLICC-GAAFLY-LKW-APKVYTRTASVLIKDN-TKGGG
A0A0F5IZT8      H----I----VLANWYWFLLSVLICC-GAAFLY-LKW-APKVYTRTASVLIKDN-TKGGG
A0A417LKQ2      N----I----VRANWYWFLLSVLLCS-GAAFLY-LKW-APKVYTRTASVLIKDN-AKGGG
A0A416TME1      H----I----VLANWYWFLLSTLFCC-GVAFLY-LKW-APKVYTRTASVLIKDN-TKGGG
A0A416XPE8      H----I----VLANWYWFLLSTLFCC-GVAFLY-LKW-APKVYTRTASVLIKDN-TKGGG
L8JI02          L----Y----LLSKWHYFVFAAIFLL-PGAYLY-TKYAT-KVYLVKASILLKSE-RKN-D
A0A4Q5WS95      V----Y---RYLPYWPLFAILAIFFT-ALSVGY-LRYAT-PVYEANATILIKDE-KKGAE
A0A501VZX6      L----Y---KYLPYWPLFALLLLISC-LGTWGY-LRYFAIPSYETSASLIIKDE-NKGVN
A0A399SH26      L----R---KFLPYWPVFIGLAILSM-ALAWVY-LRY-ATPVYEIAATLIIKDE-KKGVD
A0A501W1A9      V----F---RFLPFWPLFVVLIGVCL-AGAWAY-LHYVATPTYSTSASLIVKDE-KKGVN
A0A0E3ZGV6      V----Y---KFLPFWPLFVVLFILSV-AGAWAY-LKFYATPTYAITASLIIRDE-EKGVN
A0A1I2N4S1      L----Y---KFLPFWPLFLVLLLLGM-AGAWAY-IKYYTIPSYAVTASLLIKDE-EKGVN
A0A2T5YE44      L----Y---KFLPFWPLFLVLLVLGM-AGAWAY-IKYYTIPSYAVSASLLIKDE-EKGMN
A0A1M5BA90      M----Y---RYLPYWPLFALLLILAG-TAAYMY-LHYIAKPVYQISANILIKDE-KKGAD
A0A512B879      I----Y---SYLPYWPLFALLLVVFL-VAGSFY-L-YLTKPIYEISADILIKDE-KKGAD
A0A559PPI3      M----D---LFFPFWPLLAVILVVVL-FLAWGY-KNYAT-PIYEVSATLIIKDE-NKGVD
A0A1T5CS78      I----K---TFFPFWPLFLVLVVVCV-LGAWGY-LKYVT-PIYEASASIMIKDE-EKGVD
A0A0Q9Z8F1      I----K---TFFPFWPLFLVLVVVCI-LAAWGY-LKYAT-PIYEASASIMIKDE-EKGVD
A0A2N0U0M7      I----K---TFFPFWPLFLVLIVVCI-LAAWGY-LKYAT-PIYEASASIMIKDE-EKGVD
A0A1V9FHD0      L----N---WYLPYWPLFLILIVLGS-AGALVY-LNFFATPVYETYATVMVKDE-KKGVD
A0A4V4H170      I----N---WYLPYWPLFLILIVLGL-AGAWAY-LKYFSTPVYETYATIMVKDE-KKGVD
A0A1V9F098      T----N---WYLPYWPMFLVLLILGL-AGAWAY-LKFYSIPVYETYATIMVKDE-KKGVD
A0A4R2VU64      T----N---WYLPYWPMFLILLVLGL-AIAWAY-LRYFSIPVYETYATIMVKDE-KKGVD
A0A4S8HY23      I----N---WYLPYWPLFLMLIVFAL-AGAWAY-LTYYATPVYETYATIMVKDE-KKGVD
A0A1V9F383      V----N---WYLPYWPLFLILIIVGV-GSAWAY-LHFIAVPVYETNATVMVKDE-KKGVD
G8TRZ6          I----N---WYLPYWPLFLILTVVGL-AAAWAY-INFVAVKQYESYATVMVKDN-KKGVD
A0A4R5DL69      P-------------WLILSQIFSLLA-SF--IY-LRYST-PRYEITSTILVKDD-TKGTD
A0A1M4YED3      Q----F---RFAPYWPLFIILAIISG-VASYLY-LKYTP-PVYSAYSTMMIKDE-KRGVN
A0A2H3NSN0      H----T---IKRGKWIILGTCLAMIA-AFA-GY-TFMVA-PEYEAAATVQVE-K------
A0A2P6C324      E----A---VKRSKWVILGTCVFVTA-LTA-AV-TMMMP-QVYEAGAVVSVE-R-----E
A0A7C2DZI7      H----T---IRRGKWLILLTTLIVAG-VVT-IY-TYSLP-PVYESSAIVFID-T-RSSSN
A0A1M6XHU0      H----T---IRRGKWIILLTTLVVAG-VIG-AY-TYTLP-PVYESSAIVFVD-T-RGSGN
G2SF81          H----T---IRRGKWIILLTTLVVAG-IIG-AY-TYTLP-PVYESSAIVFVD-T-RGSGN
A0A5S9EYW1      H----T---IRRGKWIILLTTLVVAG-AIG-AY-TYTLP-PVYESSAIVFVD-T-RGGEN
D0MHQ9          H----T---IRRGKWIILLTMLVVAG-AIG-AY-TYTLP-PVYESSAIVFVD-T-RGGGN
A0A126PFG0      A----R---YRYHWSLFVAGVALALL-GAY-LY-TQLVQ-PAYEVRASLLVEGE-KKTPA
A0A3M1N7Z3      I----V---LSREWWWPTLSVLFAAF-TAW-AY-LRYTE-ATYQTTAVVQVNLA-QAVGG
                                                          :                 

A0A1T5MMH4      -------------ASELGI----SILAGKDQQNTDLISGEIEMIRSRLFLDQVLDSL--N
A0A2W4R1L8      -------------ATELGI----NRLV--EDQNLNIMSGEIEIIQSKLFLARVLDSL--K
A0A2E5CV79      -----------------------SMIMQYGSRDRSDMSNEIEVLRSRRLAKDVVKLF---
A0A2D4ZVH1      -------------YSYAGAGIENLLTSTYGIGVGSTIANELQIMKSRKLSYDLAERI---
A0A0K8QSK7      F------------SQTESAISSQAFEGFGIMGQNNNIYNQIEVLKSWPIIEEAVQEL--G
A0A1V6CN82      F------------WRQAGGFSGEALRGFG--TSYQGIQNQMIIMKSQPVVAKAIREL--G
A0A1M4XZ45      L------------SGAMGGAQQSIFQGLGGMNSMQNIYNQMVVLSSTPIISRTLNEL--D
A0A399D319      L------------ASGAGGSSEGIFQGLGMMNSMRNIYNQMVILNSTPIVSRTLNEL--D
A0A1V5IPN7      -----------------------ILLLTNQGGGKNSINNQIELMRSKPILNAAYEIMKKN
A0A1M6GR99      -------------SGSSSSSGESRYINSELLSRSQNIQNELEIIKSFPNISQTVRNL--N
A6EBM4          -----------------------DIADALNTNTATNMQSESFAIESRHLLLNAIKRL--Q
A0A7C5M4P4      -------------SNILNLP------GTESQNAYNLMSSEIELITSRLFFNKIIESV--Q
A0A1M6TTV4      -------------AGILGIQ-------NPMDQDIKGLSGEIEILKSRLFASQVVNAV--G
A0A4Q8RX32      -------------ADPTSFL-----PGSELFSGRNTFHNSLLTLQARPLLEKVLNKL--N
K0X1U5          GGLSSLM------GGISG-----GGFSLDGMIGGGSVNDEILVISSHSLIREMVQRL--D
R5EXK3          GGLSSLM------GDIAG-----GGFSLDGMIGGGSVNDEILVISSHSLIREMVQRL--D
A0A401UAP7      -------------ANEFGIT------KIMEDQNLNLISGEIELIQSNLFLSRVIDSL--K
A0A1W2GF52      -------------ANLLGLQ-------NPLEQDIKGIAGEIEILRSRLFFSKVVDAI--G
A0A2G5L7B8      -------------AGILGIQ-------NPMEQDIKGLSGEIEILKSRLFASQVVDAV--G
A0A523GAC0      -------------ANFLGF------LEINEEQNLNNISGEIELIKSKLFFDKVIKTL--D
L8JW09          -------------ASELGL------LGLSENKNLNIISGEIELIKSKLFFSKVIETV--D
A0A364XUP5      -------------ATELGI----ATITSDEPQNADLISGEIEIIRSKLFLNIVLDSI--N
A0A1M5RLA9      -------------ATEFGI----KPTVED--PNFNLLSGEIELIESRLFLGRVLDSS--D
A0A385SFR9      -------------ATEFGI----KPTVED--PNLNLLSGEIELIESRLFLGRVLDSS--D
A0A5M4A9J4      LEGSGGS------GSLNASD---VFQGFGLFQGKQNLENQIQILQSWTLVSKAVNEM--N
A0A5M4B1C7      LDGSSSG------TSFNASD---VFQGFDLFQGKQNLENQRQILKSWTIISDAVDKL--H
A0A0D3LFR6      -------------AASFGF----VDSD---KATMEGMSSEIELIKSKLFLNKVLSAL--D
M7N6D4          -------------ADFLGY----RSLDSDPNQNMNGMSEEIELIKSKLFLTRVLKAV--D
A0A4D7K1D4      -------------TSVLTFG------VDPQKNNMNALSGEMELLRSKVFFSRLIDSL--D
A0A5C7MX19      -------------AQILGVE------KIAVEQDNAAINREIQLFKSRLLVERIVDSL--P
A0A1Q3ZMZ7      -----------------------EVLELENINSKKSLSSNIELLKSPVLFENAIKKL--D
A0A2D8JJW3      -------------SGIAKMPG--FEAFSDDKK----LEDKIRNIGLRPIAQATIDKLSEP
A0A2W2AFF7      MDGKQLL------EDLGFLSGKGN------------VDNEVEIFKSRSLMESVVRDM--Q
R7PCR1          MGRAGRG------ANML--------LELNGVSVGNSLQDETFILQSYRLMERVVSRL--G
A0A1G9E2A9      -------------ANVL------FGRNSDLGSQVENITGEIEFIKSRLVYNRVIDSM--D
A0A098LL25      -------------AGVLGLNK--FNDENMPGNKLSTISGEIEFLKSRYLYEKIVDRM--K
A0A6J4H627      -------------ANLLGISD---------NDGMANMSGEIELIRSKLIYDEVIRRM--D
A0A6C0GJI1      -------------ASVLGLNGV-----NAVEDMSANLSGEIELIRSKLIYDEVIKRM--D
A0A2T2YJE8      -------------AGRLGLGGT-----IENQQTLSNLSGEIEIIKSNFTFERLQQKL--P
A0A127B287      -------------AKVLELPGA------GMESDLGKLQGEVDLIKSDLVYDRLKKSM--P
A0A6P1P2P6      -------------AKVLELPGA------GMESDLGKLQGEVDLIKSDLVYDRLKKNM--P
A0A3M9N829      -------------AGVLGL----ESNGLPIEAGAGKLQGEVDLIKSDIVYERLKKTM--P
A0A0P0CSF9      -------------AGVLGL----QNSGLKVESGIGQLQGEVDLIKSNIVFERLKKTM--P
A0A5M8QQB8      -------------AGVLGL----ENNGLKVESGIGKLQGEVDLIKSNIVFERLKETM--P
A0A3M9MNC3      -------------AGVLGL----ENNGLKVESGIGKLQGEVDLIKSNIVYERLKKTM--P
A0A5B6TAX2      -------------AGVLGL----ENNGLTVESGVGKLQGEVDLIKSNIVYERLKKTM--P
A0A5N1IQ33      -------------SGVLGLESA--GKAVDARQSSKNLAGEVELIKSSVIYQRLRDSL--D
A0A512AYT3      -------------AGALGLGGP-MGDAASSQQSMASLSGEVELIKSDLIYENLKRRL--N
A0A5M6CYN7      -------------AGALGLGGP-LSD----QQAISSLSGEIELIKSDLIYENLKRRL--N
A0A369QP10      -------------AGRLGLDG-----TIENQQNLSNLSGEIEIIKSNLTYERLQQKL--P
A0A126PDF2      -------------AGVVGLGGQ-LAAA-DPR-ASSKLAGEVQLIKSEIIYKELRDSL--D
A0A2Z3GKA1      -------------AGVVGLGGQ-LAAA-DPR-ASSKLAGEVQLIKSEIIYKELRDSL--D
A0A502GZP7      -------------AGVVGLGGQ-IAAA-GPSVGASKLAGEVQLIKSEIIYKQLRDSL--N
A0A519SBU8      -------------AAKVGLGGL-ADA---DARNGAQLAGEVELIKSNLTYKNLKERL--A
A0A4Q3JNZ3      -------------ADKFGIGGI-KG-----EP-GNQLAGEVELIKSNLTYQHLKERL--A
A0A519Q9V3      -------------AANLGLGAA-KGG---DSP-SNQLAGEIELIKSNLTYQHLKERL--A
A0A0M3RW20      -------------AGTLGLGGG-LAGP-EGPLSMNNLSGEVELIKSNLIYRQLRDSL--E
A0A495VFX4      -------------AGTLGLTGK-LAVA-EGPLSMNNLSGEVEFIKSNLIYRQLRDSL--E
A0A1S9B3W0      -------------AGQLGLLP---PGAADPRQSMSQLAGEVELIKSDLIYTRLRDSL--P
A0A1W1VRL3      -------------AGLLGLGA---GGSVEKRRPGANLEGEVELIKSNLIYRRLKDSL--A
A0A1M6R305      -------------AGALGLGGA-LGEGVAGRQSISKLSGEVELIKSNIIYRRLKDSL--D
A0A4Z0PHK3      -------------AGALGLDGP-LGQAV-GASSLNKLSGEVELIKSNIIYERLKDSL--E
A0A2M9B9H9      -------------AGILGLDGP-VGQAV-GSSNVNKLSGEVELIKSNIIYQRLKDSL--E
A0A4Z0QCY9      -------------AGVLGLDGA-LGQAV-GASSLNKLSGEVELIKSNIIYQRLKDSL--E
A0A418R9X5      -------------AGVL-LGG--IGQAAEQKQTLNKLSGEVELIKSDIIYRRLKDSL--T
A0A428JSJ3      -------------AGLL-LGD--VGQAAEQKQNLNKLSGEVELIKSDIIYRRLKDSL--E
A0A428KI59      -------------AGVL-LGD--IGQAAEQKQTLNKLSGEIELIKSDIIYRRLKDSL--A
W8F1I6          -------------AGVL-LGD--IGQAAEQKQTLNKLSGEIELIKSDIIYRRLKDSL--A
A0A246FQC0      -------------AGVLGLGA--LGGAIDQKKNLNSLSGEIEVIKSDIIYQRLKDSL--D
A0A372E5P8      -------------AGVLGLGG--LGGAVEQKQSLTKLSGEVELIKSDIIYSRLNDSL--A
A0A1H3EMW1      -------------AGVLGLGG--LGAAVEQKQSLNKLSGEIELIKSDIIYRRLNDSL--A
A0A1H9ZSN3      -------------AGVLGLGS--LGGAVEQKQSLTKLSGEIELIKSDIIYSRLNDSL--A
A0A5N1J2M4      -------------AGLLGLK---LGESDKQRVGTNQLSGEIELLKSNLIYEKVRQSM--N
A0A519S476      -------------AANLGL-A--SVKALDNTQPANQLAGEVELIKSKLTYQALKERL--A
A0A4Q3JRW8      -------------AANLGFGA--AVKGEEGANTTNQLAGEIELIKSNLTYKNLKDRL--A
A0A519M923      -------------AANLGLGG--AAKGADDGRPGAQLAGEVELIKSNLTYQHLKERL--A
A0A4Z0ENW1      -------------ASALGLG---MAMGGGDNNQASQLAGEVELIKSGLTYKRLKQTV--A
A0A519UDB4      -------------ANDLGLG---ELTGRGNDNNSSQLSGEVELIKSNLTYKRLKQVV--P
A0A3S0QKV1      -------------DAELNLPGL---VANP-QQNVNKLAGEVELIKSDLIYSRLRDSL--P
A0A328BL48      -------------AGDLGLLAA---GAQAGQQGMSKLSGEVELIQSDLIYTRLRDSL--E
A0A5R8WLY4      -------------AGDLGLLSA---GAQPGQQGISKLSAEVALIQSDLIYTRLRDSL--E
A0A1I5WSL8      -------------GSALGLAGQ-MAPAAADKGRGGKLAGEVEVIKSNIIYRRLKDSL--A
A0A0U3JVM7      -------------GSALGLAGQAAAPAVMDKGR-TKLAGEVELIKSNIIYRRLKDSL--A
A0A1G1SSV2      -------------GSALGLGGQ-GAPAVVPNGR-TKLAGEVELIKSNIIYQRLKDSL--A
A0A1G1SXV7      -------------GSALGLGGQ-GASAALPNGR-AKLAGEVELIKSNIIYQRLKDSL--A
A0A6G8CBJ6      -------------AGLLGMGP--VGGAVEKRQELANLSGEVELIKSNLIYRRLKDSL--A
A0A0W8EDI5      -------------SAVLGLGG--VGGSAEAQQNAKNLAGEVELIKSNLIYRKLQDSL--N
A0A3B7RBP8      -------------TAVLGLGA--VGGAAEAQQNSKNLAGEVELIKSNIIYRKLQDSL--N
A0A3R9P8H7      -------------AGVLGLGG--LGGAVEQKQNLNKLSGEIELIKSDIIYRRLKDSL--T
A0A238WIA7      -------------AGVLGLEG--LGKMVEQKQTVTQLSGEMELINSDLIYRRLRDSL--E
A0A212UCJ7      -------------AGVLGLEG--LGKMVEQKQTMTQLSGEIELIKSDLIYRRLRDSL--D
A0A4Z0MQE1      -------------AGVLGLEG--LGK----APSTSQLSGEIELIKSNLIYRRLRDSL--D
A0A4Z0PCF4      -------------AGVLGLEG--LGKMVEQKQTIAQLSGEIELIKSDLIYRRLRDSL--D
A0A6M6BED0      -------------AGVLGLEG--LGKMVEQKQTIAQLSGEIELIKSDLIYRRLRDSL--D
A0A5D6VDG1      -------------AGALGLG---LGAGAEARQNMNNLSGEIELIKSNLIYRQLKDSL--D
A0A6H1CVS0      -------------AGALGLGQT-LGAAVETRQKLNSLSGEVELIKSNLIYRQLKDSL--D
A0A243WHR7      -------------AGALGLGGA-LTGDI--RQSGNKLSGEIELIKSNIIYEHLKDSL--A
A0A5B8A0P6      -------------AGALGL-GA-LGQG-DGRQNINKLSGEVELIKSNIIYRRLKESL--A
A0A076HRT9      -------------AGTLGLGGA-M-KEAEGRQSLNKLSGEVELIKSNIIYRRLRDSL--D
A0A4Z0PVM7      -------------AGALGLDGP-LAQAVGS-SSLNKLSGEVELIKSNIIYQRLKDSL--E
A0A1M6DHW8      -------------AGALGLSGT-MGKGIEERQSINKLSGEVELIKSNIIYRRLKDSL--D
A0A4Q5LC61      -------------AGALGLAGP-LGKGIEEQQTLNKLSGEVELIKSNIIYRRLKDSL--D
A0A2N5YXE2      -------------NQILGIN---AGVMETD------LAPVIELVRSNEFLKTVVASL--P
K0XJ09          DM-----------SAVLELN---GGISGSG------VENEIYILQSHQLMREVVGRL--H
R5EUZ0          DM-----------SAVLELN---GGISGSG------VENEIYILQSHQLMREVVGRL--H
W0EQS0          DM-----------SAILEMN---GGVSVGS------VDNEIYILQSHQLMREVVERL--H
A0A1Y3WE15      DM-----------SAIMELN---GGISGSG------VDNEIYILQSRQLMREVVERL--H
A0A1Y4GUK3      DM-----------SALLELN---GGISGSG------VENEIYILQSRQLMREVVERL--N
A0A2U1FKU2      SGGLSQF------QDLG--------LLMGNSE----VENELLVFKAKRLTAIVVDKL--N
A0A0A2F954      TSGLQQF------QELG--------LMTGNSE----VENEILLLKSKRLTAVVVDKL--D
A0A0A2FW91      TSGLQQF------QELG--------LMTGNSE----VENEILLLKSKRLTAVVVDKL--D
A0A2D2N2N1      TSGLQQF------QELG--------LMIGNSE----VENEILMLKSKRLTAIVVDKL--D
Q7MWZ2          TSGLQQF------QELG--------LMIGNSE----VENEILMLKSKRLTAIVVDKL--D
T2NDT6          TSGLQQF------QELG--------LMIGNSE----VENEILMLKSKRLTAIVVDKL--D
W1R7P9          TSGLQQF------QELG--------LMIGNSE----VENEILMLKSKRLTAIVVDKL--D
A0A1R4AFZ0      TSGLQQF------QELG--------LMIGNSE----VENEILMLKSKRLTAIVVDKL--D
A0A1R4DVZ7      TSGLQQF------QELG--------LMIGNSE----VENEILMLKSKRLTAIVVDKL--D
A0A7C0WKI7      -------------NTLFGVT---P-FGKQMTE----INNQVEILKSRSLAGKVVDDL---
A0A2A8CVM9      -------------SGPGGMG---A--FGQQRD----LASEVGVLQYSAELASRVVAELRA
A0A5M4B212      LTTPTDS------EANVFQG---FGLFQGTQN----TENQIQILKSWTQIRKTLEHF--N
A0A3D1KEX9      YANNSAL------NALKQLN---GVQVTDN------LKNEIFILQSRRLMEMVVERM--N
A0A358Y7S2      -------------RDILGKD---ALNVEKALN----LNQEVELLRSELLINKVIEKL--G
A0A1X7J248      -------------ASVFGFN---P--LSEESSNLNTLSGEVELIRSKLFLKQVINKL--P
E4TQD2          -------------ASVFGFN---P--LKEENSNLNTLSGEVELIRSKLFLKQVIDKL--P
A0A2J6HHN3      -------------GQMLFET---KNLYDED------IYRKIEVMRSPVFIRRVVSRL--P
A0A1Y3WMT8      GGALSSL------VGDVTGG---G-FSLDGMIGGGSVNDEILVISSHTIIREMVQRL--E
A0A1Y4GQU1      SGSLSSL------MSGVSGG---G-FSLDGMIGGGSVNDEILVISSHTIIREMVQRL--E
A0A6A0R272      -------------TDFLAID---M--FSESFNQYNKILTEARIISSRTMIEKALEKL--P
A0A1V5W8T5      -------------EDLLKID---N--IYGQTS----ITNLIELIRSREFLKRTLHKL--N
A0A2T8HKA9      VTARFTR------SSMMNTV---S------------VASEILQLKSKELMRHTIATI--Q
A0A2I0QZ80      -------------ADLLDLS---D--VRTEGS----IAKEIELLRSQLLFKKAIKQL--P
A0A3E1F1A3      -------------ADVLGFA---E--ARSDGS----IAKEIELLRSQMLFEKAVQNL--P
A0A2U2XBJ3      -------------ADVLDFK---D--IRKEGT----IAKEIELLRSQLLFEKAVADL--P
A0A4Q4KU94      -------------ADLLDFK---D--ARKDGS----IAKEIELLRSQLLFEKAIDDL--P
A0A3B8INU3      -------------ATLFGFS---N---FNENPNLNYLSGEIELLKSRLFFSQVISAL--P
A0A2W1NDY9      -------------QRILEFK---D--FNTENN----LSADVELLRSPFLMEKVLMNL--N
A0A5C8AQR5      -------------KDVLNME---N--INSKSN----VSSEIELLKSQFLFEKAIDKL--N
A0A1G0CI31      -------------KEIVEIE---N--INTKDN----IASEIELLRSELLFGMAVERL--H
A0A556N0M0      -------------KELLELD---N--INKIDD----ISSEIELLRSQLLFEMAISKM--N
F2IKD6          -------------KQLLEID---N--INKRID----ISTEIELLRSQLLFDMTIARM--N
A0A1I7BM74      -------------ANVLDLK---N--VNNDGN----ISKEIELLRSQFLFEEALKRL--N
A0A2G2FJ17      -------------ADVLDFK---N--IKEDAS----ISREIELLRSEYLFEKALDRL--D
A0A2E3R1D0      DVLPEAM------P-----S---G-FWRQERN----LSNELLVLDQSMPLAEAVAAR---
A0A2T2USC0      SILGEQG------SSF---S---P-FGSQ-NN----LANEVLVANQSEAITRNVATR---
A0A2T2V0F3      SILSESG-------SM---N---P-FGSR-RN----LANEVLVANQSEAITRNVAVR---
A0A2T2S682      AVPSLTG------GRSSGAS---A-LGGQRRS----LSNQILVINQSEALAQEVAVR---
D5H561          TESAIGA------QAQAQGS---G-LLPSSSS----LRNELMFLRNSQALRERVAER---
A0A2H3NWA9      LVS--TR------GRM---V---P-GLAGNRS----LSNQLFVLRQSRELAQRVADR---
A0A2A8CVB6      VVAQLSS------RGL---S---P-YSAESRT----LQNELFVLQQSMTIPNRVADS---
A0A2P6C1S6      VLSGLGR------GRT---S---P-FLQQDQT----LQNELLILRQSRTIANRVARQ---
A0A2T2UTM4      VLSGLGR------GRR---S---P-FGQRDQT----LQNELLILRQSRTIARRVAKR---
A0A414ZBF2      MGESAAF------RDVFSLG---N----------SKVDNEMGFFKSKRLMMEVTRQL--R
A0A1Q3Q573      -------------TQILGID---NLVFEKDPTE---INREMQVLKSTMLLGKIADKL--P
A0A662BAY3      LTNKNAN------EDNVFQG---FGITDSDRN----IFNQLIVLTSTPILNRTLEEL--D
A0A4U3L369      GSSSL--------SASSGIF---Q-DLGGAFSMASTVNNEEEILLTRSLMYRVVKDL--Q
A0A357YNR3      -------------GGASEVT---TFREMGIVSRRNNADNEVEILKKTMIVEKVVRDL--G
A0A5E8AX52      -------------AVILGVQ---NPLENSGVNS---LSGEIELLKSNLFFSRVVEAI--N
F4KK08          -------------SAIERLA---Q-FTGDKHSYSDDVSNQIIILGTERVVSETVRRL--G
A0A6B5PK86      -------------KNVIDVE---N-INSKKDV----FFSEVELLRSELLFKQAMNSL--A
A0A2G2F510      -------------KEVLDFQ---N-LGSRDNQ----LSGVVELLRSELLFKRAVKSL--S
A0A316JZ08      -------------ADVIDFE---N-INTLDDD----ISAVVELLRSELLFERAVDKL--N
A0A496LCF9      -------------SYMQNMT---QNFGVVDKTN---IENQILLLRSQDLIARTIDSL-PQ
A0A5P2G2A9      SGMLGSS------SSGSNSS---FGDLSSLLNVKSSVDNELLILQTRDLMHKVVVDM--H
A0A3C0ZQC7      QMPLFDV------TGIGAVK---N------------IKNELEILKSRSLAEAVAVRL---
A0A419VXB7      ----------------VDLQ---NIFSSSPLKSDVKLSNHIEILKSFSLNYEVLENL--G
A0A0B0BTJ4      NSDL---------TGFMPGR---M-MYRTNSG----VEDELLIMGSRSIMERVVAEL--D
A0A3B9CNN6      NSDL---------TGFMPGR---M-MYRTNSG----VEDELLIMGSRSIMERVVAEL--D
R5X290          NSDL---------TGFMPGR---M-MYRTNSG----VEDELLIMGSRSIMERVVAEL--D
A0A1Q6E6I7      NSDL---------TGFMPGR---M-MYRTNSG----VEDELLIMGSRSIMERVVAEL--D
C3J7R8          -------------NVLSELF---ESSALTSLGGRSAVENELFILKTDFLIDQVIERL--N
A0A1G8BVM8      GI-----------SEAAAFQ---DMFSMGSNS----VYNEMGILKSRQLMLQVVEQL--G
A0A1I1FXP9      -------------SGLLSRV---Y-SATGEEMQSSNLSGEIELITSFMLYNKVIDKMGEN
A0A3N4H5N3      -------------TTVAESS---VLNELDNLKTSIKLENEIEKLKSKSLMNEAVISN--K
A0A2P8EAX2      -------------GNLTESP---ILSDLENIKTTVKLDNEIEKLRSKSLLNEAVISK--S
A0A4V2F6N9      -------------GNLTESP---ILSDLENIKTTVKLDNEIEKLRSKSLLNEAVISK--N
A0A3B9FXJ0      -------------SSSLDFA---DILRPGNVDR---LNEEMTVITSKSYKYNALQEL--P
R5GSU5          SRRMPSN------MNALLEL---N-GITAGDQ----LQNEIFILQSHRLIERVVTRL--K
A0A2A3UE91      -------------DDILKLN---S-LSNNGNV----LAEAIEQIRSKVFLKRVVEKL--D
A0A0A2G557      PL-----------ADIMKIS---G-TDIGGIKGNDKIENEIIIFRTERLLSRVIDEL--N
A0A2N2WFW8      -------------QKLFESK---N-FYDED------IYRKIEIMRSPVFMERVIEKL--P
A0A1F3IU95      -------------EKLFDNK---T-YYEDD------IYRKIEIMRSPVFMQRVVSNL--P
A0A3D0VUF6      -------------EKLFDNK---T-YYEDD------IYRKIEIMRSPVFMQRVVSNL--P
A0A1T4PT95      PLADI--------MKISGAE---L-GFKGTDK----IENEIIIFRTHNMLSQVVNRL--N
A0A6I6JYY3      LEESGVS------ANVFQGF---G-VMNSMRN----IFNQMVIMHSTPLITRTINEL--D
A0A2A4PYG9      -------------QKVLNVE---N--IYEQ-D----VAGEIELIRSRAFLSNALSRI--D
A0A1F3K695      -------------DKLLNLE---S--VYENTN----LAHVVELIRSKEFLKRAFEKL--P
A0A353KZR1      -------------DKLLNLE---S--VYENTN----LAHVVELIRSKEFLKRAFEKL--P
A0A2N2WYB5      -------------TRLLNIE---D--VYQNDD----ISKVIELLRSKEFLKRAFSNL--P
A0A1F3K4G0      -------------TKVLKIE---D--VYQDND----ILKVIELLRSKEFLKRTFLKL--P
A0A356H8Y3      -------------TKVLKIE---D--VYQDND----ILKVIELLRSKEFLKRTFLKL--P
A0A351HSA6      -------------TKVLKIE---D--VYQDND----ILKVIELLRSKEFLKRTFLKL--P
A0A1F3Q014      -------------SKLLNVG---N-ITEPDNG----LAEGIELLKSKVFLKRVLSQL--P
A0A2D5KD44      -------------NRLLDVE---D--YYESND----ISSEIELLKSPLLMEATLEKL--P
A0A6N9NIX1      -------------NQLLEVQ---G--FNETGD----ISGEIELLKSKYLILKTIENL--P
A0A2A4YXP3      -------------SSVLNVG---G-GFKESNS----LAKDVEILRSKLLFKRALRKI--P
A0A1F3R158      -------------DQVLKVD---N--FEEKED----VEKDVELLKSKFLLKRALSKL--P
A0A2M8ADX2      -------------DQVLKVD---N--FQEQED----VAKDVELLKSKFLLKRSLLKL--P
A0A1J5B2H0      -------------QKIFQTN---NINVEEDNN----LAKQIELMRSSLFLNRVISKL--P
A0A1V5N756      -------------RQVFGKK---T-----QVD----LAKKVELLNSSMFLSRVFSKL--P
A0A651GU15      -------------TKILQVN---K-IYEEKT-----LSAELELLRSKLLLQETVKRL--P
A0A3Q9FR88      F------------AEKFGIM---N-NSLNDGK----LESEMALITSGVTYNRVIDSL-ID
A0A553GEX3      F------------AEKFGIM---N-NSLNDGK----LESEMALITSGVTYNRVIDSL-ID
A0A150ADJ9      F------------AEKLGLM---S-NSLNDGK----LESEMALITSGVTYNRILDSL-ID
A0A1B1FWQ4      F------------AEKFGIT---N-SSLEEGK----LESEMALITSGVMYERIVDSL-ID
A0A1S1Z228      F------------AEKFGIA---N-SSLEEGK----LESEMALITSGVMYERITDSL-ID
A1ZKR2          -------------VGMLGIK---G-LIPGGSYSGGNLVGEIEFIRSQIIFNDVINAM--D
A0A1Q3GX01      -------------VQMLGIK---Q-LITNNN-SNGNLIGEIEFIRSQIIFNAVINTM--D
A0A349DQI4      -------------VQMLGIK---Q-LITSNS-INGNLIGEVEFIRSQIIFNSVIDAM--D
A0A4P5TMD1      LGIGVTS------GGVNSAD---Q-MDHNE------LQKNIQIMKSNVILDRVIDQL--P
A0A2N3IIZ0      -------------SAGLDL----R-IGLNQENPIDNIAGELEVIRSPLIYEEVLKNI--D
A0A1F3SJM1      -------------KDVLNID---N-LNVRGDQ----LSSVVELLRSELLFERAIAHL--N
A0A2G2EB96      -------------KDVLDIE---N-INSRDNE----ISSVVELLRSELLFERALNKL--N
A0A2G6PRA9      -------------KDVLNIE---N-INSREND----MSGVVELLRSELLFEKALNKL--N
A0A497D5Z2      LSGNMNN------GDVFQGF---S-LMGSDYN----LFNQMAVLKSKPLIRRVVDEL--D
A0A662B170      LSGNMNN------GDVFQGF---S-LMGSDYN----LFNQMAVLKSKPLIRRVVDEL--D
A0A2A5FYT6      -------------SQILEAT---P-AYLRQD-----ISGDIEFLRSKEFFKNILNTL--D
A0A2E6SYP1      -------------NQMMNFE---N-IYETN------LVAEMSRLKSKKMLSEALADL--K
A0A2E5RLE8      -------------NQMMNFE---N-IYETN------LVAELSRLKSKKMLSEALNTL--N
A0A2E7TQF6      -------------NQMMNFE---N-IYETN------LVAELSRLKSKKMLSEALNTL--N
A0A2E6GVY9      -------------NQMMNFE---N-IYETN------LVAELSRLKSKKMLSEALKTL--N
A0A350JJ90      -------------NRILNV----G-DIYEDAD----ISKDIELLRSPEFFKRVIANL--P
A0A3M1CDV2      -------------HQILQLN---P-ANTEGNNK---VAEAIEQIRSKTFLERIINNL--N
A0A6C1QGZ7      -------------TRILPTA---G-IYEED------IARQLELMRSDVFLQRALSRL--P
A0A4P5U6G4      -------------SKAIGLD---N-IGLEASRGNADLQRDIQVMKSNLIMDRVLDKL--P
A0A2E2TFD1      -------------SQLLEID---F-GKNQNED----MMSDLEVIRSKEFLKTIFKKL--P
A0A2E4ELE6      -------------TQVLDLE-----RMNEKAD----ISADIEIIRSKEFLKTIFAKL--P
A0A522EYA6      -------------SRILNVD---N-FNEAQND----IAKSIELLRAKVFFKRVLATL--P
A0A2E3XZI5      -------------LEFMQMN---P-LSSNSTN----LKSELAIIKSQKSILRLIKKL--K
A0A6I7QXV0      -------------AQILGTD---E-LLRGDDD----VSREIQIIRSRLLVARALEHL--P
A0A2M7NLQ9      -------------SELLGR----G-IFSSDENVTNFLVGEIELILSRSVYEEAVKRL--D
I4AFR0          -------------SELLGK----G-IFASDENAINFLSGEIELILSRSVYEEAVKKL--D
A0A2N2Y3E5      -------------NKILNI----Q-NIYDEFN----PNQTIELIRSKEFIKRVIKSL--P
A0A2D9D7T6      -------------KEVLGK----D-AFTDRESADGGLSKYIELLKSEFIFEKAVERL--S
A0A1F3PPL5      -------------DKVLEI----E-NLREENT----IAQTIELLRSQEFLKRVFSKL--P
A0A357QK06      -------------DKVLEI----E-NLREENT----IAQTIELLRSQEFLKRVFSKL--P
A0A662AEA4      -------------QKILNI----E-DIYEKKD----ISNVIELLRSKEFLKRVFKKL--P
A0A0S2HYK8      -------------SQVFQLD---D-LYEDNKK----LNKTIALIRSKEFLKRTFAKL--P
A0A2N5ZWN6      -------------TQVFQLD---N-LYEDNKK----LSKTIALIRSKEFLKRTFSKL--P
A0A2E0FJ09      -------------RRILNVK---N-PLQEDET----LTGDVELLRSPLLMEKTVASL--P
A0A1F3FZ62      -------------NKVLQTA---N-IYDGEND----ISKTVELLKSKVFLKRVFSKL--N
A0A1F3K211      -------------NKVLQTA---N-IYDGEND----ISKTVELLKSKVFLKRVFSKL--N
A0A1V6I2U9      -------------NQILGI----S-SNLMEKD----LAPVIELIRSNEFLKTVVEVL--P
A0A2H0B957      -------------NKILNL----T-NAVEEIN----SIQTIELIRSKEFLKKTFNKL--P
A0A1F3CFW6      -------------NKVLNL----T-TAVEEIN----SMQVIELIRSKEFLKRTFNKL--P
A0A2M7E2T8      -------------NKVLNL----T-TAVEEIN----SMQIIELIRSKEFLKRTFNKL--P
A0A2M7NC69      -------------NKVLNL----T-TAVEEIN----SMQIIELIRSKEFLKRTFNKL--P
A0A1F3KLL5      -------------AEILGFK---N-NFIKPSE----LPAVMELIRSNEFLKRVFVKL--P
A0A359D1M1      -------------AEILGFK---N-NFIKPSE----LPAVMELIRSNEFLKRVFVKL--P
A0A0F2NS19      -------------NKVLQV----D-NFSKTED----VAKDVELLRSKLLLKRALSKL--P
A0A2A5H8X6      -------------NKVLQV----D-NFSKTED----VAKDVELLRSKLLLKRALSKL--P
A0A2H0GAU8      -------------NKVLQV----D-NFSQKED----IAKDVELLKSKLLFKRALSKL--Q
A0A2M8FTK1      -------------NKVLQV----D-NFSQKED----IAKDVELLKSKLLFKRALSKL--Q
A0A2A5B3B0      -------------SKVLEV----R-EFQETNS----LSKDVEILKSKLLFKRALKRI--P
A0A5C6RXM7      -------------NQVLNV----D-NFHENNT----IDKDIEILRSKLLFRRAISRL--P
A0A1F3C1M2      -------------NQLLNI----E-NVSDNNE----LAQIIELIRSTEFLKRTFNKL--P
A0A1F3DS87      -------------NQLLNI----E-NVSDNNE----LAQIIELIRSTEFLKRTFNKL--P
A0A6A0R6K9      -------------NRLLDV----E-DYYETND----ISAELEILQSNIIVERAIKSL--P
A0A2E7CT70      -------------DELLEI----Y-SFQQKTN----INSEVELLKSQIIIDKAIKKL--N
A0A2D5V560      -------------NGFSDL----Y-SYNINTN----LNSEIALMNSEKAIEKVIRDI--E
A0A2D7K5A8      -------------NGFSDL----Y-TYNINTN----LNSEIALMKSQKAIDRVIEDL--N
A0A2E1XQ82      -------------NGFSDL----Y-TYNINTN----LKSEIALMKSQKAIDRLVEDL--N
A0A5C8A5B4      SE-------------NSEFI---KGTSYLSNS--VDLEDNLAVLTSNKIMTSTLQRL--D
A0A4Y9ITE2      FL-RSFS--------MADM---------FGGK--SSVDDEIAIMYSHSLFSEIVKKF--Q
A0A5M8NYX7      AM-DMNT--------FSDL----G---FMPKI--GSFDNEIEVLQSKTLMKEVVDSL--N
A0A3D5KRY6      TD-LNNI--------YRQL----S---TIQGG--PAIQDEVGVLQSYNLSLQTVKYF--N
A0A0E3V905      SE-QSSS--------LKEL----G---VFAHK--QVVENEIEILRSFTLMNRVADKL--H
A0A553ETH6      -A-NASE--------LGLV----N---FGENNNINVISGEIELIQSRLFFNKVIDNI--D
A0A640Q161      KA-NVVS--------IEEV----Y---GLDTKRKDYMQTQYEILQSRQIAERTVESL--S
A0A640QU49      KA-NVVS--------IEEV----Y---GLDTKRKDYMQTQFEILRSRQIAQRTVESM--S
A0A1Q3PII2      FN-ESAL--------LEEL----G---LPNAT--SSVENEIEILRSRTLLSQVVADL--H
A0A351BXT2      VL-SSSL--------IPEF----Q---DFITD--RYISNEIEVLKSYKIREMVAENL--I
A0A2K8Z965      SE-QNNT--------LKEL----G---VFTPK--QVVENEIEVLRSFTLMNRVVEKL--H
A0A418M8U8      NE-RDQP--------LKEL----D---AYVPK--KVVENETEILRSYTLMNRVVDKL--H
I2GTA4          NE-RDQP--------LKEL----D---AYVPK--KVVENETEILRSYTLMNRVVDKL--H
A0A2K8ZAJ2      IS-EQSA--------MKET----N---IFTQT--KLVENEIEILRSYSLMDRVVTNL--G
A0A368JPA3      VS-SDGI--------LKDL----T---TYSPG--KVIENEIEILKSSSLMKKVVDSL--G
A0A5N1JI29      VS-GDGI--------LKDL----T---AYSPG--KVIENEIEILKSNSLMKKVVDSL--G
A0A3P1BT12      PS-DNGV--------LKEL----N---IYSPS--KVVENEIEILKSNSLMKKVVDSL--G
A0A3P1CI15      VA-DEGL--------LKQL----H---IYSPN--KVVENEIEILKSNSLMKKVVDSL--G
A0A4R8CUK1      ---DESI--------PADP----D---NRNQQ--TVVDNELEILTSNSLMKKVIDTL--G
A0A3D0MYJ7      -K-QQSI--------LTGL----S---VPEGSAGSDIQSQIAIMKGYYVREIVAKSI---
A0A662AH13      IL-DAPL--------LPEF----S---SFGDD--RFIANEIEILKSYRLRTMVANAL---
A0A5C7QA01      -----AL--------LGDLS---S---MIEQK--SPAQAEIEILRSRLVLGEVIGQL--H
A0A3D3LS70      LL-TSNM--------IPGF----S---DYASD--RSISNEIEILKSQTIRSLTATAL---
A0A1G1TM36      ---ERSA--------LQEL----D---FANGN--NVLESEMEILRSRRLMQQVVQTL--G
A0A1G7ZF38      FH-ETAL--------LEEL----G---LPDAT--SSVENEIEILKSRTLLSQIISDL--H
C6VS52          LH-ETAL--------LEEL----G---LPDAA--GSVENEIEILKSRTLLGQVVDDL--H
A0A7C1LGX3      LQSNAMS------L-FTN-----G------ST--INLDNQIEILTSYRILSEVVKEL--Q
A0A2A4G4B1      ---DELS------V-FDDLG---M---VSGSA--STLEDEIQLFRSRPLIKQMVEKH--N
A0A0P7X1V8      MAGSDLS------NLMVSNF---G----IGMG--SSIENEIHVLQSRTFTGELAQRI---
A0A6P1P355      ES-----------R-MTQSI---D---AFTSN--NIVENEIKVIQSRALARKVIDEL--G
A0A5C8KAD6      DS-----------K-MTESI---D---AFITS--KIVENEINVIHSRTLMKQVVNKL--S
A0A5N1J695      DP-----------R-MMEAI---D---AFASS--KLVDNEIKVIQSRGLMNKVVDTL--M
A0A3B0C2S4      ITVDPMA------L-LSGNP---G----------INLDNEIQVLKSYRILGQVVEAL--N
A0A3N2M1H3      V--PDMA------GVFSSF----G---LVSSN--TSVYNELISLKSPAVMYEVARRL--H
A0A4S2G8T2      V--PDMA------GVFSSF----G---LVSSN--TSVYNELISLKSPAVMYEVARRL--H
A0A212K7W5      MLSDNIN------T-FSDM----G---LFKSN--TNINNEILTFKSPLLMQEVVQRM--K
F5IU11          MLSDNIN------T-FSDM----G---LFKSN--TNINNEILTFKSPLLMREVVQRM--K
A0A7C1QWC7      L--ESAE------R-FSGL----A---ELDQS--RNLENDINSLRSFSLVSETIKKL--G
A0A352Z1R7      ---------------LVDM--------TFDQS--NSIDAELEIIKSRTNIEQVAKRL--H
A0A3N2N6F7      SQ-SITS------A-LSDM----G---LFTTS--TNVANELLAFQSPALIGDVIERL--G
A0A4P7VVU7      SQ-GVAS------A-LSDI----G---LFQSS--ANVNNEMLAFQSPAIIADVIQRL--G
A0A2V1ILM4      SQ-GVAS------A-LSDI----G---LFQSS--ANVNNEMLAFQSPAIIADVIQRL--G
A0A3N2L0E8      SQ-GVAS------A-LSDI----G---LFQSS--ANVNNEMLAFQSPAIIADVIQRL--G
A0A3N2LFC5      SQ-GVAS------A-LSDI----G---LFQSS--ANVNNEMLAFQSPAIIADVIQRL--G
A0A0A2F501      LS-LNDQ------FSFGDM----G---LLQSN--TNVNNELISIQSPTLTLEVVRRL--G
R5B7P0          MP-GDIG------E-FGNM----G---LFAVK--SNVNNELHAFESPDIMSEVVARL--R
R5B0L5          IS-DT----------FAEM----G---LVQTN--SNVNDEISKLQSPDIMLEVAKRL--S
A0A6I1TEC0      IN-NDVE------SMFSDM----G---LGGTK--SNVNNELIAIKSPSVLLEVGKQL--K
A0A3R5XWG1      IN-NDVE------SMFSDM----G---LGGTK--SNVNNELIAIKSPSVLLEVGKQL--K
A0A5P0Y910      IN-NDVE------SMFSDM----G---LGGTK--SNVNNELIAIKSPSVLLEVGKQL--K
A0A414YFM3      IN-NDVE------SMFSDM----G---LGGTK--SNVNNELIAIKSPSVLLEVGKQL--K
A0A6A7UIA7      IN-NDVE------SMFSDM----G---LGGTK--SNVNNELIAIKSPSVLLEVGKQL--K
A0A6A7VPS3      IN-NDVE------SMFSDM----G---LGGTK--SNVNNELIAIKSPSVLLEVGKQL--K
A0A374THP7      IS-SDVS------SMFADM----G---LGNAK--SNVNNELIAIQSPAVLLETGKRL--K
A0A6G1VND1      IS-SDVS------SMFADM----G---LGNAK--SNVNNELIAIQSPAVLLETGKRL--K
A0A0A2EVS5      SL-AQDI------GGFADM----G---LFSKS--TNVHNELVSLRSPATLLEVIKRL--N
A0A1T4NAJ7      SL-AQDI------GGFADM----G---LFSKS--TNVHNELVSLRSPATLLEVIKRL--N
A0A255T941      S--NLIS------D-FADMG---G---LFKSN--TNIKNELSTIKSPNLMTEVVKRL--R
A0A3N2KCL3      AG-AED---------FGDF----G---LFQNK--TNIQNEITTLKSADLMEEVVRRL--N
A0A4P7VSV0      AG-AED---------FGDF----G---LFQNK--TNIQNEITTLKSADLMEEVVRRL--N
A0A2V1IJY1      AG-AED---------FGDF----G---LFQNK--TNIQNEITTLKSADLMEEVVRRL--N
A0A4P7VXK7      AG-AED---------FGDF----G---LFQNK--TNIQNEITTLKSADLMEEVVRRL--D
A0A1Y4CHN5      IS-SDVS------SAFASM----G---LVQSN--TNVNNEVIALQSPAIMTDVVKRL--H
A0A1M6I2S6      ST-T-MS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVRRL--G
A0A1Y3V692      ST-T-MS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVRRL--G
F3PXM2          TS-GSMG------E-FADF----G---LFKSN--TNINNELLTLASPTLMTEVVKRL--G
A0A174AHH7      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A174JCE8      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A3E4JMC4      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A412SND6      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A414IEQ9      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A6I0U0V8      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A6L5S9H7      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A0M1W8D8      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A3R6GKX5      PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A7V4S1          PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
B0NU19          PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
D4V601          PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A4Q0U3M9      PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A4R4H1Q2      PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A6I0GII7      PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A6I0KYU7      PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A397WLT5      PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A6A2J529      PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A6L6P8N9      PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A6N8DDD8      PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A015XH67      PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A078RZN2      PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A4R4I3T9      PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A6L0K5          PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A7ACT5          PA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A6KY94          SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A173UQR8      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A3R6HK75      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A412B7D1      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A412VNY9      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A414LTU9      SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
I9Q4U4          SA-SAMN------E-FADM----G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--G
A0A373ISF0      SG-GAMS------E-FSDM----G---IFRSN--TNINNELFTLKSPALMTEVVRRL--R
U6RF62          SG-GAMS------E-FSDM----G---IFRSN--TNINNELFTLKSPALMTEVVRRL--R
A0A662ZZD5      ST-NVVS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A3A5TI83      ST-NVVS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A415NEB6      ST-NAVS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A6I0I238      ST-NVVS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A7AJ60          ST-NVVS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A6A2JF01      ST-NVVS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A6I0Y2Y2      ST-NVVS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A6I2Q447      ST-NVVS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A395YYT3      ST-NVVS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A015UXN7      ST-NVVS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A5M5W148      ST-NVVS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A6I2NTL0      ST-NVVS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A016E4F9      ST-NAMS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A4Q5CFJ7      ST-NAMS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A6N3HG44      ST-NAMS------E-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--G
A0A6H9P0U9      ST-SAMN------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
A0A108TH71      ST-SAMN------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
I8VXH0          ST-SAMN------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
A0A412S0N6      ST-SAMN------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
A0A412IIJ0      ST-SAMN------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
A0A0P0FM97      ST-SAMN------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
R6KTP3          ST-SAMN------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
A0A139LU87      ST-SAMN------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
A0A1C6B3Y5      ST-SAMN------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
A0A6L3KCD1      ST-SAMN------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
E2NMQ4          ST-SAMN------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
A0A412YDB9      ST-SSMS------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVSRL--G
R7DY01          ST-SSMS------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVSRL--G
A0A414LGK8      ST-SSMS------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVSRL--G
A0A415IPQ4      ST-SAMS------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
A0A3E5BRW7      ST-SAMS------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
K9DXS6          ST-SAMS------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--G
A0A1M6KFV3      ST-NAMS------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVSRL--G
A0A1Q6G7L3      ST-NAMS------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVSRL--G
A0A413H235      ST-NAMS------D-FSDL----G---IFKSN--TNINNELLTLKSPTLMTEVVSRL--G
A0A1M5B2J8      AS-TDME------S-FADF----G---IFTTN--TNVNNEMGTLQSPDLMREVVTRL--H
A0A255RCT5      AS-TDME------S-FVDF----G---IFTTN--TNVNNEMGTLQSPDLMREVVRRL--H
A0A1Y4GLF5      IS-SGME------T-FSEF----G---LFQSS--TNVNNELLAFQSPAVMTEVVKRL--Q
A0A1H3XSC0      VS-SDLE------S-FSEF----G---LFQSS--TNVNNELVALQSPAVMTEVVRRL--H
A6LE40          VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A4Y1VPX5      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A6N2XMM4      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
B3JI46          VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A358R8U0      LA-SDVE------S-FGDL----G---LFQTT--TNVNNELLVLQSPSIMLEVVKRL--H
R6WSB6          LA-SDVE------S-FGDL----G---LFQTT--TNVNNELLVLQSPSIMLEVVKRL--H
A0A401LPX7      SS-ADME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
A0A6G0GNY9      SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLQSPDIMREVVSRL--H
A0A6I1BFM0      SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLQSPDIMREVVSRL--H
A0A3A5Z900      SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
A0A285TGL6      SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
A0A3A5RFX4      SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
A0A1Q6IUW9      SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
A0A413XDP6      SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
A0A6N8CVT6      SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
K6AP24          SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
A0A6I2NHV3      SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
A0A662ZYI7      SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
A0A078RYI7      SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
C7XEQ8          SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
D7INX6          SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
K5ZG55          SS-TDME------S-FSDL----G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--H
A0A3N2N9B8      ---AGME------E-FSDF----G---LISTK--TDVENEIINLRSGELMEEVVSRL--K
A0A3N2NMI0      ---AGME------E-FADL----G---LISSS--TSVANEITNLRSGDLMEEVVRRL--N
A0A359I8H7      VA--DIS------NAFSSL----G---LVSSN--TNVNNELISLSSPAVMYEVVKNL--G
A0A3N2KA63      VA--DIS------NAFSSL----G---LVSSN--TNVNNELISLSSPAVMYEVVKNL--G
A0A4Q0IMT7      VA--DIS------NAFSSL----G---LVSSN--TNVNNELISLSSPAVMYEVVKNL--G
A0A3B9FAU3      ---KDLN------AMFANL----G---QNPDQ--SNVNNEMAAIQAPSNVLETVKRL--N
A0A3C1E5L7      ---KDLN------AMFANL----G---QNPDQ--SNVNNEMAAIQAPSNVLETVKRL--N
A0A4Q0UAV1      TL--AMP------D-LSAL----G---ISNNS--GDLANEMIVIRSVDLLTDVVATL--D
A0A354SN68      SI-GNTS------GIFNNL----G---IGKSY--MNTNDEVAIINSQTIALEVVQSL--H
A0A6L5XFL0      IS-SQFG------Q-FSSM----G---IGKSN--TNLYNEMITLKSPTYMEEVVREL--H
A0A3N2N595      PSMSVGG------DEFANM----G---LFQNK--TNIQNEMTTFMSSDLMTEVVKRL--K
A0A0A2DUD9      LS-NDMS------SAFSEL----G---LFQSN--TNVNNELLSMKSPMLMEEVVRRL--E
A0A3P1ZBJ5      RS---VE------QQLSQL----G---LFE-N--TSVSNEILSFQSPALMEDVVKRL--H
R5FHS9          VSIDDIF------SSASSG----G---ISTNS--NYVNNELIALQSPSIMLEVVKRL--G
A0A413TW79      IN-SDVA------SMFSDM----G---LSGGK--SNVNNELIAIQSPAVLLEAGKQL--K
A0A3E5E9M7      IN-SDVT------SMFSDM----G---LSGGK--SNVNNELIAIQSPAVLLEAGKQL--K
A0A3E4SK73      IN-SDVA------SMFSDM----G---LSGGK--SNVNNELIAIQSPAVLLEAGKQL--K
A0A415GGC6      IN-SDVA------SMFSDM----G---LSGGK--SNVNNELIAIQSPAVLLEAGKQL--K
A0A413DBH9      IN-SDVT------SMFSDM----G---LSGGK--SNVNNELIAIQSPAVLLEAGKQL--K
A0A1Y4PQK7      IA-SDIE------G-FDNF----G---LFRSA--TNVNNELIALQSPSVMTEVVKRL--H
A0A1Y4IH41      IS-SDIE------G-FDNF----G---LFRSA--TNVNNELVALQSPAVMTEVVKRL--H
A0A3A6AAP4      IS-SDIE------G-FDNF----G---LFRSA--TNVNNELVALQSPSVMTEVVKRL--H
A0A6I0ZRD2      IS-SDIE------G-FDNF----G---LFRSA--TNVNNELVALQSPSVMTEVVKRL--H
A0A1Y4DYA7      PS-GN-A------GVLYDL----D---LFQTG--TNVNNEIQSLQSPAVMYDVVKRL--H
A0A1Y3X4I9      LS-NS-A------GVLGDL----D---LFQTN--TNVNNEMQSLQSPAVMYDVVKRL--H
A0A1Y4FNK8      MS-DA-A------GVLGDM----N---LFQTS--TNVNNEIQSLQSPSVMLDVVKRL--H
A0A355FD59      MA-GDVS------SLFSDL----G---LSQAN--VNVNNELIAIQSPAVILETIKRL--H
A0A359CEZ9      MA-GDVS------SLFSDL----G---LSQAN--VNVNNELIAIQSPAVILETIKRL--H
A0A353Q7B4      MA-GDVS------SLFSDL----G---LSQAN--VNVNNELIAIQSPAVILETIKRL--H
F8X3A5          IS-SDVA------SMFADF----G---LSQPN--TNVNNELIAIQSPAIILETVKRL--H
A0A1M3KVR9      IS-SDVA------SMFADF----G---LSQPN--TNVNNELIAIQSPSIILETVKRL--H
A0A4Y9IJS3      IS-SDVA------SMFADF----G---LSQPN--TNVNNELIAIQSPSIILETVKRL--H
A0A495WI87      LS-ADAG------S-FADL----G---LIQAN--TNVNNEIISLQSPAIMTDVVKRL--H
A0A354M4S6      LS-ADAG------S-FADL----G---LIQAN--TNVNNEIISLQSPAIMTDVVKRL--H
R7DH52          LS-ADAG------S-FADL----G---LIQAN--TNVNNEIISLQSPAIMTDVVKRL--H
A0A4Q5E7L5      VS-SDMD------A-FSDL----G---LFQSG--TNVNNELIAFQSPALITEIVKRL--R
A0A4P8LP09      VS-SDLE------S-FSEF----G---LFQSN--TNVNNELIAFQSPALMTEVVKRL--R
A0A4R4GZU7      VS-SDLE------S-FSEF----G---LFQSN--TNVNNELIAFQSPALMTEVVKRL--R
A0A016CWA4      VS-SDLE------S-FSEF----G---LFQSN--TNVNNELIAFQSPALMTEVVKRL--R
A0A1C6H117      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A0M1W0V2      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A139KA16      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A174VQ92      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A1Q6HCG0      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A1Y4JYM9      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A3A5QW67      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A3A5RQE6      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A3A6BP07      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A3E5E153      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A3Q9IP20      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A412WV15      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A413ICP6      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A414KYB9      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A5B3FWR2      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A6L4P3V7      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
E5WX00          VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
K0X3P3          VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A415TAH7      VS-PDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRF--R
A0A078T2W6      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6I1AQV4      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A5C6L2P1      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A412MJT7      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A3E4WKT5      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A3A5YY33      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A078TAH2      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A1E9CFZ7      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A373FYU5      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A3A5TZ72      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A3A5XBP2      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A3A6MEG9      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A3E4JP35      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A3E4KP40      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A3E4NX82      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A3E4XFU8      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A412RG70      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A412TD37      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A413GAA4      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A414M7I4      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A496BTA0      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A496D2V6      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A4Q5G1P5      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A5C6KCA6      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A5M5AHM5      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A6I0KZV6      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A6I0Y5K7      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A6I1BFB8      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A6I2P5W5      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A6N8DC51      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
E5UZA2          VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A069SMG6      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A6A2RTB3      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A6I0VY00      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--R
A0A1M4YZ07      VS-SDLK------S-FSEF----G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--R
A0A0P0FQW1      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A5M5C0W6      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6I0H151      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A642LZ22      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6I0HI59      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A642NJ89      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6I0HI52      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6L3JTQ2      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6L4EED9      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6I0YVB5      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6L5RHE2      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6N3AEV2      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6L3KG29      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6G0G4T5      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6I0HFG9      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A4Q5E5M7      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A6L4F5W0      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
C3RFN5          VS-SDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRL--R
A0A3A5Z014      VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--H
A0A6I0ING7      FS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--R
A0A6L5S265      FS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--R
A0A078S3Q8      FS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--R
A0A069SJV7      FS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--R
A0A3E5DXI5      FS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--R
A0A3E5EM98      FS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--R
A0A3E5F453      FS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--R
A0A6N2YYD4      FS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--R
I9T3G6          FS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--R
A0A3E4SYU0      VS-SDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRL--R
A6LGY1          VS-SDLE------S-FSEF----G---LFQSS--TNVNNELITFQSPALMTEVVKRL--R
K5ZSH4          VS-SDLE------S-FSEF----G---LFQSG--TNVNNELITFQSPALMTEVVKRL--R
A0A1H4ADG3      NS-PQSN------G-ISSLQ---S-LGLFPGA--SNVDNERDILVSYPLIHQVVSDL--Q
A0A5B8VUR8      PA-PQNN------G-IGSLE---S-LGLYPRS--STVDNEREILVSYPLIHQVVTDL--Q
A0A0D3L8Q3      -L-TESA------V-FNDIP---G----FKSH--TNIDNEIRLLKSQSLMHRVFNEL--D
A0A2N3U785      -V-YENS------F-FSELG---I----FQTN--QSINDEIELLKSISLMQRVVKDL--S
A0A5B6TJH8      -I-SGAG------T-FSDLD---M----FNST--KVVDNEILILDSKTLMERVVQDL--D
A0A519U664      -L-SNAD------A-LSDLT---T----FKST--RSIDNEIEVLRSASIMERVAKEL--D
A0A519MA34      -L-SNAD------A-LSDLT---T----FKTT--RSVDNEIEVLKSASIMERVAKEL--D
A0A519UCX0      -L-SSAD------A-LSDLT---T----FKST--RSIDNEMEVLKSVSIMERVAKEL--D
A0A0E3ZG78      -L-SNES------A-FSDLE---I----FQAT--KNINNEIEVLQSESLMKRVASEL--S
A0A1I6BRK6      -L-SNAD------A-LSDLN---T----FKAT--RNVDNEIEVLKSKGLMERVIREL--D
A0A243WAB1      -V-SNAE------A-LSDLT---M----LKSA--RNIDNEIEVLRSESLMEKVVSEL--N
A0A6G8C8X6      -L-ANAD------A-FSDLP---A----FKST--RNIDNEIEVLRSKTLMERVVNEL--G
A0A416GA42      TP-SEAE------I-FKEV----G---FMNLS--GNVENEILIFKSLHLAEQVVRRL--D
A0A1T3IYP5      AR-ITRS------S-VANVV---S------------VKDEIIQLKSKELMRLVVDKV--G
A0A1T5K9D4      ---SNTR------A-TTKL----DNYSNLINS--VSMSNEMLQLKSKTLMAEVVKDL--N
A0A077ENE7      ---SNTP------T-TARI----TR-SFGANT--ISVKDEILQLKSKELMRLVVDKV--H
A0A6I5UW06      ---SNTP------T-TARI----TR-SFGANT--ISVKDEILQLKSKELMRLVVDKV--H
T0NN57          ---SNTP------T-TARI----TR-SSVASS--VSVKDEILQLKSKELLRQAIDRT--G
X5K347          ---SNTP------T-TARI----TR-SSVASS--VSVKDEILQLKSKELLRQAIDRT--G
A0A060RD97      ---GEAA------I-FADLG---L---LSSTS--SLVDNEIFILRSASLMRTVVQKL--D
A0A3C1ITV0      QI-SELA------A-FADL----G---IGSTG--IDVYNELQAFQSPLLMQDVVNQL--R
R7HN19          QI-SELA------A-FADL----G---IGSTG--IDVYNELQAFQSPLLMQDVVNQL--R
A0A350IHV0      -M-KELA------S-FTNAM---S--LRRNSG--ANVYNEMESFTSPDIMSVVVDRL--G
R5RVP0          -L-RDLASFTGGVR-YRSMN---G----------SNVYNEIEAISSPDIMQTVVKRL--G
R6A0L2          GL-RRTSKNSGMNT-LLELN---G----VSVG--DNLKNEIFIISSKRLMSRVVDKL--N
R7LG80          RM-VK----GNMSG-LLELN---G----ISVG--DNLKNEIFILSSKRLMTRVVDKL--D
A0A2L2WX98      GR-KASS---SMNT-LLELN---G----ISVG--DNLKNEVFILSSQRIMERVVDSL--H
A0A6N8KXI9      SR-VTRS----------------S---MFYNT--VSVASEILQLKSKELMRQTVTSL--H
G5GD56          GM-SRSARNNGLNT-LMQLN---G----ISVG--DNLKNEMFILTSERLMTRVVDSL--G
R5KD55          LN-QLLN------D-YVDF----G---FFADN--TNVNNVIAAIKSPDVMSEVVDRL--G
A0A174QNT3      ---NDLS------A-MLELS---G----IPGG--SSVENEVYILRSYQLLNDVVQRL--H
A0A4S2FGS1      ---NDIS------A-MLDLN---G----IPGG--SSVENEVYILRSYQLLNDVVQRL--H
R9I0H0          ---NDIS------A-MWEVS---G----GLGG--SGVENEVYILRSYQILNDVVQRL--H
K5BUT9          ---SDMS------A-MLEVS---G----GITG--TSVDNEIYILRSHQLLREVVNRL--H
A0A174FPA3      ---SDMS------A-MLEVS---G----GITG--TSVDNEIYILRSHQLLREVVNRL--H
R6S9Y6          ---SDMS------A-MLEVS---G----GITG--TSVDNEIYILRSHQLLREVVNRL--H
A0A642LIH6      ---SDMS------A-MLEVS---G----GITG--TSVDNEIYILRSHQLLREVVNRL--H
C9KX15          ---SDMS------A-MLEVS---G----GITG--TSVDNEIYILRSHQLLREVVNRL--H
A0A6H0KRK1      ---SDIS------A-MLELQ---G----GITG--SGVENEMFILRSHQLVREVVNRL--H
R6DAG6          ---SDIS------A-MLELQ---G----GITG--SGVENEMFILRSHQLVREVVNRL--H
A0A3L8AAP1      ---SDIS------A-MLELQ---G----GITG--SGVENEMFILRSHQLVREVVNRL--H
A0A4S2AYX2      ---SDIS------A-MLELQ---G----GITG--SGVENEMFILRSHQLVREVVNRL--H
A0A4Y9H477      ---SDIS------A-MLELQ---G----GITG--SGVENEMFILRSHQLVREVVNRL--H
A0A0E2M2Y7      -P-RSMK------Q-FEEI----G---LFMDN--SEVENEILVLKSKRLTAIVVDKL--D
A0A0K2J6Z0      -P-RSMK------Q-FEEI----G---LFMDN--SEVENEILVLKSKRLTAIVVDKL--D
B2RKZ8          -P-RSMK------Q-FEEI----G---LFMDN--SEVENEILVLKSKRLTAIVVDKL--D
A0A212GC82      -P-RSMK------Q-FEEI----G---LFMDN--SEVENEILVLKSKRLTAIVVDKL--D
A0A254MU12      -P-RSMK------Q-FEEI----G---LFMDN--SEVENEILVLKSKRLTAIVVDKL--D
R6CQ93          -T-AGLD------R-YDNYI---N-------K--VNVANEILQFRSKRLMREVVQRL--H
A0A3D1NQW3      ---TDLA------T-LSDLA---G----LSQR--RNVDNEIYILQSRRLMTEVVKQL--G
B0MT10          ---TDLA------T-LSDLA---G----LSQR--RNVDNEIYILQSRRLMTEVVKQL--G
R7JGW9          ---TDLA------T-LSDLA---G----LSQR--RNVDNEIYILQSRRLMTEVVKQL--G
A0A3D2BF46      ---TDIA------A-FGDLL---G----ATAR--RNVDNEIIVLKSRNLMTEVVRRL--N
A0A358R538      ---TDLA------A-FSDLA---G----FQNR--RSVDNEVFILQSRRLMAEVVRRL--G
A0A1Y4AAB8      ---MDIS------A-FSDIS---G----FQSR--NSVDNEIYILQSRRLMQEVVRTL--R
A0A1Y3WWY9      ---PELS------A-FSDLA---S----FQTQ--RSVDNEIYILQSRRLMSEVVRRL--N
A0A1Y4U5L4      ---PELS------A-FSDLA---S----FQTQ--RSVDNEIYILQSRRLMSEVVRRL--N
A0A1Y3VCJ1      ---VELS------A-FSDLS---G----YQSR--KSIDNELFILQSRKLMTEVVRRL--N
A0A1Y3QTW7      ---MELG------A-FSDLV---G----FQNR--RNVDNEVYILQSHRLMSEVVKRL--H
R6XWY7          ---MELG------A-FSDLV---G----FQNR--RNVDNEVYILQSHRLMSEVVKRL--H
A0A4Y1X9Y9      ---MELG------V-FSDLV---G----FQNR--RNVDNEVYILQSHRLMSEVVKRL--H
A0A4Y1WM66      ---MELG------A-FSDLV---G----FQNR--RNVDNEVYILQSHRLMSEVVKRL--H
A0A6N4GYT3      ---MELG------A-FSDLV---G----FQNR--RNVDNEVYILQSHRLMSEVVKRL--H
A0A174AVF1      ---MELG------A-FSDLV---G----FQNR--RNVDNEVYILQSHRLMSEVVKRL--H
A0A656Q4F4      ---MELG------A-FSDLV---G----FQNR--RNVDNEVYILQSHRLMSEVVKRL--H
A0A1Q6EIY0      ---TDLG------A-FSDLV---G----FQNR--RNVDNEVYILQSHRLMSEVVKRL--H
A0A5B5VN71      ---TDLG------A-FSDLV---G----FQNR--RNVDNEVYILQSHRLMSEVVKRL--H
E4M8L3          ---TDLG------A-FSDLV---G----FQNR--RNVDNEVYILQSHRLMSEVVKRL--H
I3YQ50          ---TDLG------A-FSDLV---G----FQNR--RNVDNEVYILQSHRLMSEVVKRL--H
R5UEY8          ---TDLG------A-FSDLV---G----FQNR--RNVDNEVYILQSHRLMSEVVKRL--H
A0A1H4D866      ---LELT------A-FSDLA---G----FQNR--RSVDNEVFILQSRRLMTEVVKRL--D
A0A5B3G4Y7      ---VDLT------A-FSDLA---G----FQNR--RNVDNEVFILQSRRLMTNVVKQL--N
A0A374A9J5      ---VDLT------A-FSDLA---G----FQNR--RNVDNEVFILQSRRLMTNVVKQL--N
A0A5B3GQN5      ---VDLT------A-FSDLA---G----FQNR--RNVDNEVFILQSRRLMTNVVKQL--N
A0A1Q6E9S3      ---VDLT------A-FSDLA---G----FQNR--RNVDNEVFILQSRRLMTNVVKQL--N
D4IJ36          ---VDLT------A-FSDLA---G----FQNR--RNVDNEVFILQSRRLMTNVVKQL--N
A0A414Q925      -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVETL--H
A0A415PUS9      -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVEIL--H
A0A108TCU0      -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVETL--H
A0A413BA42      -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVETL--H
S3Y344          -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVEIL--H
A0A4Q5G8Y8      -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVEIL--H
A0A412TGL3      -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVETL--H
A0A413VJ33      -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVEIL--H
A0A414L0W6      -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVETL--H
A0A412DP39      -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVETL--H
A0A413ZSE8      -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVEIL--H
B0NP84          -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVEIL--H
R6AK43          -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVEIL--H
A0A412N2D9      -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVETL--H
A0A1Y4JYS9      -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVETL--H
R6LHA4          -V-NGAA------A-FQDL--------FSLGG--STVDNEVGIFKSKRLMRTVVETL--H
A0A3E5HPT8      -A-NSRS------A-MQLNN---A---DFIGQ--VNVASEILQFKSKELMRKVIDRL--H
C6IJ48          -A-NSRS------A-MQLNN---A---DFIGQ--VNVASEILQFKSKELMRKVIDRL--H
Q8A3U2          -A-NSRS------A-MQLNN---A---DFIGQ--VNVASEILQFKSKELMRKVIDRL--H
A0A3R6S1H6      LA-SEAA------A-FEDL----N---VLNTK--SSVDNEVLVFQSRNLMIEVVRRL--N
A0A3R6SD81      LA-SEAA------A-FEDL----N---VLNTK--SSVDNEVLVFQSRNLMIEVVRRL--N
A0A354WXN6      -F-SEAN------A-FGDL----G---ITMGS--RNVDNEVLVFKANRLMEMVVKRL--H
R5IP14          -F-SESA------M-FKDL----GSMDMINVR--SSAETEMLIFQSYRLMQDVVSQL--D
A0A316SZX7      -I-TESA------A-FQEL----G---AFNIK--SNVDNEILLFESKRLMEEVVRLL--K
A0A1Y4AIY1      -S-MSAY------G-FSDLN---N---MLGIQ--RNVDNEVIVFKTYRLMEKVARRL--H
A0A0J6CIR2      GL-SESA------A-FEEL----N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--N
A0A3D8HG59      AM-SEAS------A-FSDL----G---MFSMK--SSVDNEVLVFQSRQLMQNVVKRL--K
A0A3R6S408      AM-SEAS------A-FSDL----G---MFSMK--SSVDNEVLVFQSRQLMQNVVKRL--K
F3ZRU7          NM-QGVA------A-LTDL----A---DFGLK--SSVDNEILIFQSNSLLREVSTRL--S
A0A1C5Q1F3      LP-NAAS------A-FSEM----D---LLNIQ--STVDNEVLIFKSKRLMIEVARKL--K
R7A239          LP-NAAS------A-FSEM----D---LLNIQ--STVDNEVLIFKSKRLMIEVARKL--K
A0A3R6HIK7      -A-ATTY------G-FTDL----D---MFGLQ--RNVDNEVIVFKAYRLMEMVARRL--H
K5ZVW7          -A-ATTY------G-FTDL----D---MFGLQ--RNVDNEVIVFKAYRLMEMVARRL--H
A0A1Y4D5Z0      -S-RSLY------G-FSDL----D---MLSLQ--RNVDNEVIVFKTYRLMETVARRL--H
A0A413VXJ7      -I-SESS------A-FADL----G---LFGGK--RNVDNEVLIFQSRHLMEEVARRL--H
I9RSN9          -I-SESS------A-FADL----G---LFGGK--RNVDNEVLIFQSRHLMEEVARRL--H
U6RJK5          -I-SESS------A-FADL----G---LFGGK--RNVDNEVLIFQSRHLMEEVARRL--H
A0A1Q6GA32      -I-SESS------A-FADL----G---LFGGK--RNVDNEVLIFQSRHLMEEVARRL--H
I9RPU6          -M-SESA------A-FSDL----S---LFGGK--RNVDNEVLVFQSRHLMEEVARRL--H
I8YFS5          -I-SEST------A-FADI----S---FLGGK--RNVDNEVLVFQSRHLMEKVARRL--H
A0A6L3FCC6      -I-SEST------A-FADI----S---FLGGK--RNVDNEVLVFQSRHLMEKVARRL--H
I8Y597          -I-SEST------A-FADI----S---FLGGK--RNVDNEVLVFQSRHLMEKVARRL--H
A0A1Q6GBF5      -V-SESS------A-FADL----S---LFGGK--RNVDNEVLVFQSRHLIEEVARRL--H
I8YFZ3          -M-SESA------A-FSDL----S---LFGGK--RNVDNEVLVFQSRHLMEEVAHRL--H
A0A1Q6GDH2      -M-SESA------A-FSDL----S---LFGGK--RNVDNEVLVFQSRHLMEEVARRL--H
U6RSB0          -M-SESA------A-FSDL----S---LFGGK--RNVDNEVLVFQSRHLMEEVARRL--H
I9SIK1          -M-SESA------A-FSDL----S---LLGGK--RNVDNEVLVFQSRHLMEEVARRL--H
I9GXM2          -M-SESA------A-FSDL----S---LFGGK--RNVDNEVLVFQSRHLMEEVARRL--H
I9TP59          -M-SESA------A-FSDL----S---LLGGK--RNVDNEVLVFQSRHLMEEVARRL--H
R5S343          -A-GEGR------V-FEEL----N---LFNVK--SNVDNEVQVFKSTRLMSSVVRKL--S
A0A1M6K7I9      -M-GESA------L-FADL----N---LFGGA--RSVDNELLVFQSRSIMENVVRRL--S
A0A5M6A8C8      -M-GESA------L-FADL----N---LFGGA--RSVDNELLVFQSRSIMENVVRRL--S
A0A6L3FBE6      -M-SESS------A-FADI----S---FFGGK--RNVDNEVLVFQSRNLMEKVARRL--H
A0A6L3FNG1      -I-SESS------A-FADI----S---LFGGK--RNVDNEVLVFQSRYLMEKVARRL--C
A0A3R5ZMK1      -M-SESA------A-FEDL----G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A6L6NFJ9      -L-SESA------A-FEDL----G---IFGTK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A1Y3ZIA4      -M-SESA------A-FEDL----G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--H
K5Y1A4          -M-SESA------A-FEDL----G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A4Q5CIT0      -M-SESA------A-FEDL----G---LFGSK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A6L6NWL9      -M-SESA------A-FEDL----G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A3R6K8X4      -M-SESA------A-FEDL----G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A6N8D6C8      -M-SESA------A-FEDL----G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A3R6BKI7      -M-SESA------A-FEDL----G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A6N8CW60      -M-SESA------A-FEDL----G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A412M2W1      -M-SESA------A-FEDL----G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--H
K5ZX55          -M-SESA------A-FEDL----G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A415BDM7      -M-SESA------A-FEDL----G---LFGSK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A6L6MX19      -M-SESA------A-FEDL----G---LFGSK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A1Q6I3T6      -M-SESA------A-FEDL----G---LFGSK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A414XX40      -M-SESA------A-FEDL----G---LFGSK--RNVDNEVLVFKSRRLMTEVARNL--H
A7AEU7          -M-SESA------A-FEDL----G---LFGSK--RNVDNEVLVFKSRRLMTEVARNL--H
A0A5F0U645      AA-SEAA------V-FEDL----N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--D
K5ZBN2          AA-SEAA------V-FEDL----N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--D
A0A0J6CKW3      AA-SEAA------V-FEDL----N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--D
A0A0F5IQM7      AA-SEAA------V-FEDL----N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--D
A0A496CDT3      AA-SEAA------V-FEDL----N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--D
A0A6G1ZKM3      AA-SEAA------V-FEDL----N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--D
S0GLB0          AA-SEAA------V-FEDL----N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--D
A0A3R6NLC1      AA-SEAA------V-FEDL----N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--D
A0A416WYC9      AA-SEAA------V-FEDL----N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--D
A0A0F5IT40      -L-SESA------A-FEEL----N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--N
A0A496CX20      -L-SESA------A-FEEL----N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--N
A0A5F0UBI0      -L-SESA------A-FEEL----N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--N
A0A6G1ZHG0      -L-SESA------A-FEEL----N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--N
S0GSI7          -L-SESA------A-FEEL----N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--N
K5YB65          -L-SESA------A-FEEL----N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--N
A0A0F5IWP9      -L-SESA------A-FEEL----N---MFNVK--SNVDNEVLVFKSKRLMSIVAERL--N
A0A0F5IZT8      -L-SESA------A-FEEL----N---MFNVK--SNVDNEVLVFKSKRLMSIVAERL--N
A0A417LKQ2      -L-SESA------A-FEEL----N---MFNVK--SNVDNEVLVFKSKRLMNIVAERL--N
A0A416TME1      -L-SESA------A-FEEL----N---MFNVK--SNVDNEVLVFKSKRLMNIVSERL--N
A0A416XPE8      -L-SESA------A-FEEL----N---MFNVK--SNVDNEVLVFKSKRLMNIVSERL--N
L8JI02          -L-GGKE------F-LRGMG---L----FTSD--TELEDEIGILKSYGMVSNAIRSL--D
A0A4Q5WS95      ----ESS------L-SESMN---V----LSSK--KIVENEVVVLQSRNLADKIVAGL--R
A0A501VZX6      ----DAK------M-TESID---A----FTSN--KIVENEIKVLYSRTLLKEVVEDL--K
A0A399SH26      ----DAR------M-TESIN---A----FASK--KIVENEIEVIQSRALMKKVALGL--H
A0A501W1A9      ----ASK------I-EESID---A----FNAN--KTVENELNVLRSYALMSQVVREL--H
A0A0E3ZGV6      ----ASK------I-TESID---A----FSSN--KIVENELNVLRSNALMNQVVNEL--K
A0A1I2N4S1      ----ASK------I-MESID---A----FSTN--KTVENELNVLRSSALMSQVVHKL--K
A0A2T5YE44      ----ASK------I-MESID---A----FNTN--KTVENELNVLRSSALMSQVVHKL--K
A0A1M5BA90      ----ESK------I-LEALN---I-----TSN--KTVDNEVEVIQSGELLNEVIDSL--H
A0A512B879      ----ESK------I-LDALN---I----YSSN--KIVENEIEVIQSKELLKKVVNSL--S
A0A559PPI3      ----NSK------M-VESMS---P----FDSK--KIVENEIKVIQSPDIMKKVVDTL--N
A0A1T5CS78      ----NSR------I-MESIN---P----FDSK--KIVENEIEVLKSRDLMKSVVRDL--D
A0A0Q9Z8F1      ----DSK------I-MESIN---P----FDSK--KIVENEIEVLKSRDLMKAVVRDL--N
A0A2N0U0M7      ----DSK------I-MESIN---P----FDSK--KIVENEIEVLKSRDLMKSVVRDL--N
A0A1V9FHD0      ----ESG------M-GEALQ---I----FPTK--NIVENEMEVIHSRKLITDVINQL--H
A0A4V4H170      ----ESG------V-LEALQ---I----YPTK--NIVENEMEVIHSRKLMEKVVEQL--Q
A0A1V9F098      ----ESG------V-LEALQ---I----YPTK--NIVENEMEVIHSRKLMEKVVEQL--Q
A0A4R2VU64      ----ESG------V-LEALQ---I----YPTK--NIVENEIEVIHSRKLMEKVIEGL--Y
A0A4S8HY23      ----ESG------V-QEALQ---I----YPIK--NIVENEMEVIHSRKLMEKVVEQL--H
A0A1V9F383      ----ESG------S-MEALQ---I----YPTK--NIAENEIEVIHSRKLMEQVIVQL--L
G8TRZ6          ----ESG------A-MEALQ---V----YPMQ--NIAENEIEVLQSKTLMTDVVNQL--H
A0A4R5DL69      -L-GEAA------I-LENLG---L----APGK--SNVDNEVEILKSRTLIESVVSDL--Q
A0A1M4YED3      ----ESK------M-EESLD---F----YQSN--KVVENEIVVLSSKGLMEKVISNL--N
A0A2H3NSN0      -----PN------Q-AQTVR---F----DIQP--ELSSEIGILTNSGSLAMRVITEL--R
A0A2P6C324      ----AAP------A-RMMVG---L----NEQR--DLSSEIGLLKNSGELARRVVSTI--E
A0A7C2DZI7      ----TPT------T-LTAFT---L----GEQR--ALSNELGILRNSAELATRVATAL--L
A0A1M6XHU0      ----APV------S-VAAFT---P----IERR--ALSNELGILKNSAELATRVAKAI--V
G2SF81          ----APV------S-VAAFT---P----IERR--ALSNELGILRNSAELATRVAEAI--V
A0A5S9EYW1      ----APV------S-VAAFT---P----IERR--ALSNELGILRNSAELATRVAEAI--V
D0MHQ9          ----APV------S-VAAFT---P----IERR--ALSNELGILRNSAELATRVAEAI--V
A0A126PFG0      ----EKS------A-LQELD---L----VTTP--KVVESEMEILKSRKLMLSVVRDL--Q
A0A3M1N7Z3      ----FQT------Q-NTAGS---F----FPPE--VLTEAYLELWSRYDLIAQVVQQL--R
                                                                            

A0A1T5MMH4      IDVT---------------------YY-------------SK------G--EV-------
A0A2W4R1L8      IDVS---------------------YY-------------NK------G--EI-------
A0A2E5CV79      WDSN---------------------RR-------------NSL-----A-----------
A0A2D4ZVH1      ------------------------------------------------NEVEF-------
A0A0K8QSK7      FEVS---------------------VY-------------SV------G--QI-------
A0A1V6CN82      FEVS---------------------YH-------------NE------G--KL-------
A0A1M4XZ45      FEVS---------------------YY-------------AL------G--RV-------
A0A399D319      FEVS---------------------YY-------------AV------G--RV-------
A0A1V5IPN7      PDWE---------------------SY-------------PIS-----G-----------
A0A1M6GR99      LEVS---------------------YY-------------EYK-----NYQYY-------
A6EBM4          YHIS---------------------FY-------------SY------E--RL-------
A0A7C5M4P4      LSPQ---------------------YF-------------TY------G--QF-------
A0A1M6TTV4      MDVS---------------------YF-------------RP------GRSH--------
A0A4Q8RX32      FSVM---------------------YY-------------EE------K--LL-------
K0X1U5          LNIS---------------------YT-------------SKK-----N--FF-------
R5EXK3          LNIS---------------------YT-------------SKK-----N--FF-------
A0A401UAP7      LDVS---------------------YY-------------SV------G--EF-------
A0A1W2GF52      MGIS---------------------YY-------------HP------GRSHL-------
A0A2G5L7B8      MNVS---------------------YF-------------HP------GRSHL-------
A0A523GAC0      LDIS---------------------YY-------------AV------G--NI-------
L8JW09          LDLS---------------------YY-------------TA------G--QV-------
A0A364XUP5      LSVS---------------------YF-------------NK------G--EL-------
A0A1M5RLA9      LNVS---------------------YF-------------SV------G--RV-------
A0A385SFR9      LNVS---------------------YF-------------SV------G--RV-------
A0A5M4A9J4      AEVS---------------------YY-------------EV------D-----------
A0A5M4B1C7      DEVS---------------------YY-------------VV------N-----------
A0A0D3LFR6      LDVS---------------------YF-------------TQ------G--KI-------
M7N6D4          LDVS---------------------YF-------------EK------G--KI-------
A0A4D7K1D4      LDVT---------------------IR-------------TTF-----G--SL-------
A0A5C7MX19      LEMS---------------------YF-------------KE------GKTKF-------
A0A1Q3ZMZ7      LAVG---------------------FF-------------NK------G--SI-------
A0A2D8JJW3      VNSL---------------------FL-------------TP------DYKLI-------
A0A2W2AFF7      LNVN---------------------YF-------------SS------G--RV-------
R7PCR1          LDVS---------------------YD-------------TK------D--GL-------
A0A1G9E2A9      LAVS---------------------YY-------------VV------G--DV-------
A0A098LL25      MNVS---------------------YF-------------AY------G--NI-------
A0A6J4H627      LAVS---------------------YF-------------AY------GRSRI-------
A0A6C0GJI1      MSVS---------------------YY-------------AY------G--QI-------
A0A2T2YJE8      LDIN---------------------YY-------------SI------G--NV-------
A0A127B287      LQVS---------------------YH-------------VE------A--RI-------
A0A6P1P2P6      LQTS---------------------YH-------------VE------A--RV-------
A0A3M9N829      LQVS---------------------YH-------------VD------A--RV-------
A0A0P0CSF9      LQVS---------------------YF-------------VE------A--RV-------
A0A5M8QQB8      LQVS---------------------YF-------------VE------A--RV-------
A0A3M9MNC3      LQVS---------------------YH-------------IE------A--RV-------
A0A5B6TAX2      LQVS---------------------YH-------------VE------A--RV-------
A0A5N1IQ33      LDVN---------------------YF-------------AE------G--TV-------
A0A512AYT3      LNVS---------------------YY-------------AL------G--NV-------
A0A5M6CYN7      LNVS---------------------YY-------------AL------G--NV-------
A0A369QP10      LDIS---------------------YY-------------AI------G--NI-------
A0A126PDF2      LYVN---------------------YY-------------VQ------G--TV-------
A0A2Z3GKA1      LYVN---------------------YY-------------VQ------G--TV-------
A0A502GZP7      LNVN---------------------YY-------------VQ------G--TV-------
A0A519SBU8      LDVN---------------------YY-------------VQ------G--TV-------
A0A4Q3JNZ3      LDVN---------------------YY-------------VQ------G--TV-------
A0A519Q9V3      LDVN---------------------YY-------------VQ------G--TV-------
A0A0M3RW20      LDVN---------------------YY-------------AQ------G--TV-------
A0A495VFX4      LDVN---------------------YY-------------AQ------G--TV-------
A0A1S9B3W0      LDVN---------------------YY-------------AE------G--TV-------
A0A1W1VRL3      LDVN---------------------YY-------------VE------G--TV-------
A0A1M6R305      LDVN---------------------YY-------------AE------G--TV-------
A0A4Z0PHK3      LDVN---------------------YY-------------VE------G--TV-------
A0A2M9B9H9      LNVN---------------------YY-------------VE------G--TV-------
A0A4Z0QCY9      LNVN---------------------YY-------------VE------G--TV-------
A0A418R9X5      LDVN---------------------YY-------------VQ------G--TV-------
A0A428JSJ3      LDVN---------------------YY-------------VQ------G--TV-------
A0A428KI59      LDVN---------------------YY-------------VQ------G--TV-------
W8F1I6          LDVN---------------------YY-------------VQ------G--TV-------
A0A246FQC0      LDVN---------------------YY-------------VQ------G--TV-------
A0A372E5P8      LDVN---------------------YY-------------VQ------G--TV-------
A0A1H3EMW1      LDVN---------------------YY-------------VQ------G--TV-------
A0A1H9ZSN3      LDVN---------------------YY-------------VQ------G--TV-------
A0A5N1J2M4      LEVS---------------------YF-------------VR------G--NV-------
A0A519S476      LDIN---------------------YY-------------VQ------G--TV-------
A0A4Q3JRW8      LDVN---------------------YY-------------VQ------G--TV-------
A0A519M923      LDVN---------------------YY-------------VQ------G--TV-------
A0A4Z0ENW1      LDIN---------------------YY-------------TQ------G--TV-------
A0A519UDB4      LDIN---------------------YY-------------TQ------G--TV-------
A0A3S0QKV1      LDVN---------------------YY-------------AE------G--TV-------
A0A328BL48      LDVN---------------------YY-------------TE------G--TV-------
A0A5R8WLY4      LDVN---------------------YY-------------TE------G--TV-------
A0A1I5WSL8      LDVN---------------------YY-------------VQ------G--TV-------
A0A0U3JVM7      LDIN---------------------YY-------------VQ------G--TV-------
A0A1G1SSV2      LDVN---------------------YY-------------VQ------G--TV-------
A0A1G1SXV7      LDVN---------------------YY-------------VQ------G--TV-------
A0A6G8CBJ6      LDVN---------------------YY-------------VE------G--TV-------
A0A0W8EDI5      LNVS---------------------YF-------------VE------G--TV-------
A0A3B7RBP8      LNVG---------------------YF-------------VE------G--TV-------
A0A3R9P8H7      LDVN---------------------YY-------------VQ------G--TV-------
A0A238WIA7      LEVA---------------------YY-------------AE------G--TV-------
A0A212UCJ7      LEVN---------------------YY-------------AE------G--TV-------
A0A4Z0MQE1      LEVN---------------------YY-------------AE------G--TV-------
A0A4Z0PCF4      LEVN---------------------YY-------------AE------G--TV-------
A0A6M6BED0      LEVN---------------------YF-------------AE------G--TV-------
A0A5D6VDG1      LDVN---------------------YY-------------SQ------G--TV-------
A0A6H1CVS0      LDVN---------------------YY-------------SQ------G--TV-------
A0A243WHR7      LDVN---------------------YY-------------VE------G--TV-------
A0A5B8A0P6      LDVN---------------------YY-------------AE------G--AV-------
A0A076HRT9      LDVN---------------------YY-------------AE------G--TV-------
A0A4Z0PVM7      LNVN---------------------YY-------------VE------G--TV-------
A0A1M6DHW8      LDVN---------------------YY-------------VE------G--TV-------
A0A4Q5LC61      LDVN---------------------YY-------------VE------G--TV-------
A0A2N5YXE2      LDVS---------------------YY-------------RQ------G--TF-------
K0XJ09          LDVT---------------------YQ-------------VK------N--WL-------
R5EUZ0          LDVT---------------------YQ-------------VK------N--WL-------
W0EQS0          LDVA---------------------YR-------------VK------D--WL-------
A0A1Y3WE15      LDVT---------------------YQ-------------VK------D--FL-------
A0A1Y4GUK3      LDVT---------------------YQ-------------VK------D--FL-------
A0A2U1FKU2      LDLT---------------------LS-------------KD------G--FW-------
A0A0A2F954      LDVS---------------------IS-------------KQ------G--FW-------
A0A0A2FW91      LDVS---------------------IS-------------KQ------G--FW-------
A0A2D2N2N1      LDVS---------------------IY-------------KQ------G--FW-------
Q7MWZ2          LDVS---------------------IY-------------KQ------G--FW-------
T2NDT6          LDVS---------------------IY-------------KQ------G--FW-------
W1R7P9          LDVS---------------------IY-------------KQ------G--FW-------
A0A1R4AFZ0      LDVS---------------------IY-------------KQ------G--FW-------
A0A1R4DVZ7      LDVS---------------------IY-------------KQ------G--FW-------
A0A7C0WKI7      ------------------------------------------------------------
A0A2A8CVM9      TESA---------------------LE-------------EK------G--KF-------
A0A5M4B212      FEVS---------------------YL-------------QL------G--RF-------
A0A3D1KEX9      LDVD---------------------YV-------------MM------K--GL-------
A0A358Y7S2      IHTN---------------------LY-------------SK------G--TI-------
A0A1X7J248      LDVT---------------------YH-------------VI------G--RF-------
E4TQD2          LDVS---------------------YH-------------VI------G--RF-------
A0A2J6HHN3      LDVS---------------------IF-------------AK------G--NI-------
A0A1Y3WMT8      LNKI---------------------YT-------------SK------K--NF-------
A0A1Y4GQU1      LNKV---------------------YT-------------SK------K--NF-------
A0A6A0R272      LDVR---------------------YY-------------KK------G--RF-------
A0A1V5W8T5      LYTS---------------------YY-------------LE------G--KF-------
A0A2T8HKA9      GDIS---------------------YS-------------KT------E--GL-------
A0A2I0QZ80      LQIS---------------------LY-------------AK------G--EF-------
A0A3E1F1A3      LTVS---------------------HY-------------AK------G--EF-------
A0A2U2XBJ3      LTVS---------------------LY-------------AK------G--EF-------
A0A4Q4KU94      LNVS---------------------LY-------------AR------G--EF-------
A0A3B8INU3      LQVS---------------------YF-------------TQ------G--KI-------
A0A2W1NDY9      LKIS---------------------YF-------------SE------G--EV-------
A0A5C8AQR5      MNVS---------------------LF-------------SK------G--KI-------
A0A1G0CI31      MNVS---------------------LF-------------SK------G--RI-------
A0A556N0M0      MNVS---------------------IF-------------AE------G--KI-------
F2IKD6          MNVS---------------------VF-------------SK------G--KI-------
A0A1I7BM74      LEVS---------------------HF-------------AK------G--EF-------
A0A2G2FJ17      LQVS---------------------LF-------------AE------G--DV-------
A0A2E3R1D0      ------------------------------------------------------------
A0A2T2USC0      ------------------------------------------------------------
A0A2T2V0F3      ------------------------------------------------------------
A0A2T2S682      ------------------------------------------------------------
D5H561          ------------------------------------------------------------
A0A2H3NWA9      ------------------------------------------------------------
A0A2A8CVB6      ------------------------------------------------------------
A0A2P6C1S6      ------------------------------------------------------------
A0A2T2UTM4      ------------------------------------------------------------
A0A414ZBF2      LDVS---------------------YK-------------ER------N--GL-------
A0A1Q3Q573      LDIS---------------------YL-------------KE------G--KS-------
A0A662BAY3      FDIN---------------------YY-------------SV------G--RV-------
A0A4U3L369      LNVS---------------------YY-------------KK------E--DI-------
A0A357YNR3      LYAT---------------------YT-------------EM------R--PLSLLARFG
A0A5E8AX52      YNVS---------------------YH-------------YY------G--NI-------
F4KK08          LDVQ---------------------YH-------------YD------A--GL-------
A0A6B5PK86      MNVS---------------------IF-------------YK------G--KI-------
A0A2G2F510      LNVS---------------------LY-------------SR------G--NV-------
A0A316JZ08      MSVS---------------------MF-------------SR------G--KL-------
A0A496LCF9      FSID---------------------FY-------------KK------K--QF-------
A0A5P2G2A9      LNVN---------------------YY-------------KR------V--PL-------
A0A3C0ZQC7      ------------------------------------------------------------
A0A419VXB7      WNVS---------------------WY-------------RH------M--PL-------
A0A0B0BTJ4      ANIV---------------------YA-------------TK------S--KL-------
A0A3B9CNN6      ANIV---------------------YA-------------TK------S--KL-------
R5X290          ANIV---------------------YA-------------TK------S--KL-------
A0A1Q6E6I7      ANIV---------------------YA-------------TK------S--KL-------
C3J7R8          LDVS---------------------YS-------------QS------R--GI-------
A0A1G8BVM8      LETN---------------------YQ-------------VK------D--GL-------
A0A1I1FXP9      IHIT---------------------YM-------------QK------G--NF-------
A0A3N4H5N3      AFIF---------------------LY-------------DK------I--GF-------
A0A2P8EAX2      AFVT---------------------FY-------------DK------I--GI-------
A0A4V2F6N9      AFVT---------------------FY-------------DH------N--GM-------
A0A3B9FXJ0      IEIS---------------------LI-------------AS------G--RI-------
R5GSU5          LDVD---------------------YS-------------VK------N--GL-------
A0A2A3UE91      ISVN---------------------YY-------------SE------G--VF-------
A0A0A2G557      LRVT---------------------YR-------------KK------E--GL-------
A0A2N2WFW8      LDVS---------------------IF-------------VK------G--NI-------
A0A1F3IU95      LGVS---------------------VF-------------AK------G--NI-------
A0A3D0VUF6      LGVS---------------------VF-------------AK------G--NI-------
A0A1T4PT95      LRVN---------------------YQ-------------RK------E--GI-------
A0A6I6JYY3      FEIS---------------------YY-------------AV------G--RV-------
A0A2A4PYG9      LGIS---------------------YY-------------SK------G--KI-------
A0A1F3K695      LSIA---------------------YY-------------SE------G--TF-------
A0A353KZR1      LSIA---------------------YY-------------SE------G--TF-------
A0A2N2WYB5      LQVS---------------------YF-------------SE------G--TF-------
A0A1F3K4G0      IQIS---------------------YF-------------SE------G--TF-------
A0A356H8Y3      IQIS---------------------YF-------------SE------G--TF-------
A0A351HSA6      IQIS---------------------YF-------------SE------G--TF-------
A0A1F3Q014      LQAS---------------------YY-------------AE------G--TF-------
A0A2D5KD44      LQVS---------------------YF-------------SE------G--QF-------
A0A6N9NIX1      MEVS---------------------YY-------------SQ------G--KF-------
A0A2A4YXP3      IDVS---------------------YY-------------NQ------G--EI-------
A0A1F3R158      LNVS---------------------YF-------------NQ------G--KF-------
A0A2M8ADX2      LEVS---------------------YF-------------NK------G--KF-------
A0A1J5B2H0      LDIS---------------------YY-------------TE------G--RL-------
A0A1V5N756      LDIA---------------------YY-------------KK------G--RF-------
A0A651GU15      LKVS---------------------YY-------------LK------G--DI-------
A0A3Q9FR88      LTVT---------------------YQ-------------SV------G--DV-------
A0A553GEX3      LTVT---------------------YQ-------------SV------G--DV-------
A0A150ADJ9      LRLS---------------------YY-------------SV------G--EI-------
A0A1B1FWQ4      LSVE---------------------YY-------------SV------G--DV-------
A0A1S1Z228      LSVD---------------------YY-------------SV------G--DV-------
A1ZKR2          LWIS---------------------YY-------------QQ------G--NI-------
A0A1Q3GX01      LWVS---------------------YY-------------EQ------G--NI-------
A0A349DQI4      LWVS---------------------YY-------------EQ------G--NI-------
A0A4P5TMD1      LSIS---------------------YF-------------NI------G--QI-------
A0A2N3IIZ0      LSVE---------------------YY-------------AE------G--RI-------
A0A1F3SJM1      LNVS---------------------LY-------------SR------G--KI-------
A0A2G2EB96      LNVS---------------------LF-------------SR------G--QI-------
A0A2G6PRA9      LSVS---------------------LF-------------SR------G--EI-------
A0A497D5Z2      FELS---------------------YY-------------RE------G--NI-------
A0A662B170      FELS---------------------YY-------------RE------G--NI-------
A0A2A5FYT6      LEVS---------------------YF-------------SE------G--QV-------
A0A2E6SYP1      LDVN---------------------YY-------------SK------G--KF-------
A0A2E5RLE8      IDVN---------------------YY-------------TK------G--KF-------
A0A2E7TQF6      IDVN---------------------YY-------------TK------G--KF-------
A0A2E6GVY9      IDVN---------------------YY-------------TK------G--KF-------
A0A350JJ90      VDVS---------------------YY-------------AE------G--EV-------
A0A3M1CDV2      LQIS---------------------YY-------------NE------G--TF-------
A0A6C1QGZ7      LDVS---------------------YF-------------SK------G--RV-------
A0A4P5U6G4      LLVS---------------------YY-------------NT------G--QI-------
A0A2E2TFD1      LDIS---------------------YF-------------NE------G--EL-------
A0A2E4ELE6      LTIS---------------------YY-------------TE------G--EF-------
A0A522EYA6      LKVT---------------------YF-------------AE------G--TF-------
A0A2E3XZI5      LNIL---------------------YY-------------NE------G--EI-------
A0A6I7QXV0      LDVR---------------------YF-------------KE------G--RT-------
A0A2M7NLQ9      LNIS---------------------YF-------------VK------G--RW-------
I4AFR0          LSVS---------------------YF-------------VK------G--RW-------
A0A2N2Y3E5      LDVS---------------------YY-------------SK------G--TF-------
A0A2D9D7T6      LYTS---------------------VY-------------SE------G--KL-------
A0A1F3PPL5      IDIQ---------------------YF-------------NE------G--TF-------
A0A357QK06      IDIQ---------------------YF-------------NE------G--TF-------
A0A662AEA4      LEIE---------------------YY-------------TQ------G--TF-------
A0A0S2HYK8      LDIR---------------------YF-------------VE------G--AF-------
A0A2N5ZWN6      LETR---------------------YY-------------IE------G--AF-------
A0A2E0FJ09      LQIR---------------------YF-------------LE------G--KI-------
A0A1F3FZ62      FEVS---------------------YY-------------IK------G--RI-------
A0A1F3K211      FEVS---------------------YY-------------IK------G--RI-------
A0A1V6I2U9      LDIS---------------------YY-------------RK------G--TF-------
A0A2H0B957      LGVS---------------------YY-------------SQ------G--TF-------
A0A1F3CFW6      LKIS---------------------YF-------------SQ------G--TF-------
A0A2M7E2T8      LKIS---------------------YF-------------SQ------G--TF-------
A0A2M7NC69      LKIS---------------------YF-------------SQ------G--TF-------
A0A1F3KLL5      FEIS---------------------YF-------------SQ------G--TF-------
A0A359D1M1      FEIS---------------------YF-------------SQ------G--TF-------
A0A0F2NS19      LEVS---------------------YF-------------NQ------G--KI-------
A0A2A5H8X6      LEVS---------------------YF-------------NQ------G--KI-------
A0A2H0GAU8      LKVS---------------------YY-------------NQ------G--NF-------
A0A2M8FTK1      LKVS---------------------YY-------------NQ------G--NF-------
A0A2A5B3B0      IDVS---------------------YY-------------RK------G--EI-------
A0A5C6RXM7      LAIS---------------------FY-------------NK------G--TL-------
A0A1F3C1M2      FQIT---------------------YF-------------SE------G--TF-------
A0A1F3DS87      FQVT---------------------YF-------------SE------G--TF-------
A0A6A0R6K9      LEVS---------------------YY-------------TQ------G--QF-------
A0A2E7CT70      ENVR---------------------YY-------------SE------G--EI-------
A0A2D5V560      LKVF---------------------YY-------------FE------G--EX-------
A0A2D7K5A8      LKVF---------------------YY-------------FK------G--EI-------
A0A2E1XQ82      LKVF---------------------YY-------------FE------G--EI-------
A0A5C8A5B4      FGIS---------------------YY-------------ATK-----Y-----------
A0A4Y9ITE2      LNKT---------------------YI-------------VKE-----N-----------
A0A5M8NYX7      LRVA---------------------YY-------------TNG-----K-----------
A0A3D5KRY6      WRYS---------------------WY-------------QKR-----F-----------
A0A0E3V905      LDVR---------------------YF-------------QNT-----T-----------
A0A553ETH6      LNIS---------------------YF-------------TTG-----N-----------
A0A640Q161      LYNN--------------------------------------------------------
A0A640QU49      LYNN--------------------------------------------------------
A0A1Q3PII2      LTTQ---------------------YF-------------ASG-----H-----------
A0A351BXT2      DTFK--------------------------------------------------------
A0A2K8Z965      LNVR---------------------YY-------------EAT-----T-----------
A0A418M8U8      LDVR---------------------YF-------------EKT-----A-----------
I2GTA4          LDVR---------------------YF-------------EKT-----A-----------
A0A2K8ZAJ2      LDVQ---------------------YY-------------RPT-----R-----------
A0A368JPA3      LNIR---------------------YF-------------RST-----P-----------
A0A5N1JI29      LNIR---------------------YF-------------RST-----P-----------
A0A3P1BT12      LNIR---------------------YF-------------RST-----P-----------
A0A3P1CI15      LNVR---------------------FF-------------RST-----P-----------
A0A4R8CUK1      LNVR---------------------YF-------------HKT-----A-----------
A0A3D0MYJ7      ------------------------------------------------------------
A0A662AH13      ------------------------------------------------------------
A0A5C7QA01      LDVQLSSQEDNFKNRFLGANHYDTVYS-------------NDA-----V-----------
A0A3D3LS70      ------------------------------------------------------------
A0A1G1TM36      LSTV---------------------YQ-------------RPG-----R-----------
A0A1G7ZF38      LTTQ---------------------YF-------------AAG-----T-----------
C6VS52          LTIQ---------------------YF-------------ASG-----L-----------
A0A7C1LGX3      LDVT---------------------YY-------------LKG-----K-----------
A0A2A4G4B1      LHIR---------------------YY-------------SKN-----S-----------
A0A0P7X1V8      YDER---------------------YQ-------------PDG-----R-----------
A0A6P1P355      LYAP---------------------QF-------------EED-----K-----------
A0A5C8KAD6      LYAP---------------------IY-------------EEG-----K-----------
A0A5N1J695      LYAQ---------------------VF-------------EED-----Q-----------
A0A3B0C2S4      LDVS---------------------YF-------------QKG-----N-----------
A0A3N2M1H3      LDMN---------------------YD-------------RLG-----G-----------
A0A4S2G8T2      LDMN---------------------YD-------------RLG-----G-----------
A0A212K7W5      LDED---------------------YS-------------TKG-----F-----------
F5IU11          LDED---------------------YS-------------IKG-----F-----------
A0A7C1QWC7      LEIA---------------------YYRESDNLLKQTSQIYNS-----N-----------
A0A352Z1R7      LDWQ---------------------VT-------------KKS-----K-----------
A0A3N2N6F7      LRAN---------------------YV-------------YKK-----R-----------
A0A4P7VVU7      LQTD---------------------YI-------------YRH-----N-----------
A0A2V1ILM4      LQTD---------------------YI-------------YRH-----N-----------
A0A3N2L0E8      LQTD---------------------YI-------------YRH-----N-----------
A0A3N2LFC5      LQTD---------------------YI-------------YRH-----N-----------
A0A0A2F501      LNVE---------------------YY-------------ADG-----R-----------
R5B7P0          LYMS---------------------YT-------------VDG-----T-----------
R5B0L5          LDET---------------------YN-------------IDG-----R-----------
A0A6I1TEC0      LNVD---------------------YA-------------VDG-----R-----------
A0A3R5XWG1      LNVD---------------------YA-------------VDG-----R-----------
A0A5P0Y910      LNVD---------------------YA-------------VDG-----R-----------
A0A414YFM3      LNVD---------------------YA-------------VDG-----R-----------
A0A6A7UIA7      LNVD---------------------YA-------------VDG-----R-----------
A0A6A7VPS3      LNVD---------------------YA-------------VDG-----R-----------
A0A374THP7      LDVD---------------------YA-------------IDG-----A-----------
A0A6G1VND1      LDVD---------------------YA-------------IDG-----A-----------
A0A0A2EVS5      LDID---------------------YK-------------VDG-----R-----------
A0A1T4NAJ7      LDID---------------------YK-------------VDG-----R-----------
A0A255T941      LNEV---------------------YS-------------VRE-----G-----------
A0A3N2KCL3      LDMN---------------------YY-------------IPG-----R-----------
A0A4P7VSV0      LDMN---------------------YY-------------IPG-----R-----------
A0A2V1IJY1      LDMN---------------------YY-------------IPG-----R-----------
A0A4P7VXK7      LDMN---------------------YY-------------IPG-----R-----------
A0A1Y4CHN5      LDVN---------------------YK-------------VDG-----R-----------
A0A1M6I2S6      LNET---------------------YT-------------VRK-----G-----------
A0A1Y3V692      LNET---------------------YT-------------VRK-----G-----------
F3PXM2          LDET---------------------YT-------------VRR-----G-----------
A0A174AHH7      LNEI---------------------YT-------------IRR-----G-----------
A0A174JCE8      LNEI---------------------YT-------------IRR-----G-----------
A0A3E4JMC4      LNEI---------------------YT-------------IRR-----G-----------
A0A412SND6      LNEI---------------------YT-------------IRR-----G-----------
A0A414IEQ9      LNEI---------------------YT-------------IRR-----G-----------
A0A6I0U0V8      LNEI---------------------YT-------------IRR-----G-----------
A0A6L5S9H7      LNEI---------------------YT-------------IRR-----G-----------
A0A0M1W8D8      LNEI---------------------YT-------------IRR-----G-----------
A0A3R6GKX5      LNEI---------------------YT-------------IRR-----G-----------
A7V4S1          LNEI---------------------YT-------------IRR-----G-----------
B0NU19          LNEI---------------------YT-------------IRR-----G-----------
D4V601          LNEI---------------------YT-------------IRR-----G-----------
A0A4Q0U3M9      LNEI---------------------YT-------------IRR-----G-----------
A0A4R4H1Q2      LNEI---------------------YT-------------IRR-----G-----------
A0A6I0GII7      LNEI---------------------YT-------------IRR-----G-----------
A0A6I0KYU7      LNEI---------------------YT-------------IRR-----G-----------
A0A397WLT5      LNEI---------------------YT-------------IRR-----G-----------
A0A6A2J529      LNEI---------------------YT-------------IRR-----G-----------
A0A6L6P8N9      LNEI---------------------YT-------------IRR-----G-----------
A0A6N8DDD8      LNEI---------------------YT-------------IRR-----G-----------
A0A015XH67      LNEI---------------------YT-------------IRR-----G-----------
A0A078RZN2      LNEI---------------------YT-------------IRR-----G-----------
A0A4R4I3T9      LNEI---------------------YT-------------IRR-----G-----------
A6L0K5          LNEI---------------------YT-------------IRR-----G-----------
A7ACT5          LNEI---------------------YT-------------IRR-----G-----------
A6KY94          LNEI---------------------YT-------------VRR-----G-----------
A0A173UQR8      LNEI---------------------YT-------------VRR-----G-----------
A0A3R6HK75      LNEI---------------------YT-------------VRR-----G-----------
A0A412B7D1      LNEI---------------------YT-------------VRR-----G-----------
A0A412VNY9      LNEI---------------------YT-------------VRR-----G-----------
A0A414LTU9      LNEI---------------------YT-------------VRR-----G-----------
I9Q4U4          LNEI---------------------YT-------------VRR-----G-----------
A0A373ISF0      LNET---------------------YT-------------VRK-----G-----------
U6RF62          LNET---------------------YT-------------VRK-----G-----------
A0A662ZZD5      LNET---------------------YT-------------VRK-----G-----------
A0A3A5TI83      LNET---------------------YT-------------VRK-----G-----------
A0A415NEB6      LNET---------------------YT-------------VRK-----G-----------
A0A6I0I238      LNET---------------------YT-------------VRK-----G-----------
A7AJ60          LNET---------------------YT-------------VRK-----G-----------
A0A6A2JF01      LNET---------------------YT-------------VRK-----G-----------
A0A6I0Y2Y2      LNET---------------------YT-------------VRK-----G-----------
A0A6I2Q447      LNET---------------------YT-------------VRK-----G-----------
A0A395YYT3      LNET---------------------YT-------------VRK-----G-----------
A0A015UXN7      LNET---------------------YT-------------VRK-----G-----------
A0A5M5W148      LNET---------------------YT-------------VRK-----G-----------
A0A6I2NTL0      LNET---------------------YT-------------VRK-----G-----------
A0A016E4F9      LNET---------------------YT-------------IRK-----G-----------
A0A4Q5CFJ7      LNES---------------------YT-------------VRK-----G-----------
A0A6N3HG44      LNES---------------------YT-------------VRK-----G-----------
A0A6H9P0U9      LNET---------------------FT-------------IRK-----G-----------
A0A108TH71      LNET---------------------FT-------------IRK-----G-----------
I8VXH0          LNET---------------------FT-------------IRK-----G-----------
A0A412S0N6      LNET---------------------YT-------------IRK-----G-----------
A0A412IIJ0      LNET---------------------FT-------------IRK-----G-----------
A0A0P0FM97      LNET---------------------FT-------------IRK-----G-----------
R6KTP3          LNET---------------------FT-------------IRK-----G-----------
A0A139LU87      LNET---------------------FT-------------IRK-----G-----------
A0A1C6B3Y5      LNET---------------------FT-------------IRK-----G-----------
A0A6L3KCD1      LNET---------------------FT-------------IRK-----G-----------
E2NMQ4          LNET---------------------FT-------------IRK-----G-----------
A0A412YDB9      LNET---------------------FT-------------VRR-----G-----------
R7DY01          LNET---------------------FT-------------VRR-----G-----------
A0A414LGK8      LNEV---------------------FT-------------VRK-----G-----------
A0A415IPQ4      LNET---------------------FT-------------IRR-----G-----------
A0A3E5BRW7      LNDI---------------------FT-------------VRR-----G-----------
K9DXS6          LNDI---------------------FT-------------VRR-----G-----------
A0A1M6KFV3      LNES---------------------FT-------------VRR-----G-----------
A0A1Q6G7L3      LNES---------------------FT-------------VRR-----G-----------
A0A413H235      LNES---------------------FT-------------VRR-----G-----------
A0A1M5B2J8      LEMN---------------------YL-------------VEG-----R-----------
A0A255RCT5      LDMN---------------------YL-------------VDG-----R-----------
A0A1Y4GLF5      LGTT---------------------YY-------------LPG-----K-----------
A0A1H3XSC0      LDMN---------------------YT-------------VPG-----R-----------
A6LE40          LDMN---------------------YF-------------VPG-----K-----------
A0A4Y1VPX5      LDMN---------------------YF-------------VRG-----K-----------
A0A6N2XMM4      LDMN---------------------YF-------------VRG-----K-----------
B3JI46          LDMN---------------------YF-------------VRG-----K-----------
A0A358R8U0      LDMN---------------------YH-------------IPG-----R-----------
R6WSB6          LDMN---------------------YH-------------IPG-----R-----------
A0A401LPX7      LEMN---------------------YQ-------------TDG-----R-----------
A0A6G0GNY9      LEMN---------------------YQ-------------TDG-----R-----------
A0A6I1BFM0      LEMN---------------------YQ-------------TDG-----R-----------
A0A3A5Z900      LEMN---------------------YQ-------------TDG-----R-----------
A0A285TGL6      LEMN---------------------YQ-------------TDG-----R-----------
A0A3A5RFX4      LEMN---------------------YQ-------------TDG-----R-----------
A0A1Q6IUW9      LEMN---------------------YQ-------------TDG-----R-----------
A0A413XDP6      LEMN---------------------YQ-------------TDG-----R-----------
A0A6N8CVT6      LEMN---------------------YQ-------------TDG-----R-----------
K6AP24          LEMN---------------------YQ-------------TDG-----R-----------
A0A6I2NHV3      LEMN---------------------YQ-------------TDG-----R-----------
A0A662ZYI7      LEMN---------------------YQ-------------TDE-----R-----------
A0A078RYI7      LEMN---------------------YQ-------------TDG-----R-----------
C7XEQ8          LEMN---------------------YQ-------------TDG-----R-----------
D7INX6          LEMN---------------------YQ-------------TDG-----R-----------
K5ZG55          LEMN---------------------YQ-------------TDG-----R-----------
A0A3N2N9B8      LDMD---------------------YY-------------SHG-----R-----------
A0A3N2NMI0      LDVN---------------------YF-------------RKG-----R-----------
A0A359I8H7      LDVN---------------------YS-------------TPG-----R-----------
A0A3N2KA63      LDVN---------------------YS-------------TPG-----R-----------
A0A4Q0IMT7      LDVN---------------------YS-------------TPG-----R-----------
A0A3B9FAU3      LDMN---------------------YT-------------MEG-----R-----------
A0A3C1E5L7      LDMN---------------------YT-------------MEG-----R-----------
A0A4Q0UAV1      LNNM---------------------YY-------------VDN-----G-----------
A0A354SN68      LEVS---------------------YS-------------ISD-----R-----------
A0A6L5XFL0      LDMQ---------------------YA-------------VKG-----T-----------
A0A3N2N595      LDMN---------------------YF-------------KDG-----T-----------
A0A0A2DUD9      LWTS---------------------YE-------------APG-----A-----------
A0A3P1ZBJ5      LDID---------------------YS-------------VEG-----F-----------
R5FHS9          LNVS---------------------YL-------------TDS-----T-----------
A0A413TW79      LDVN---------------------YS-------------EGG-----T-----------
A0A3E5E9M7      LDVN---------------------YS-------------EDG-----T-----------
A0A3E4SK73      LDVN---------------------YS-------------EDG-----T-----------
A0A415GGC6      LDVN---------------------YS-------------EDG-----T-----------
A0A413DBH9      LDVN---------------------YS-------------EDG-----T-----------
A0A1Y4PQK7      LDMS---------------------YY-------------APG-----R-----------
A0A1Y4IH41      LDMS---------------------YY-------------APG-----R-----------
A0A3A6AAP4      LDMS---------------------YY-------------APG-----R-----------
A0A6I0ZRD2      LDMS---------------------YY-------------APG-----R-----------
A0A1Y4DYA7      LNIN---------------------YY-------------TKG-----V-----------
A0A1Y3X4I9      LNIN---------------------YS-------------TDG-----T-----------
A0A1Y4FNK8      LDIN---------------------YY-------------TDG-----G-----------
A0A355FD59      IDVD---------------------YQ-------------ING-----P-----------
A0A359CEZ9      IDVD---------------------YQ-------------ING-----P-----------
A0A353Q7B4      IDVD---------------------YQ-------------ING-----P-----------
F8X3A5          LDVN---------------------YQ-------------IKD-----A-----------
A0A1M3KVR9      LDVN---------------------YQ-------------IKD-----S-----------
A0A4Y9IJS3      LDVN---------------------YQ-------------IKD-----S-----------
A0A495WI87      LNMD---------------------YH-------------VDG-----G-----------
A0A354M4S6      LNMD---------------------YH-------------VDG-----G-----------
R7DH52          LNMD---------------------YH-------------VDG-----G-----------
A0A4Q5E7L5      LDMN---------------------YF-------------FPG-----K-----------
A0A4P8LP09      LDMN---------------------YF-------------VPG-----K-----------
A0A4R4GZU7      LDMN---------------------YF-------------VPG-----K-----------
A0A016CWA4      LDMN---------------------YF-------------VPG-----K-----------
A0A1C6H117      LDMN---------------------YF-------------VPG-----K-----------
A0A0M1W0V2      LDMN---------------------YF-------------VPG-----K-----------
A0A139KA16      LDMN---------------------YF-------------VPG-----K-----------
A0A174VQ92      LDMN---------------------YF-------------VPG-----K-----------
A0A1Q6HCG0      LDMN---------------------YF-------------VPG-----K-----------
A0A1Y4JYM9      LDMN---------------------YF-------------VPG-----K-----------
A0A3A5QW67      LDMN---------------------YF-------------VPG-----K-----------
A0A3A5RQE6      LDMN---------------------YF-------------VPG-----K-----------
A0A3A6BP07      LDMN---------------------YF-------------VPG-----K-----------
A0A3E5E153      LDMN---------------------YF-------------VPG-----K-----------
A0A3Q9IP20      LDMN---------------------YF-------------VPG-----K-----------
A0A412WV15      LDMN---------------------YF-------------VPG-----K-----------
A0A413ICP6      LDMN---------------------YF-------------VPG-----K-----------
A0A414KYB9      LDMN---------------------YF-------------VPG-----K-----------
A0A5B3FWR2      LDMN---------------------YF-------------VPG-----K-----------
A0A6L4P3V7      LDMN---------------------YF-------------VPG-----K-----------
E5WX00          LDMN---------------------YF-------------VPG-----K-----------
K0X3P3          LDMN---------------------YF-------------VPG-----K-----------
A0A415TAH7      LDMN---------------------YF-------------VPG-----K-----------
A0A078T2W6      LDMN---------------------YF-------------VPG-----K-----------
A0A6I1AQV4      LDMN---------------------YF-------------VRG-----K-----------
A0A5C6L2P1      LDMN---------------------YF-------------VRG-----K-----------
A0A412MJT7      LDMN---------------------YF-------------VRG-----K-----------
A0A3E4WKT5      LDMN---------------------YF-------------VRG-----K-----------
A0A3A5YY33      LDMN---------------------YF-------------VRG-----K-----------
A0A078TAH2      LDMN---------------------YF-------------VRG-----K-----------
A0A1E9CFZ7      LDMN---------------------YF-------------VRG-----K-----------
A0A373FYU5      LDMN---------------------YF-------------VRG-----K-----------
A0A3A5TZ72      LDMN---------------------YF-------------VRG-----K-----------
A0A3A5XBP2      LDMN---------------------YF-------------VRG-----K-----------
A0A3A6MEG9      LDMN---------------------YF-------------VRG-----K-----------
A0A3E4JP35      LDMN---------------------YF-------------VRG-----K-----------
A0A3E4KP40      LDMN---------------------YF-------------VRG-----K-----------
A0A3E4NX82      LDMN---------------------YF-------------VRG-----K-----------
A0A3E4XFU8      LDMN---------------------YF-------------VRG-----K-----------
A0A412RG70      LDMN---------------------YF-------------VRG-----K-----------
A0A412TD37      LDMN---------------------YF-------------VRG-----K-----------
A0A413GAA4      LDMN---------------------YF-------------VRG-----K-----------
A0A414M7I4      LDMN---------------------YF-------------VRG-----K-----------
A0A496BTA0      LDMN---------------------YF-------------VRG-----K-----------
A0A496D2V6      LDMN---------------------YF-------------VRG-----K-----------
A0A4Q5G1P5      LDMN---------------------YF-------------VRG-----K-----------
A0A5C6KCA6      LDMN---------------------YF-------------VRG-----K-----------
A0A5M5AHM5      LDMN---------------------YF-------------VRG-----K-----------
A0A6I0KZV6      LDMN---------------------YF-------------VRG-----K-----------
A0A6I0Y5K7      LDMN---------------------YF-------------VRG-----K-----------
A0A6I1BFB8      LDMN---------------------YF-------------VRG-----K-----------
A0A6I2P5W5      LDMN---------------------YF-------------VRG-----K-----------
A0A6N8DC51      LDMN---------------------YF-------------VRG-----K-----------
E5UZA2          LDMN---------------------YF-------------VRG-----K-----------
A0A069SMG6      LDMN---------------------YF-------------VRG-----K-----------
A0A6A2RTB3      LDMN---------------------YF-------------VRG-----K-----------
A0A6I0VY00      LDMN---------------------YF-------------VRG-----K-----------
A0A1M4YZ07      LDMN---------------------YF-------------VPG-----K-----------
A0A0P0FQW1      LDMN---------------------YF-------------VPG-----K-----------
A0A5M5C0W6      LDMN---------------------YF-------------VPG-----K-----------
A0A6I0H151      LDMN---------------------YF-------------VPG-----K-----------
A0A642LZ22      LDMN---------------------YF-------------VPG-----K-----------
A0A6I0HI59      LDMN---------------------YF-------------VPG-----K-----------
A0A642NJ89      LDMN---------------------YF-------------VPG-----K-----------
A0A6I0HI52      LDMN---------------------YF-------------VPG-----K-----------
A0A6L3JTQ2      LDMN---------------------YF-------------VPG-----K-----------
A0A6L4EED9      LDMN---------------------YF-------------VPG-----K-----------
A0A6I0YVB5      LDMN---------------------YF-------------VPG-----K-----------
A0A6L5RHE2      LDMN---------------------YF-------------VPG-----K-----------
A0A6N3AEV2      LDMN---------------------YF-------------VPG-----K-----------
A0A6L3KG29      LDMN---------------------YF-------------VPG-----K-----------
A0A6G0G4T5      LDMN---------------------YF-------------VPG-----K-----------
A0A6I0HFG9      LDMN---------------------YF-------------VPG-----K-----------
A0A4Q5E5M7      LDMN---------------------YF-------------VPG-----K-----------
A0A6L4F5W0      LDMN---------------------YF-------------VPG-----K-----------
C3RFN5          LDMN---------------------YF-------------VPG-----K-----------
A0A3A5Z014      LDMN---------------------YF-------------VPG-----K-----------
A0A6I0ING7      LDMN---------------------YF-------------VPG-----K-----------
A0A6L5S265      LDMN---------------------YF-------------VPG-----K-----------
A0A078S3Q8      LDMN---------------------YF-------------VPG-----K-----------
A0A069SJV7      LDMN---------------------YF-------------VPG-----K-----------
A0A3E5DXI5      LDMN---------------------YF-------------VPG-----K-----------
A0A3E5EM98      LDMN---------------------YF-------------VPG-----K-----------
A0A3E5F453      LDMN---------------------YF-------------VPG-----K-----------
A0A6N2YYD4      LDMN---------------------YF-------------VPG-----K-----------
I9T3G6          LDMN---------------------YF-------------VPG-----K-----------
A0A3E4SYU0      LDMN---------------------YF-------------VPG-----K-----------
A6LGY1          LDMN---------------------YF-------------VPG-----K-----------
K5ZSH4          LDMN---------------------YF-------------VPG-----K-----------
A0A1H4ADG3      LYLN---------------------FS-------------TYK-----D-----------
A0A5B8VUR8      LNLS---------------------FS-------------TYK-----D-----------
A0A0D3L8Q3      LDVT---------------------YY-------------GDG-----R-----------
A0A2N3U785      LYVN---------------------YY-------------VEG-----H-----------
A0A5B6TJH8      LFTN---------------------YY-------------IEG-----Q-----------
A0A519U664      LFTS---------------------YY-------------VEG-----K-----------
A0A519MA34      LFTS---------------------YY-------------VEG-----K-----------
A0A519UCX0      LYTS---------------------YY-------------VKG-----R-----------
A0A0E3ZG78      LFIG---------------------YY-------------IEG-----R-----------
A0A1I6BRK6      LVTR---------------------YY-------------VEE-----R-----------
A0A243WAB1      LVAN---------------------YY-------------VEG-----K-----------
A0A6G8C8X6      LFTS---------------------YY-------------VEG-----K-----------
A0A416GA42      LDVC---------------------YQ-------------VKG-----F-----------
A0A1T3IYP5      ADKS---------------------YK-------------IHS-----G-----------
A0A1T5K9D4      IDVN---------------------YI-------------HHV-----G-----------
A0A077ENE7      ADKS---------------------YK-------------VHK-----G-----------
A0A6I5UW06      ADKS---------------------YK-------------VHK-----G-----------
T0NN57          SDIS---------------------YK-------------VRY-----G-----------
X5K347          SDIS---------------------YK-------------VRY-----G-----------
A0A060RD97      LNVS---------------------YS-------------YMG-----R-----------
A0A3C1ITV0      LNVT---------------------YK-------------SKN-----W-----------
R7HN19          LNVT---------------------YK-------------SKN-----W-----------
A0A350IHV0      LEAS---------------------YV-------------EKQ-----F-----------
R5RVP0          LETT---------------------YV-------------EKQ-----F-----------
R6A0L2          LDVD---------------------YT-------------TKE-----K-----------
R7LG80          LDVD---------------------YL-------------MPV-----S-----------
A0A2L2WX98      LDVD---------------------YT-------------IKE-----S-----------
A0A6N8KXI9      ADIS---------------------YS-------------EKR-----G-----------
G5GD56          LDVD---------------------YT-------------TSA-----G-----------
R5KD55          LDVS---------------------YT-------------TRG-----T-----------
A0A174QNT3      LDIN---------------------YV-------------VRN-----G-----------
A0A4S2FGS1      LDVE---------------------YT-------------LRN-----G-----------
R9I0H0          LDVD---------------------YT-------------IRD-----G-----------
K5BUT9          LDVD---------------------YA-------------KDG-----I-----------
A0A174FPA3      LDVG---------------------YA-------------KDG-----I-----------
R6S9Y6          LDVG---------------------YA-------------KDG-----I-----------
A0A642LIH6      LDVG---------------------YA-------------KDG-----I-----------
C9KX15          LDVG---------------------YA-------------KDG-----I-----------
A0A6H0KRK1      LDVS---------------------YE-------------KDG-----F-----------
R6DAG6          LDVS---------------------YE-------------KEG-----F-----------
A0A3L8AAP1      LDVS---------------------YE-------------KEG-----F-----------
A0A4S2AYX2      LDVS---------------------YE-------------KEG-----F-----------
A0A4Y9H477      LDVS---------------------YE-------------KEG-----F-----------
A0A0E2M2Y7      LDVS---------------------IS-------------KDG-----F-----------
A0A0K2J6Z0      LDVS---------------------IS-------------KDG-----F-----------
B2RKZ8          LDVS---------------------IS-------------KDG-----F-----------
A0A212GC82      LDVS---------------------IS-------------KDG-----F-----------
A0A254MU12      LDVS---------------------IS-------------KDG-----F-----------
R6CQ93          ADVD---------------------YR-------------VEK-----G-----------
A0A3D1NQW3      LTVQ---------------------YE-------------TKD-----G-----------
B0MT10          LTVQ---------------------YE-------------TKD-----G-----------
R7JGW9          LTVQ---------------------YE-------------TKD-----G-----------
A0A3D2BF46      LHVN---------------------YV-------------VKH-----G-----------
A0A358R538      LTTD---------------------YS-------------VRD-----R-----------
A0A1Y4AAB8      LTTG---------------------YS-------------KRS-----G-----------
A0A1Y3WWY9      LTEA---------------------YS-------------IHE-----H-----------
A0A1Y4U5L4      LTEA---------------------YS-------------IHE-----H-----------
A0A1Y3VCJ1      LTVN---------------------YT-------------VDG-----R-----------
A0A1Y3QTW7      LTVN---------------------YS-------------VRD-----G-----------
R6XWY7          LTVN---------------------YS-------------VRD-----G-----------
A0A4Y1X9Y9      LTVN---------------------YS-------------VRD-----G-----------
A0A4Y1WM66      LTVN---------------------YS-------------VRD-----G-----------
A0A6N4GYT3      LTVN---------------------YS-------------VRD-----G-----------
A0A174AVF1      LTVN---------------------YS-------------VRD-----G-----------
A0A656Q4F4      LTVN---------------------YS-------------VRD-----G-----------
A0A1Q6EIY0      LTVN---------------------YS-------------VRE-----G-----------
A0A5B5VN71      LTVN---------------------YS-------------VRE-----G-----------
E4M8L3          LTVN---------------------YS-------------VRE-----G-----------
I3YQ50          LTVN---------------------YS-------------VRE-----G-----------
R5UEY8          LTVN---------------------YS-------------VRE-----G-----------
A0A1H4D866      LTVS---------------------YS-------------VRE-----R-----------
A0A5B3G4Y7      LTVN---------------------YS-------------VSE-----R-----------
A0A374A9J5      LTVN---------------------YS-------------VSD-----G-----------
A0A5B3GQN5      LTVN---------------------YS-------------VSD-----G-----------
A0A1Q6E9S3      LTVN---------------------YS-------------VSD-----G-----------
D4IJ36          LTVN---------------------YS-------------VSD-----G-----------
A0A414Q925      LDIS---------------------YK-------------EWD-----G-----------
A0A415PUS9      LDIS---------------------YK-------------EWD-----G-----------
A0A108TCU0      LDIS---------------------YK-------------EWD-----G-----------
A0A413BA42      LDIS---------------------YK-------------EWD-----G-----------
S3Y344          LDIS---------------------YK-------------EWD-----G-----------
A0A4Q5G8Y8      LDIS---------------------YK-------------EWD-----G-----------
A0A412TGL3      LDIS---------------------YK-------------EWD-----G-----------
A0A413VJ33      LDIS---------------------YK-------------EWD-----G-----------
A0A414L0W6      LDIS---------------------YK-------------EWD-----G-----------
A0A412DP39      LDIS---------------------YK-------------EWD-----G-----------
A0A413ZSE8      LDIS---------------------YK-------------EWD-----G-----------
B0NP84          LDIS---------------------YK-------------EWD-----G-----------
R6AK43          LDIS---------------------YK-------------EWD-----G-----------
A0A412N2D9      LNVS---------------------YK-------------EWD-----G-----------
A0A1Y4JYS9      LNVS---------------------YK-------------EWD-----G-----------
R6LHA4          LNVS---------------------YK-------------EWD-----G-----------
A0A3E5HPT8      ADVS---------------------YM-------------VRD-----G-----------
C6IJ48          ADVS---------------------YM-------------VRD-----G-----------
Q8A3U2          ADVS---------------------YM-------------VRD-----G-----------
A0A3R6S1H6      LNIS---------------------YR-------------VEA-----G-----------
A0A3R6SD81      LNIS---------------------YR-------------VEA-----G-----------
A0A354WXN6      LDIN---------------------YS-------------IKE-----G-----------
R5IP14          LDVG---------------------YV-------------MQG-----G-----------
A0A316SZX7      LDVN---------------------YT-------------EDM-----G-----------
A0A1Y4AIY1      LDVS---------------------YT-------------EKR-----G-----------
A0A0J6CIR2      LDIS---------------------YT-------------IKD-----G-----------
A0A3D8HG59      LDIS---------------------YT-------------QKR-----G-----------
A0A3R6S408      LDIS---------------------YT-------------QKR-----G-----------
F3ZRU7          LNTT---------------------YS-------------VRQ-----G-----------
A0A1C5Q1F3      LDIF---------------------YS-------------VKG-----K-----------
R7A239          LDIF---------------------YS-------------VKG-----K-----------
A0A3R6HIK7      LDVS---------------------YQ-------------VKR-----G-----------
K5ZVW7          LDVS---------------------YQ-------------VKR-----G-----------
A0A1Y4D5Z0      LDIS---------------------YT-------------VKQ-----G-----------
A0A413VXJ7      LDIS---------------------YK-------------IKE-----G-----------
I9RSN9          LDIS---------------------YK-------------IKE-----G-----------
U6RJK5          LDIS---------------------YK-------------IKE-----G-----------
A0A1Q6GA32      LDIS---------------------YK-------------IKE-----G-----------
I9RPU6          LDMS---------------------YK-------------VKN-----G-----------
I8YFS5          LDMS---------------------YK-------------VKN-----G-----------
A0A6L3FCC6      LDMS---------------------YK-------------VKN-----G-----------
I8Y597          LDMS---------------------YK-------------VKN-----G-----------
A0A1Q6GBF5      LDMS---------------------YK-------------VKN-----G-----------
I8YFZ3          LDMS---------------------YK-------------VKN-----G-----------
A0A1Q6GDH2      LDMS---------------------YK-------------VKN-----G-----------
U6RSB0          LDMS---------------------YK-------------VKN-----G-----------
I9SIK1          LDMS---------------------YQ-------------VKN-----G-----------
I9GXM2          LDMS---------------------YK-------------VKN-----G-----------
I9TP59          LDMS---------------------YQ-------------VKN-----G-----------
R5S343          LEQI---------------------YT-------------TKR-----G-----------
A0A1M6K7I9      LNMS---------------------YK-------------VRI-----G-----------
A0A5M6A8C8      LNMS---------------------YK-------------VRI-----G-----------
A0A6L3FBE6      LDMS---------------------YT-------------VKN-----G-----------
A0A6L3FNG1      LDMS---------------------YK-------------IRN-----G-----------
A0A3R5ZMK1      LDVS---------------------YT-------------VKD-----G-----------
A0A6L6NFJ9      LDVS---------------------YT-------------VKE-----G-----------
A0A1Y3ZIA4      LDVS---------------------YT-------------VKD-----G-----------
K5Y1A4          LDVS---------------------YT-------------VKD-----G-----------
A0A4Q5CIT0      LDVS---------------------YT-------------VKD-----G-----------
A0A6L6NWL9      LDVS---------------------YT-------------VKD-----G-----------
A0A3R6K8X4      LDVS---------------------YT-------------VKD-----G-----------
A0A6N8D6C8      LDVS---------------------YT-------------VKD-----G-----------
A0A3R6BKI7      LDVS---------------------YT-------------VKD-----G-----------
A0A6N8CW60      LDVS---------------------YT-------------VKD-----G-----------
A0A412M2W1      LDVS---------------------YT-------------VKD-----G-----------
K5ZX55          LDVS---------------------YT-------------VKD-----G-----------
A0A415BDM7      LDVS---------------------YT-------------VKD-----G-----------
A0A6L6MX19      LDVS---------------------YT-------------VKD-----G-----------
A0A1Q6I3T6      LDVS---------------------YT-------------VKD-----G-----------
A0A414XX40      LDVS---------------------YT-------------VKD-----G-----------
A7AEU7          LDVS---------------------YT-------------VKD-----G-----------
A0A5F0U645      LDIS---------------------YS-------------IRE-----G-----------
K5ZBN2          LDIS---------------------YS-------------IRE-----G-----------
A0A0J6CKW3      LDIS---------------------YS-------------IRE-----G-----------
A0A0F5IQM7      LDIS---------------------YS-------------IRE-----G-----------
A0A496CDT3      LDIS---------------------YS-------------IRE-----G-----------
A0A6G1ZKM3      LDIS---------------------YS-------------IRE-----G-----------
S0GLB0          LDIS---------------------YS-------------IRE-----G-----------
A0A3R6NLC1      LDIS---------------------YS-------------IRE-----G-----------
A0A416WYC9      LDIS---------------------YS-------------IRE-----G-----------
A0A0F5IT40      LDIS---------------------YT-------------IKD-----G-----------
A0A496CX20      LDIS---------------------YT-------------IKD-----G-----------
A0A5F0UBI0      LDIS---------------------YT-------------IKD-----G-----------
A0A6G1ZHG0      LDIS---------------------YT-------------IKD-----G-----------
S0GSI7          LDIS---------------------YT-------------IKD-----G-----------
K5YB65          LDIS---------------------YT-------------IKD-----G-----------
A0A0F5IWP9      LDIG---------------------YT-------------VKE-----G-----------
A0A0F5IZT8      LDIG---------------------YT-------------VKE-----G-----------
A0A417LKQ2      LDVS---------------------YT-------------VKE-----G-----------
A0A416TME1      LDVS---------------------YT-------------EKD-----G-----------
A0A416XPE8      LDVS---------------------YT-------------EKD-----G-----------
L8JI02          FGIS---------------------YF-------------SKE-----S-----------
A0A4Q5WS95      LYAP---------------------VF-------------ESG-----R-----------
A0A501VZX6      LYAP---------------------VF-------------EEG-----K-----------
A0A399SH26      LYAP---------------------VY-------------EDT-----K-----------
A0A501W1A9      LYAP---------------------IF-------------EES-----R-----------
A0A0E3ZGV6      LYAP---------------------VY-------------EET-----K-----------
A0A1I2N4S1      LYAP---------------------IY-------------EED-----R-----------
A0A2T5YE44      LYAP---------------------IY-------------EED-----R-----------
A0A1M5BA90      LYAP---------------------IF-------------EDG-----P-----------
A0A512B879      LYAP---------------------VF-------------EAT-----P-----------
A0A559PPI3      LYAP---------------------VY-------------EEKDFFGLN-----------
A0A1T5CS78      LYAP---------------------IY-------------EDG-----R-----------
A0A0Q9Z8F1      LYAP---------------------IY-------------EDA-----G-----------
A0A2N0U0M7      LYAP---------------------IY-------------EDT-----G-----------
A0A1V9FHD0      LYAP---------------------VS-------------EAADFGSLK-----------
A0A4V4H170      LYAP---------------------VY-------------EAPDYKQGK-----------
A0A1V9F098      LYAP---------------------IY-------------EAAG-NKGK-----------
A0A4R2VU64      LYAP---------------------VY-------------EDAG-NKGK-----------
A0A4S8HY23      LYAP---------------------VF-------------EAPDFKKRK-----------
A0A1V9F383      LYAP---------------------IN-------------EGPEYSMGK-----------
G8TRZ6          LYAP---------------------IY-------------EGIDFSQWK-----------
A0A4R5DL69      LYIS---------------------YF-------------VSG-----N-----------
A0A1M4YED3      LYTE---------------------IK-------------EET-----Q-----------
A0A2H3NSN0      TAAD--------------------------------------------------------
A0A2P6C324      DVAD--------------------------------------------------------
A0A7C2DZI7      ETAN--------------------------------------------------------
A0A1M6XHU0      ATAE--------------------------------------------------------
G2SF81          ATAE--------------------------------------------------------
A0A5S9EYW1      ATAE--------------------------------------------------------
D0MHQ9          ATAE--------------------------------------------------------
A0A126PFG0      LSTL---------------------YQ-------------QRD-----H-----------
A0A3M1N7Z3      LNYE---------------------VY-------------SIG-----K-----------
                                                                            

A0A1T5MMH4      -----------LNH--ELFGN---------S-PILV-SYKIE--NPAFFNQPFFL-----
A0A2W4R1L8      -----------LNY--EFFGN---------L-PFTV-DYTIT--RPAFYGVPIFV-----
A0A2E5CV79      -----------LFNTRKYYPR---------GEKYRRILKEIM--SLGIYSPEIEK-----
A0A2D4ZVH1      ----------------DQYGN---------KFPILWRAYPVDSTSTSIDTVAMRY-----
A0A0K8QSK7      -----------LDP--EVYTA---------A-PFVV-EWDRS--HPQMIGTRIRL-----
A0A1V6CN82      -----------STA--ENYTD---------A-AFRV-EWDRN--HPQLIGFDFRI-----
A0A1M4XZ45      -----------AIA--ERYEE---------V-PFQV-IWDED--HPQIINADFYL-----
A0A399D319      -----------AVS--ERYKE---------V-PFQV-VWDEE--HPQVIDADFFL-----
A0A1V5IPN7      ----------------SAYPV---------G-NLRRIQISSK------------------
A0A1M6GR99      ----------------NAYNE---------S-PFKVFIFKE---HPQLVGPVFDV-----
A6EBM4          -----------LQT--DLYPQ---------Q-PLQIDILKID--SLQSGRQLILF-----
A0A7C5M4P4      -----------LVD--EKFRN---------P-PFTV-DCQLK--NANIYNKNIDV-----
A0A1M6TTV4      -----------LSD--ERYGN---------S-PFQV-LYNEL--SSELLDRRIYI-----
A0A4Q8RX32      -----------YNE--NLYTS---------S-PFEV-IIDKN--HLQMTNVVFNV-----
K0X1U5          -----------KKK--EYYRN---------S-PFTV-DIPES--MVDTLSSGFVV-----
R5EXK3          -----------KKK--EYYRN---------S-PLTV-EIPES--MVDTLSSGFVV-----
A0A401UAP7      -----------LDY--ELYKN---------S-PFKVTPIEV---NNSYYNLNHTI-----
A0A1W2GF52      -----------VD---ERYGN---------S-PFEV-QYDLT--NSALLDKRFDI-----
A0A2G5L7B8      -----------YD---ERYGN---------S-PFIV-DVQVS--DPSILNRRIDV-----
A0A523GAC0      -----------LED--EKYRS---------P-PFKV-EYTFL--DNWVYDQQFTV-----
L8JW09          -----------LND--EKFKT---------S-PFIV-DYNLK--NPQLLDRRIFV-----
A0A364XUP5      -----------LNH--ELFGN---------T-PYHI-EYKNV--DDGLYNIPLHL-----
A0A1M5RLA9      -----------LND--ELFQN---------A-PFLV-RYKAQ--NESSFNVPIHL-----
A0A385SFR9      -----------LND--ELFQS---------A-PFVV-RYKAQ--NESSFNAPIHL-----
A0A5M4A9J4      -----------MGLEKELYNN---------A-PFRI-EWLSR--HQQLVGATF-------
A0A5M4B1C7      -----------WGHTSELYHK---------S-PFVV-KWNKG--HPQLIGATF-------
A0A0D3LFR6      -----------LDD--EKYRS---------A-PFKV-DYLLK--DERFFNQKIYV-----
M7N6D4          -----------LDD--EKYRS---------S-PFEV-SYLVK--DESFFNRRFFV-----
A0A4D7K1D4      -----------KNE--ERYRN---------K-PFRV-DYQVK--SADLHNRLFNV-----
A0A5C7MX19      -----------ISE--ELYKN---------C-PFEL-KMDVK--DLDILRVPIYI-----
A0A1Q3ZMZ7      -----------LTS--QIYQS---------S-SLGYKSLLIK--DSSIIGQPVYL-----
A0A2D8JJW3      -----------FKYKEDKKDT---------V-SFLF--------NNEIIDVPIHIKEGCG
A0A2W2AFF7      -----------KKT--PLYED---------V-PFHFVFIPLY--EDSVSKDMYTF-----
R7PCR1          -----------RPI--SLFSI---------R-PFNV-VFQAPFSKALAFDVKIL------
A0A1G9E2A9      -----------VNS--EAYHD---------S-PFRV-EYKLK--SGAIQDRSIEL-----
A0A098LL25      -----------LYE--ERYNN---------S-PFKV-IGEIK--HPDFLDFKFDI-----
A0A6J4H627      -----------KNE--ERFLS---------A-PFRV-ETVRL--GPAAYDKPIDI-----
A0A6C0GJI1      -----------LEE--ERYKN---------S-PFIV-NFDAT--SNVPYDRPFDV-----
A0A2T2YJE8      -----------LNE--ELYKN---------S-PFKI-TYQLT--NEAYYDRRYNV-----
A0A127B287      -----------LEV--ELYKD---------S-PFKV-AFDSS--RFDLYDQKIYV-----
A0A6P1P2P6      -----------LEV--ELYND---------S-PFRV-TFDST--NFDLYDQKIYV-----
A0A3M9N829      -----------LDA--ELYKD---------S-PFAV-NYDTS--AFDLFDQQIFI-----
A0A0P0CSF9      -----------LDA--ELYKD---------S-PFQV-SYDNE--SFNLYDQKIYV-----
A0A5M8QQB8      -----------LDA--ELYKD---------S-PFEV-LYDSV--DFNLYDQKIYV-----
A0A3M9MNC3      -----------LDA--ELYKS---------S-PFEV-VYDST--NFSLFDQKVYI-----
A0A5B6TAX2      -----------LDA--ELYKD---------S-PFEV-SYDST--NFDVYDQKIYV-----
A0A5N1IQ33      -----------LAS--EVYKT---------S-PFRV-EYRIK--DNSFYNRKFNL-----
A0A512AYT3      -----------LSE--ELYKN---------S-PFKV-IYEIK--DDGFYNKNFDV-----
A0A5M6CYN7      -----------LSE--ELYNN---------S-PFKI-TYDIK--DGRFYNKKINV-----
A0A369QP10      -----------LNE--ELYRS---------S-PFHI-SYEMS--NEAYYNIKFGV-----
A0A126PDF2      -----------LES--ELYGI---------S-PFQI-AYTIK--DKDLYNQKISL-----
A0A2Z3GKA1      -----------LES--ELYGI---------S-PFRI-AYTIK--DKELYNQKISL-----
A0A502GZP7      -----------LES--ELYGN---------S-PFHI-AYVVR--DKELYNQKISL-----
A0A519SBU8      -----------LET--EMYNT---------S-PFHV-RYKVS--DPQFYSRKFQV-----
A0A4Q3JNZ3      -----------LEA--ELYNS---------T-PFHV-QYKIT--DPELYSHKFLL-----
A0A519Q9V3      -----------LEA--ELYNS---------A-PFHV-KYKIA--DQGLYNHKFLI-----
A0A0M3RW20      -----------LES--ELYKA---------S-PFHI-EYAIK--DPGYYGIQFNI-----
A0A495VFX4      -----------LES--ELYKT---------S-PFHV-EYYIT--NLNLYGVRFNV-----
A0A1S9B3W0      -----------LET--ELYGV---------S-PFHV-TYTVR--EPSQFNLKFSV-----
A0A1W1VRL3      -----------LES--ELYTR---------S-PFQV-TYKIK--NPAFYNRKFNV-----
A0A1M6R305      -----------LET--ELYGV---------S-PFRV-DYE----GDILYNTKFSV-----
A0A4Z0PHK3      -----------LEN--ELYGV---------S-PFNV-EYKIK--DPSFYNTKFSL-----
A0A2M9B9H9      -----------LEN--ELYGI---------S-PFKV-SYDIK--DPNFYNSKFNL-----
A0A4Z0QCY9      -----------LET--ELYGI---------S-PFKV-SYTIK--DPNYYNTKFNL-----
A0A418R9X5      -----------LES--ELYSL---------S-PVRI-EYKAG--KGAMFNQKIGL-----
A0A428JSJ3      -----------LES--ELYNL---------S-PVRV-EYTAN--KGAAFNQKIGL-----
A0A428KI59      -----------LES--ELYNL---------S-PVRV-EYKAG--KGAMFNQKIGF-----
W8F1I6          -----------LES--ELYNL---------S-PIRV-EYKAG--KGALFNQKIGF-----
A0A246FQC0      -----------LES--ELYAS---------S-PFIV-KYKPI--NNAVFDLKIGI-----
A0A372E5P8      -----------LET--EIYGA---------S-PFEV-SYEAT--ANAAFDQKIAL-----
A0A1H3EMW1      -----------LET--EIYGI---------S-PFEV-SYQAT--ADATFDQKLAL-----
A0A1H9ZSN3      -----------LET--EIYGS---------S-PFEV-SYEAL--ADAAFDRKIAL-----
A0A5N1J2M4      -----------LDQ--EVYTD---------S-PFNL-IFKVN--NPELYDKPVEV-----
A0A519S476      -----------LES--ELYNN---------A-PFHV-RYKIA--DAELYGHKFQV-----
A0A4Q3JRW8      -----------LEA--ELYNN---------S-PFYV-RYKIT--DNELYNHKFLV-----
A0A519M923      -----------LEA--ELYSN---------S-PFRI-EYKVT--DNELYGHKFQV-----
A0A4Z0ENW1      -----------LEN--ELFGS---------C-PYQV-KYTIS--DPVYYNHKFDV-----
A0A519UDB4      -----------LET--ELFGN---------S-PFKV-IYTIS--DVSYYNRKFNI-----
A0A3S0QKV1      -----------LET--ELYGN---------S-PFRV-EYTVR--EPIQFNKKFSV-----
A0A328BL48      -----------LET--ELYRT---------A-PFRV-EYAVR--EPLQFGQKFSV-----
A0A5R8WLY4      -----------LET--ELYRT---------A-PFRV-EYTVR--EPLQFGQKFNV-----
A0A1I5WSL8      -----------LEA--ELYGT---------S-PFKV-IYKIT--DPSLYNRKFDL-----
A0A0U3JVM7      -----------LES--ELYGI---------A-PFRV-KYHIT--DPSLYNHKFDL-----
A0A1G1SSV2      -----------LES--ELYGT---------S-PFRV-KYNIT--DPSLYNRKFEL-----
A0A1G1SXV7      -----------LES--ELYRT---------S-PFRV-KYSIT--DPSLYNRKFEL-----
A0A6G8CBJ6      -----------LES--ELYKR---------S-PFKV-AYAIK--DPAFYNRKLNV-----
A0A0W8EDI5      -----------LAS--ELYNA---------T-PFRI-DYDPA--DQILYNRKFDI-----
A0A3B7RBP8      -----------LAN--ELYTD---------T-PFRV-QYSTK--DGFLFNKKIYI-----
A0A3R9P8H7      -----------LET--EMYNT---------S-PFKV-VYTPT--DDAAYDQKIAV-----
A0A238WIA7      -----------LET--ELYKT---------S-PFKV-EYESK--NGSLFNTRFNL-----
A0A212UCJ7      -----------LET--ELYRA---------S-PFKV-EYQTK--GGGQYNTKFGL-----
A0A4Z0MQE1      -----------LET--ELYRA---------A-PFKV-EYEVRAGGAGQFNSKFGL-----
A0A4Z0PCF4      -----------LET--ELYRT---------S-PFKV-DYETKAGGAGQLNTKFGL-----
A0A6M6BED0      -----------LET--ELYRA---------S-PFKV-VYETKAGGAGQLNTKFGL-----
A0A5D6VDG1      -----------LES--ELYGI---------S-PFQV-NYTIT--DPSLYNTRFNV-----
A0A6H1CVS0      -----------LEN--ELYGT---------S-PFHV-DYTIT--DPALYNTRFSV-----
A0A243WHR7      -----------LEN--ELYGL---------S-PFKV-NYKIK--DGSLYNTRFDL-----
A0A5B8A0P6      -----------LES--ELYGN---------S-PFKV-EYNIK--NGVFYNTPINI-----
A0A076HRT9      -----------LES--ELYGT---------S-PFRV-QY--D--GEVLYNTKFNL-----
A0A4Z0PVM7      -----------LEN--ELYGV---------S-PFKV-AYIIK--DPNFYNSKFNL-----
A0A1M6DHW8      -----------LEN--ELYGT---------S-PFEV-EYRIK--DASLYNTKFNL-----
A0A4Q5LC61      -----------LEN--ELYGT---------S-PFKV-EYNIK--DPGLYNTKFNL-----
A0A2N5YXE2      -----------LYT--ELYGN---------T-PFEV-NYRIN--NTVILDQKVNI-----
K0XJ09          -----------HYD--QLYAE---------S-PIRV---NFL--DAYTAPVSMEI-----
R5EUZ0          -----------HYD--QLYAE---------S-PIRV---NFL--DAYTAPVSMEI-----
W0EQS0          -----------HYK--SLYAE---------S-PIRV---NFI--DPYTAPVFMKI-----
A0A1Y3WE15      -----------HNK--QLYAE---------S-PIRV---DFL--DDYTAPVSMKI-----
A0A1Y4GUK3      -----------HNK--QLYAE---------S-PLRA---HFL--DAYTLPVSMKV-----
A0A2U1FKU2      -----------RKE--SLYAN---------S-PLSIKITNRD--STEGYSFRIQI-----
A0A0A2F954      -----------RNE--SLYGN---------S-PVSIQITDRD--STENYSFRIRI-----
A0A0A2FW91      -----------RNE--SLYGN---------S-PVSIQITDRD--STENYSFRIRI-----
A0A2D2N2N1      -----------RNE--SLYGN---------S-PVSIQITDRD--STENYSFRIQI-----
Q7MWZ2          -----------RNE--SLYGN---------S-PVSIQITDRD--STENYSFRIQI-----
T2NDT6          -----------RNE--SLYGN---------S-PVSIQITDRD--STENYSFRIQI-----
W1R7P9          -----------RNE--SLYGN---------S-PVSIQITDRD--STENYSFRIQI-----
A0A1R4AFZ0      -----------RNE--SLYGN---------S-PVSIQITDRD--STENYSFRIQI-----
A0A1R4DVZ7      -----------RNE--SLYGN---------S-PVSIQITDRD--STENYSFRIQI-----
A0A7C0WKI7      -----------FNS----------------P-----------------------------
A0A2A8CVM9      --------------------------------PLLY------------------------
A0A5M4B212      -----------RTS--ELYRN---------L-PFHV-EWDRN--HPQLLDANFDL-----
A0A3D1KEX9      -----------QPV--TLFKH---------N-PIKV---EFL--SPYFEDISFEV-----
A0A358Y7S2      -----------LTQ--NLYRE---------T-GFSLMVYSLN--DSSLCGTEMHV-----
A0A1X7J248      -----------KDD--ERYRF---------T-PFTV--SYDK--SCAAYGEKFFV-----
E4TQD2          -----------KNE--ERYRF---------S-PFTV--SYEK--SCANYDQKFYV-----
A0A2J6HHN3      -----------LNS--ELYKS---------A-PFKV-YYELI--DSTFYAESLDI-----
A0A1Y3WMT8      -----------FNK--VEYYG---------NSPITV-DVPES--MLDTLVSGFVV-----
A0A1Y4GQU1      -----------FSK--KEYYG---------NSPITV-DVPES--MLDTLVSGFVV-----
A0A6A0R272      -----------SSY--ELYRK---------S-PINL-NLLSA--SDEITPLEIDL-----
A0A1V5W8T5      -----------LTS--ELYNK---------T-PFFV-EYQDV--QSAIFNKNIYL-----
A0A2T8HKA9      -----------RNI--ELYKD---------S-PIRVTFTKLD--PEAHASMTIIP-----
A0A2I0QZ80      -----------LTE--QRYRQ---------G-NLEISPLLLK--DSSLLNTPINI-----
A0A3E1F1A3      -----------LTE--TLYKQ---------N-SVSIDPVLLK--DSSLFGVPIYL-----
A0A2U2XBJ3      -----------LTE--TLYKQ---------G-VVRIMPLIIK--DSSLFGTPIFL-----
A0A4Q4KU94      -----------LTE--TLYKQ---------G-TIRIKPLIIK--DSSLFGTPIFL-----
A0A3B8INU3      -----------LDD--EKYKE---------S-PFEA-TITVR--NPAVFDKKVMV-----
A0A2W1NDY9      -----------LIE--EKFKQ---------S-PYHLIFYELK--DSSLINVPIYL-----
A0A5C8AQR5      -----------LTE--EMYRT---------S-SFNVQPYSLN--DSALCNVPIYV-----
A0A1G0CI31      -----------LTE--EKYLQ---------S-SFNVQPFQLK--DSSLCDIPIWI-----
A0A556N0M0      -----------LTE--EKYHQ---------S-TFTVLPYALR--DSSLCDVPIGV-----
F2IKD6          -----------LTE--EKYHQ---------N-TFTILPYSLS--DSSLCDIPIWI-----
A0A1I7BM74      -----------LTE--ERYTQ---------S-QFQVQLFKLN--EPDLYNLPIYF-----
A0A2G2FJ17      -----------LTE--KRYKQ---------S-TFYIKQSHIK--DSSVFHIPIYI-----
A0A2E3R1D0      -----------LIEAETVPGT---------NRPLPI------------------------
A0A2T2USC0      -----------LDSMETNPYT---------GEQLSV------------------------
A0A2T2V0F3      -----------LDTMETHPRT---------GEPLAV------------------------
A0A2T2S682      -----------LDTMGTHPRT---------GKPLDV------------------------
D5H561          -----------LLEQGEARRVLSSQGVSPFGRLMDR------------------------
A0A2H3NWA9      -----------MDEM--YPEG---------EGPPIM------------------------
A0A2A8CVB6      -----------LLALGRHPET---------GRPIQM------------------------
A0A2P6C1S6      -----------LQRMGTHPDT---------GQPLQI------------------------
A0A2T2UTM4      -----------LQDLGTHPET---------GEPLQI------------------------
A0A414ZBF2      -----------RKR--ELYNS---------T-PFTV----VF--QDAEPGQEISL-----
A0A1Q3Q573      -----------KFITEDLYQS---------A-PFEI-LPEQI--APEFYGNPVYI-----
A0A662BAY3      -----------KSR--EIYKE---------S-PFEV-IWDYE--HPQLIYADFLL-----
A0A4U3L369      -----------RTI--ETFEK---------T-PYSV-HLVAM--RDSIAPFTLHW-----
A0A357YNR3      LKDNVPSFLIIKSN--SLYGN---------ESPVLVRMSDKD--LNNLI-----------
A0A5E8AX52      -----------LTE--ERYRN---------S-PFVV-SYKLH--NTGFFDRPIDI-----
F4KK08          -----------REK--DLYKQ---------S-PVSIRFVNAD--PDEKISLRIKS-----
A0A6B5PK86      -----------LTE--EKYKL---------S-SVNVQPYHLN--DSTLVGTPVTI-----
A0A2G2F510      -----------LTE--EKYLS---------S-SYYIQPYELY--DSTLINKEVRV-----
A0A316JZ08      -----------LTE--ELYLA---------S-SFNIQPYELV--DSTLIGQEIGI-----
A0A496LCF9      -----------KNV--PLYGR---------S-PISIEIINIY--EEGYYMYYSYK-----
A0A5P2G2A9      -----------GIR--ELYKD---------K-PFGI-TLSNN--ADPIKGYKFEI-----
A0A3C0ZQC7      ------------IK--RGYTD---------S-----------------------------
A0A419VXB7      -----------GDF--ILYGN---------E-PCHV-EFEPD--AFNLKGVPVHI-----
A0A0B0BTJ4      -----------RYS--YLTAE---------SSPLKL----TA--DTIRYTFNIHI-----
A0A3B9CNN6      -----------RYS--YLTAE---------SSPLKL----TA--DTIRYTFNIHI-----
R5X290          -----------RYS--YLTAE---------SSPLKL----TA--DTIRYTFNIHI-----
A0A1Q6E6I7      -----------RYS--YLTAE---------SSPLKL----TA--DTIRYTFNIHI-----
C3J7R8          -----------RTE--MLYKD---------T-PLEVRFVGNS--SDVYCKLEVSS-----
A0A1G8BVM8      -----------RFK--DLYTS---------S-PIEV-EYMDD--VAKQGMFTITV-----
A0A1I1FXP9      -----------VFS--EMYKS---------S-PFRV-EYEVK--NPAFYDIPVDV-----
A0A3N4H5N3      -----------FKK--EISPF---------SLPVEIEVHEIN--NDFVGGGELLQ-----
A0A2P8EAX2      -----------FKR--EISPY---------NVSINIVVHEFN--EEFLLEGEVFT-----
A0A4V2F6N9      -----------FKK--ELSPY---------NVPVNLIVHEFN--EEFLSGVEVFA-----
A0A3B9FXJ0      -----------RNT--DMYYN---------G-PFWV-DIDVQ--DSTVLGDVIEL-----
R5GSU5          -----------GQS--TLYKK---------R-PFEA-TFLRP--AEIDEDITFKV-----
A0A2A3UE91      -----------KNN--ELYDS---------S-PYLI-KINAK--KGTVYGSQIKV-----
A0A0A2G557      -----------RSK--KLYKE---------T-PIRL--TLLN--TSDTLSGSFSL-----
A0A2N2WFW8      -----------LNF--ELYDG---------A-PFHI-QYQIV--DSLSYGTPYSL-----
A0A1F3IU95      -----------LNF--ELYDD---------V-PFDI-KYEIV--DSTFYGVPLLI-----
A0A3D0VUF6      -----------LNF--ELYDD---------V-PFDI-KYEIV--DSTFYGVPLLI-----
A0A1T4PT95      -----------SSK--KLYKD---------S-PIHLTLLEFP--ED--HSGSFIL-----
A0A6I6JYY3      -----------KTS--ERYRE---------V-PFTV-EWDEA--HPQLTNSEFLL-----
A0A2A4PYG9      -----------LDS--EIYTA---------S-PYTV-EVRNV--GPGLLGKPIYI-----
A0A1F3K695      -----------LTN--ELYRM---------S-PFTV-EANIL--DSRIYEIPIYI-----
A0A353KZR1      -----------LTN--ELYRM---------S-PFTV-EANIL--DSRIYEIPIYI-----
A0A2N2WYB5      -----------LST--ELYKR---------S-PFKV-EWKTL--NPSIFNTPIYI-----
A0A1F3K4G0      -----------LST--ELYRR---------S-PFQI-EWKMI--TGKLYDIPVYI-----
A0A356H8Y3      -----------LST--ELYRR---------S-PFQI-EWKMI--TGKLYDIPVYI-----
A0A351HSA6      -----------LST--ELYRR---------S-PFQI-EWKMI--TGKLYDIPVYI-----
A0A1F3Q014      -----------KNN--ELYTS---------S-PYSV-DYKII--NPKISGVKIYI-----
A0A2D5KD44      -----------LRN--EIYKN---------A-PFNV-EVLYK--EPSLSSTKIDI-----
A0A6N9NIX1      -----------LEK--ELYVE---------S-PFVV-EFDLI--DSSLIGRPIFV-----
A0A2A4YXP3      -----------LTN--ELYRS---------S-PIKV-EHQVK--DSSILGQHFYV-----
A0A1F3R158      -----------LTF--ELYKN---------S-PINI-EYYIK--DSSVIGISHFV-----
A0A2M8ADX2      -----------LTF--ELYKN---------S-PLDV-NYDIK--DSSIIGLPFYI-----
A0A1J5B2H0      -----------LNF--ELYKS---------S-PFEI-KYSIK--NPAIYGIPIYI-----
A0A1V5N756      -----------LNT--EMYRS---------N-HYNV-HYVVK--KPVIYNVPINI-----
A0A651GU15      -----------LTR--QLYRV---------P-QPKLNLVAIT--DSSILDKQIFI-----
A0A3Q9FR88      -----------RDS--ELFGD---------AVPFTFEYPNNV--QPTLKDLPFFL-----
A0A553GEX3      -----------RNS--ELFGD---------AVPFTFEYPNNI--QPALKDLPFLL-----
A0A150ADJ9      -----------RDS--ELFGK---------NLPFSITFPSGK--LPFLQDKPILL-----
A0A1B1FWQ4      -----------RDS--ELFED---------GVPFTLTYPSGK--QPALKNTPFYL-----
A0A1S1Z228      -----------RDS--ELFGD---------GVPFTLTYPSGK--QPAFKDIPLFL-----
A1ZKR2          -----------LDA--EYYKN---------P-PFKVIDHQVK--SDAFLDKNINI-----
A0A1Q3GX01      -----------LEA--EYYTN---------A-PFKVVDYKIK--APVYYDKKFNI-----
A0A349DQI4      -----------LEA--EYYTN---------A-PFKVVDYKIK--TPGYYDKKFNI-----
A0A4P5TMD1      -----------LVE--ERYKT---------S-PFEI-VPTVN--EPALYDIPIYF-----
A0A2N3IIZ0      -----------LDN--EMHGF---------S-PIEV-QAVVL--NENLYNQKFYI-----
A0A1F3SJM1      -----------LTE--EKYLS---------S-SFHVQPYELR--DSSLVYEGTEV-----
A0A2G2EB96      -----------LTE--EKYLS---------S-AFNIQPYQLS--DSSLINQEIAV-----
A0A2G6PRA9      -----------LTE--EKYLS---------S-SFNIQPYELS--DSSIINQEVAV-----
A0A497D5Z2      -----------MTS--EMYRN---------P-PFRV-QWEEG--HPQVINADFYV-----
A0A662B170      -----------MTS--EMYRN---------P-PFRV-QWEEG--HPQVINADFYV-----
A0A2A5FYT6      -----------MAT--ENYAN---------H-PYSV-GFQVK--DSSIFGRKIYI-----
A0A2E6SYP1      -----------LNT--ENYRS---------S-KYKI-SYQIK--DKSVLNKLIQI-----
A0A2E5RLE8      -----------LNT--ENYHS---------N-PFSI-SYQLK--KREAVKSPIMV-----
A0A2E7TQF6      -----------LNT--ENYHS---------N-PFSI-SYQLK--KREAVKSPIMV-----
A0A2E6GVY9      -----------LNT--ENYQS---------N-PFSI-SYQLK--KRKAVNYPLMI-----
A0A350JJ90      -----------LNH--ERYLS---------S-DFEV-IYEIH--DPIILDRRIYI-----
A0A3M1CDV2      -----------KNH--ELYKN---------S-PYLA-DINIK--NENIYGKKIYV-----
A0A6C1QGZ7      -----------LNH--ELYRN---------S-PFTV-DIIVK--DPSIYGIPVYL-----
A0A4P5U6G4      -----------LVE--EKYKS---------S-PFEI-LPLVK--TNSIYDLPINF-----
A0A2E2TFD1      -----------LNY--ELYMS---------S-PYIV-DYDII--SAEAFAHKYYI-----
A0A2E4ELE6      -----------LTF--EHYKS---------C-PFEV-KFEIK--SPEAFGKDYYV-----
A0A522EYA6      -----------KEN--EHYGT---------T-VYTA-ETEVK--SDIIYGTKIYV-----
A0A2E3XZI5      -----------ISR--LLYKK---------N-TYKLENFYIK--DSSIISKKIYL-----
A0A6I7QXV0      -----------RVVHSELYRS---------S-PFTITIDEIK--DPAIYEREIYI-----
A0A2M7NLQ9      -----------WFNYFERFQD---------S-PFEVTEYEVY--DASFYNRHLDI-----
I4AFR0          -----------WFNYFERFQD---------S-PFEVTDYEVY--DNSFYNHPLNI-----
A0A2N2Y3E5      -----------LET--EQYRN---------S-PFTV-VFRNE--GFKHFDVPIAL-----
A0A2D9D7T6      -----------LTK--DLYRS---------N-LVSVEPVKLL--DSTLCGVHFDI-----
A0A1F3PPL5      -----------LSN--EMYKS---------S-PFEV-KVKIN--NGAIYDKKIYI-----
A0A357QK06      -----------LSN--EMYKS---------S-PFEV-KVKIN--NGAIYDKKIYI-----
A0A662AEA4      -----------QST--ELYRT---------S-PFIV-KTKIK--NPSIYNTPIFV-----
A0A0S2HYK8      -----------LSD--EIYQS---------S-PFEI-QYKIK--DSKAFGIPVFI-----
A0A2N5ZWN6      -----------LST--ETYNN---------S-SYSV-NYEIQ--NPSIYGEPIHI-----
A0A2E0FJ09      -----------LKH--EKYNG---------S-LFLVEDFQLL--NSSLVNVPIYV-----
A0A1F3FZ62      -----------LNF--DVYRN---------T-PFII-EQKVF--NPSIYGINFDI-----
A0A1F3K211      -----------LNF--DVYRN---------T-PFII-EQKVF--NPSIYGINFDI-----
A0A1V6I2U9      -----------LST--ELYGS---------T-PFEI-KYNII--NTEIYDQNIDL-----
A0A2H0B957      -----------LVS--ELYKA---------T-PFTV-DFHIT--KGNLYNIPIYV-----
A0A1F3CFW6      -----------LEN--ELYKA---------N-PFSI-DYKNT--KRNLYNVPIYV-----
A0A2M7E2T8      -----------LEN--ELYKA---------N-PFSI-DYKNT--KRNLYNVPIYV-----
A0A2M7NC69      -----------LEN--ELYKA---------N-PFSI-DYKNT--KRNLYNVPIYV-----
A0A1F3KLL5      -----------LST--ETYRT---------S-SYII-EVRNV--EPEMYNNQIYI-----
A0A359D1M1      -----------LST--ETYRT---------S-SYII-EVRNV--EPEMYNNQIYI-----
A0A0F2NS19      -----------LEY--ELYKN---------S-PFKV-FFEVK--DSSVLGKKFYL-----
A0A2A5H8X6      -----------LEY--ELYKN---------S-PFKV-FFEVK--DSSVLGKKFYI-----
A0A2H0GAU8      -----------LNN--ELYVG---------S-PMKV-NYAIK--DSSIVGIPFFI-----
A0A2M8FTK1      -----------LNN--ELYVG---------S-PMKV-NYAIK--DSSIVGIPFFI-----
A0A2A5B3B0      -----------LIN--ELYRS---------T-PIKV-SYVIK--DSTILGQSFFV-----
A0A5C6RXM7      -----------LEH--ELYKS---------A-PIDV-EFNIK--DSSIINHTFNV-----
A0A1F3C1M2      -----------LKN--ELYKN---------A-PFTI-EFNIK--NNIVYDIPIYI-----
A0A1F3DS87      -----------LKN--ELYKN---------E-PFSI-EFNIK--NNIIYDVPIYI-----
A0A6A0R6K9      -----------LTN--EIYSN---------N-PFDV-NILWK--DSTMGSRKVMI-----
A0A2E7CT70      -----------LTS--DLYKT---------S-PFEIKDLKIR--DSIIIGLPIYI-----
A0A2D5V560      -----------ITR--FLYNQ---------S-PXSFENFSIK--DMSIISKPIYL-----
A0A2D7K5A8      -----------LTR--FLYNQ---------S-PFIFENFSVK--DESILSKAIYL-----
A0A2E1XQ82      -----------LTR--FLYNQ---------S-PFIFENFSVK--DESIFSKPIYL-----
A0A5C8A5B4      -----------FL-KQEQYAY---------P-PFFVKLDSMAIQVID-------V-----
A0A4Y9ITE2      -----------FL-KKKLKYD---------NTPVEIVIPPMFSDTVSEPVIFKLT-----
A0A5M8NYX7      -----------LK-KNEL-YN---------QTPLWVILKNQIG-----------W-----
A0A3D5KRY6      -----------IG-KRDL-YK---------NDPLTLVLPSDFIQLENVPIHIKII-----
A0A0E3V905      -----------FG-KREI-YT---------DSPIELIVESGKPELYKKPLEVSML-----
A0A553ETH6      -----------VL-IDEK-YQ---------NSPFRVKFIVKDGNVYDKRIYVRLI-----
A0A640Q161      ------------------------------------------------------------
A0A640QU49      ------------------------------------------------------------
A0A1Q3PII2      -----------LK-TTEL-YE---------KTPYKITLLKPRT--AKPTTY---------
A0A351BXT2      ------------------------------------------------------------
A0A2K8Z965      -----------FS-KREL-YE---------DSPIELIIEQPISALYKSPLDITLP-----
A0A418M8U8      -----------FG-KREI-YK---------ASPVDVFVEFGKPELYEEPMLLTFI-----
I2GTA4          -----------FG-KREI-YK---------ASPVEVFIEFGKPELYEAPMLLTFI-----
A0A2K8ZAJ2      -----------TL-KKHI-YQ---------ESPIRLIVEKPTSQLYMEELKFLFV-----
A0A368JPA3      -----------FG-KREI-YE---------EAPIRIVLTDPTPNLYRADLEIGII-----
A0A5N1JI29      -----------FG-KREI-YE---------EAPIRIVLTDPTPNLYRADLEIGII-----
A0A3P1BT12      -----------FG-KREI-YD---------DAPLRIILKEPTANLYRADLEIGII-----
A0A3P1CI15      -----------FG-KREI-YE---------EAPIRLVLSDPTPNLYRADLEISII-----
A0A4R8CUK1      -----------FG-QREI-YD---------NTPVRLVLDSPTPNLYRADLHIGIL-----
A0A3D0MYJ7      -----------------------------------LDTLNTIKDIDKSLYP---------
A0A662AH13      -----------------------------------IDSFNVID--KPDSFY---------
A0A5C7QA01      -----------IF-KDNL-KS---------LHIKQFDLPEAYL--DQPLHL---------
A0A3D3LS70      -----------------------------------IDSFKNSD--SKTDFY---------
A0A1G1TM36      -----------FS-AQDL-YG---------KSPVQLTFLHTLR--GQHVLN---------
A0A1G7ZF38      -----------LK-TTEL-YD---------KTPYKVRFLKSRP--AKPESY---------
C6VS52          -----------LK-TTEL-YE---------KAPYRVRFIQKQP--PRPETY---------
A0A7C1LGX3      -----------LK-DKQVWDA-----------PFIVVKETSEELKKA-------Q-----
A0A2A4G4B1      -----------FK-NTELFLD---------K-PFKLEWLSPIN--DS-------Y-----
A0A0P7X1V8      -----------LY-----------------------------------------------
A0A6P1P355      -----------FR-AIPAYTS---------S-PIKIKLRNPEEARET-------E-----
A0A5C8KAD6      -----------FK-STNAYTS---------S-PIRIKLKNPEDIKQT-------V-----
A0A5N1J695      -----------FR-SIPAYAS---------S-PVIIKVKNPERISEV-------P-----
A0A3B0C2S4      -----------IK-TTEIWNP---------PFAITKLIAEDSIG-QP-------R-----
A0A3N2M1H3      -----------FH-PVTLYGH---------TLPYIVDMQGIEEQ-GG-------A-----
A0A4S2G8T2      -----------FH-PVTLYGH---------TLPYIVDMQGIEEQ-GG-------A-----
A0A212K7W5      -----------FR-NKPLYKN---------S-PVIVSIDSTNVN-ES-------F-----
F5IU11          -----------FR-NRSLYKN---------S-PVIVSTGPVNVN-ES-------F-----
A0A7C1QWC7      -----------YY-TVNIDKS---------HVQSINARFYIEAL-TD-------T-----
A0A352Z1R7      -----------DL-DFKLLDF---------SSTAKTPSYRIEMT-GA-------D-----
A0A3N2N6F7      -----------LR-PVSLYGD---------SMVLSVSLPDISVN-RG-------L-----
A0A4P7VVU7      -----------LK-NITLYGD---------SCPVSVDFLSIPSK-QS-------A-----
A0A2V1ILM4      -----------LK-NITLYGD---------SCPVSVNFLSIPSK-QS-------A-----
A0A3N2L0E8      -----------LK-NITLYGD---------SCPVSVDFLSIPSK-QS-------A-----
A0A3N2LFC5      -----------LK-NITLYGD---------SCPVSVDFLSIPSK-QS-------A-----
A0A0A2F501      -----------YY-KEVLYGQ---------ELPYRVKFLGLKDT-DN-------A-----
R5B7P0          -----------FH-RNVLYGT---------SLPISADLLDVDEN-VG-------V-----
R5B0L5          -----------FH-KDLLYGS---------SLPIDVDFSTLADG-ES-------G-----
A0A6I1TEC0      -----------FH-RNVLYGN---------DLPVTVQFLTIGEE-HY-------G-----
A0A3R5XWG1      -----------FH-RNVLYGN---------DLPVTVQFLTIGEE-HY-------G-----
A0A5P0Y910      -----------FH-RNVLYGN---------DLPVTVQFLTIGEE-HY-------G-----
A0A414YFM3      -----------FH-RNVLYGN---------DLPVTVQFLTIGEE-HY-------G-----
A0A6A7UIA7      -----------FH-RNVLYGN---------DLPVTVQFLTIGEE-HY-------G-----
A0A6A7VPS3      -----------FH-RNVLYGN---------DLPVTVQFLTIGEE-HY-------G-----
A0A374THP7      -----------FH-KEALYGG---------DLPVTVDFIGFTDD-QS-------G-----
A0A6G1VND1      -----------FH-KEALYGG---------DLPVTVDFIGFTDD-QS-------G-----
A0A0A2EVS5      -----------FH-RSTLYGS---------ELPIVVSIDRFYGA-LE-------W-----
A0A1T4NAJ7      -----------FH-RSTLYGS---------ELPIMVSIDRFYGA-LE-------W-----
A0A255T941      -----------LK-RVELYGT---------S-PVEVMMRKQSK--YP-------F-----
A0A3N2KCL3      -----------FH-DVVAYGS---------NLPVRVEMPGFAEN-GS-------A-----
A0A4P7VSV0      -----------FH-DVVAYGS---------NLPVRVEMPGFAEN-GS-------A-----
A0A2V1IJY1      -----------FH-DVVAYGS---------NLPVRVEMPGFAEN-GS-------A-----
A0A4P7VXK7      -----------FH-DVVAYGS---------NLPVRVEMPGFAEN-GS-------A-----
A0A1Y4CHN5      -----------FY-DRVLYGQ---------NLPVSVSFLDLNDN-ES-------A-----
A0A1M6I2S6      -----------LK-DVGLYKS---------N-PVAVSYRHQDE--TP-------V-----
A0A1Y3V692      -----------LK-DVGLYKS---------N-PVAVSYRHQDE--TP-------V-----
F3PXM2          -----------LR-RVELYRS---------A-PVAVRFCGKAE--RP-------V-----
A0A174AHH7      -----------LK-RIELYKS---------S-PILVTYLVDNK--KN-------V-----
A0A174JCE8      -----------LK-RIELYKS---------S-PILVTYLVDNK--KN-------V-----
A0A3E4JMC4      -----------LK-RIELYKS---------S-PILVTYLVDNK--KN-------V-----
A0A412SND6      -----------LK-RIELYKS---------S-PILVTYLVDNK--KN-------V-----
A0A414IEQ9      -----------LK-RIELYKS---------S-PILVTYLVDNK--KN-------V-----
A0A6I0U0V8      -----------LK-RIELYKS---------S-PILVTYLVDNK--KN-------V-----
A0A6L5S9H7      -----------LK-RIELYKS---------S-PILVTYLVDNK--KN-------V-----
A0A0M1W8D8      -----------LK-RIELYKS---------S-PILVTYLVDNK--KN-------V-----
A0A3R6GKX5      -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A7V4S1          -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
B0NU19          -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
D4V601          -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A0A4Q0U3M9      -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A0A4R4H1Q2      -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A0A6I0GII7      -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A0A6I0KYU7      -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A0A397WLT5      -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A0A6A2J529      -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A0A6L6P8N9      -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A0A6N8DDD8      -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A0A015XH67      -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A0A078RZN2      -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A0A4R4I3T9      -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A6L0K5          -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A7ACT5          -----------LK-RIELYKS---------S-PILVTYLFDNK--KS-------V-----
A6KY94          -----------LK-RIELYKS---------S-PILVTYLFDDK--KS-------V-----
A0A173UQR8      -----------LK-RIELYKS---------S-PILVTYLFDDK--KS-------V-----
A0A3R6HK75      -----------LK-RIELYKS---------S-PILVTYLFDDK--KS-------V-----
A0A412B7D1      -----------LK-RIELYKS---------S-PILVTYLFDDK--KS-------V-----
A0A412VNY9      -----------LK-RIELYKS---------S-PILVTYLFDDK--KS-------V-----
A0A414LTU9      -----------LK-RIELYKS---------S-PILVTYLFDDK--KS-------V-----
I9Q4U4          -----------LK-RIELYKS---------S-PILVTYLFDDK--KS-------V-----
A0A373ISF0      -----------LK-NVGLYKA---------N-PVAVTFGEVME--KP-------V-----
U6RF62          -----------LK-NVDLYKA---------N-PVAVTFGEVME--KP-------V-----
A0A662ZZD5      -----------LK-DVELYKS---------S-PLAVTYRHLDE--TP-------V-----
A0A3A5TI83      -----------LK-DVELYKS---------S-PLAVTYRHLDE--TP-------V-----
A0A415NEB6      -----------LK-DVELYKS---------S-PLAVTYRHLDE--TP-------V-----
A0A6I0I238      -----------LK-DVELYKS---------S-PLAVTYRHLDE--TP-------V-----
A7AJ60          -----------LK-DVELYKS---------S-PLAVTYRHLDE--TP-------V-----
A0A6A2JF01      -----------LK-DVELYKS---------S-PLAVTYRHLDE--TP-------V-----
A0A6I0Y2Y2      -----------LK-DVELYKS---------S-PLAVTYRHLDE--TP-------V-----
A0A6I2Q447      -----------LK-DVELYKS---------S-PLAVTYRHLDE--TP-------V-----
A0A395YYT3      -----------LK-DVELYKS---------S-PLAVTYRHLDE--TP-------V-----
A0A015UXN7      -----------LK-DVELYKS---------S-PLAVTYRHLDE--TP-------V-----
A0A5M5W148      -----------LK-DVELYKS---------S-PLAVTYRHLDE--TP-------V-----
A0A6I2NTL0      -----------LK-DVELYKS---------S-PLAVTYRHLDE--TP-------V-----
A0A016E4F9      -----------LR-TIGLYKC---------N-PIAVTYRHLDE--IP-------I-----
A0A4Q5CFJ7      -----------LR-TIGLYKC---------N-PIVITYRHLDE--TP-------V-----
A0A6N3HG44      -----------LR-TIGLYKC---------N-PIVITYRHLDE--TP-------V-----
A0A6H9P0U9      -----------LK-NVDLYKV---------S-PVTITFCDKIE--VP-------L-----
A0A108TH71      -----------LK-NVDLYKV---------S-PVTITFCDKIE--VP-------L-----
I8VXH0          -----------LK-NVDLYKV---------S-PVTITFCDKIE--VP-------L-----
A0A412S0N6      -----------LK-NVDLYKV---------S-PVTITFCDKIE--VP-------L-----
A0A412IIJ0      -----------LK-NVDLYKV---------S-PVTITFCDKIE--VP-------L-----
A0A0P0FM97      -----------LK-NVDLYKV---------S-PVTITFCDKTE--VP-------L-----
R6KTP3          -----------LK-NVDLYKV---------S-PVTITFCDKTE--VP-------L-----
A0A139LU87      -----------LK-NVDLYKV---------S-PVTITFCDKIE--VP-------L-----
A0A1C6B3Y5      -----------LK-NVDLYKV---------S-PVTITFCDKIE--VP-------L-----
A0A6L3KCD1      -----------LK-NVDLYKV---------S-PVTITFCDKIE--VP-------L-----
E2NMQ4          -----------LK-NVDLYKV---------S-PVTITFCDKIE--VP-------L-----
A0A412YDB9      -----------LK-KVDLYKA---------A-PFTVTFRDQPE--AP-------L-----
R7DY01          -----------LK-KVDLYKA---------A-PFTVTFRDQPE--AP-------L-----
A0A414LGK8      -----------LK-KVDLYKA---------A-PFTVTFRDQPE--AP-------L-----
A0A415IPQ4      -----------LK-SVDLYKG---------S-PVTITFCDKIE--VP-------L-----
A0A3E5BRW7      -----------LK-NVDLYQS---------T-PVTVTFFDKVE--TP-------L-----
K9DXS6          -----------LK-NVDLYQS---------T-PVTVTFFDKVE--TP-------L-----
A0A1M6KFV3      -----------LK-NVDLYKS---------A-PVAVTFLDKME--AP-------L-----
A0A1Q6G7L3      -----------LK-NVDLYKS---------A-PVAVTFLDKVE--AP-------L-----
A0A413H235      -----------LK-NVDLYKS---------A-PVAVTFLDKVE--AP-------L-----
A0A1M5B2J8      -----------FH-KNTIYGD---------QLPVAVTLTDFPDN-QS-------A-----
A0A255RCT5      -----------FH-KVTIYGD---------QLPVAVSFADFPDN-QS-------A-----
A0A1Y4GLF5      -----------FH-RVVAYGK---------NLPVTVTLCDLPED-ET-------G-----
A0A1H3XSC0      -----------FH-RQVAYGP---------TLPVNVSINGLSEN-ES-------V-----
A6LE40          -----------FH-RKVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A4Y1VPX5      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A6N2XMM4      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
B3JI46          -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A358R8U0      -----------FQ-DRVAYGA---------SLPLTVSLPELTEN-ES-------A-----
R6WSB6          -----------FQ-DRVAYGA---------SLPLTVSLPELTEN-ES-------A-----
A0A401LPX7      -----------FH-KQTVYGN---------QLPVHVVIPNLSEN-ES-------A-----
A0A6G0GNY9      -----------FH-KQTVYGN---------RLPVQVVIPTLSEN-ES-------A-----
A0A6I1BFM0      -----------FH-KQTVYGN---------RLPVQVVIPTLSEN-ES-------A-----
A0A3A5Z900      -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
A0A285TGL6      -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
A0A3A5RFX4      -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
A0A1Q6IUW9      -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
A0A413XDP6      -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
A0A6N8CVT6      -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
K6AP24          -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
A0A6I2NHV3      -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
A0A662ZYI7      -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
A0A078RYI7      -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
C7XEQ8          -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
D7INX6          -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
K5ZG55          -----------FH-KQTVYGN---------QLPVQVVIPNLSEN-ES-------A-----
A0A3N2N9B8      -----------FH-DEVAYGT---------TLPIELSIVNAPAD-AS-------A-----
A0A3N2NMI0      -----------FH-NIVAYGT---------GLPIQLEIVNFPTD-AS-------A-----
A0A359I8H7      -----------FH-EKTLYGS---------NLPVNVKFHDLEEQ-QC-------A-----
A0A3N2KA63      -----------FH-EKTLYGS---------NLPVNVKFHDLEEQ-QC-------A-----
A0A4Q0IMT7      -----------FH-EKTLYGS---------NLPVNVKFHDLEEQ-QC-------A-----
A0A3B9FAU3      -----------WH-KNILYGR---------SLPANVRMMGLGDH-ES-------A-----
A0A3C1E5L7      -----------WH-KNILYGR---------SLPANVRMMGLGDH-ES-------A-----
A0A4Q0UAV1      -----------LH-NKLLYNN---------SPVTAVNMAPEDKK-LK-------G-----
A0A354SN68      -----------LK-EITLYGK---------NLPIKVSFLEATSM-DN-------L-----
A0A6L5XFL0      -----------FH-DNILYGR---------TLPVNVLLPDAGEE-QS-------V-----
A0A3N2N595      -----------FH-KEIAYGY---------TLPICAELIDFSAY-GT-------L-----
A0A0A2DUD9      -----------FH-DHLLYGT---------NLPLNLRFTDLSEQ-ES-------A-----
A0A3P1ZBJ5      -----------FH-DITLYGR---------TLPFQVRFLSLNEE-QG-------A-----
R5FHS9          -----------FY-KGVLYGQ---------NMPYTVSMPDVQDE-DV-------V-----
A0A413TW79      -----------FH-PVALYGR---------TLPVTVHFYSLNDM-QS-------A-----
A0A3E5E9M7      -----------FH-PVALYGR---------TLPVTVHFYSLNDM-QS-------A-----
A0A3E4SK73      -----------FH-PVALYGR---------TLPVTVHFYSLNDM-QS-------A-----
A0A415GGC6      -----------FH-PVALYGR---------TLPVTVHFYSLNDM-QS-------A-----
A0A413DBH9      -----------FH-PVALYGR---------TLPVTVHFYSLNDM-QS-------A-----
A0A1Y4PQK7      -----------FH-DRLLYGM---------ALPFQANITGLQEN-ES-------V-----
A0A1Y4IH41      -----------FH-DRLLYGM---------TLPFQANIAGIQEN-DF-------A-----
A0A3A6AAP4      -----------FH-DRLLYGM---------TLPFQANIAGIQEN-DF-------A-----
A0A6I0ZRD2      -----------FH-DRLLYGM---------TLPFQANIAGIQEN-DF-------A-----
A0A1Y4DYA7      -----------FY-NHILYGQ---------NCPYEVEFFDLQDN-DV-------A-----
A0A1Y3X4I9      -----------FY-KQVLYGQ---------ACPYEVEFFDLLDN-EG-------A-----
A0A1Y4FNK8      -----------FY-KKVLYGG---------TCPYSVSFNDLQDN-ES-------V-----
A0A355FD59      -----------FH-RKTLYGS---------ELPVRVVFTDLTDK-EN-------A-----
A0A359CEZ9      -----------FH-RKTLYGS---------ELPVRVVFADLTDK-EN-------A-----
A0A353Q7B4      -----------FH-RKTLYGS---------ELPVRVVFTDLTDK-EN-------A-----
F8X3A5          -----------FY-KKVLYGP---------DLPITVSFTDLADN-ES-------A-----
A0A1M3KVR9      -----------FY-KKVLYGP---------DLPITVSFADLADN-ES-------V-----
A0A4Y9IJS3      -----------FY-KKVLYGP---------DLPITVSFADLADN-ES-------A-----
A0A495WI87      -----------FY-REVLYGR---------TLPINVSIDTPNDN-ES-------S-----
A0A354M4S6      -----------FY-REVLYGR---------TLPINVSIDTPNDN-ES-------S-----
R7DH52          -----------FY-REVLYGR---------TLPINVSIDTPNDN-ES-------S-----
A0A4Q5E7L5      -----------FH-QQVAYGL---------TLPVNVTMSDLSEN-ES-------A-----
A0A4P8LP09      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A4R4GZU7      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A016CWA4      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A1C6H117      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A0M1W0V2      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A139KA16      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A174VQ92      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A1Q6HCG0      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A1Y4JYM9      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A3A5QW67      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A3A5RQE6      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A3A6BP07      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A3E5E153      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A3Q9IP20      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A412WV15      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A413ICP6      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A414KYB9      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A5B3FWR2      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A6L4P3V7      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
E5WX00          -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
K0X3P3          -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A415TAH7      -----------FH-RQVAYGL---------TLPVDVTISDFPEN-ES-------A-----
A0A078T2W6      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A6I1AQV4      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A5C6L2P1      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A412MJT7      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3E4WKT5      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3A5YY33      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A078TAH2      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A1E9CFZ7      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A373FYU5      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3A5TZ72      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3A5XBP2      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3A6MEG9      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3E4JP35      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3E4KP40      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3E4NX82      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3E4XFU8      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A412RG70      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A412TD37      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A413GAA4      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A414M7I4      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A496BTA0      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A496D2V6      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A4Q5G1P5      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A5C6KCA6      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A5M5AHM5      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A6I0KZV6      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A6I0Y5K7      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A6I1BFB8      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A6I2P5W5      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A6N8DC51      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
E5UZA2          -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A069SMG6      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A6A2RTB3      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A6I0VY00      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A1M4YZ07      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A0P0FQW1      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A5M5C0W6      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A6I0H151      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A642LZ22      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A6I0HI59      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A642NJ89      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A6I0HI52      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A6L3JTQ2      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A6L4EED9      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A6I0YVB5      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A6L5RHE2      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A6N3AEV2      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A6L3KG29      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A6G0G4T5      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A6I0HFG9      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A4Q5E5M7      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
A0A6L4F5W0      -----------FH-RQVAYGL---------TLPVDVTISDLPEN-ES-------A-----
C3RFN5          -----------FH-RKVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3A5Z014      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A6I0ING7      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A6L5S265      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A078S3Q8      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A069SJV7      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3E5DXI5      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3E5EM98      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3E5F453      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A6N2YYD4      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
I9T3G6          -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A3E4SYU0      -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A6LGY1          -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
K5ZSH4          -----------FH-RQVAYGL---------TLPVDVTINDLPEN-ES-------A-----
A0A1H4ADG3      -----------FR-SKPLYKK---------SLPFTTSITGFSTDNLD----PSQL-----
A0A5B8VUR8      -----------FK-SEPLYKE---------SLPFKISIEGFTTDNLD----PKQL-----
A0A0D3L8Q3      -----------IK-DPELYGN---------KLPFRVVTNKLDSLAYG-------K-----
A0A2N3U785      -----------IK-TEEIYGS---------SLPIKVVVSDLKQPAFG-------K-----
A0A5B6TJH8      -----------FQ-DIEIYGK---------ELPIKLVVESLHNSGYN-------K-----
A0A519U664      -----------VV-DKEIYGQ---------SVPIKVLRSNVDSTAAG-------K-----
A0A519MA34      -----------II-DKEIYGQ---------SVPIKVLRNNVDSTAAG-------K-----
A0A519UCX0      -----------AI-DKEIYGQ---------SVPIKVLRNNMDSTAAG-------K-----
A0A0E3ZG78      -----------VN-DIEIYGS---------EVPIKVLVNDLAPPAYR-------K-----
A0A1I6BRK6      -----------IT-DREIYGE---------ALPFRIVRNGLDSTMTG-------K-----
A0A243WAB1      -----------FV-NREIYGR---------ELPAKLLIDKLDSTAIG-------K-----
A0A6G8C8X6      -----------VK-DREIYGR---------ALPIKVLLNGLDSTAAG-------Q-----
A0A416GA42      -----------WR-PTDLYGV---------S-PVTVHFVQGDD--LA-------C-----
A0A1T3IYP5      -----------LR-DYELYKK---------S-PVHVKIEGKTQE-SS-------Y-----
A0A1T5K9D4      -----------LR-NIELYRN---------A-PIRIFFSREDNPIGY-------F-----
A0A077ENE7      -----------LR-DYELYKK---------S-PVQVKVEGISSE-GS-------Y-----
A0A6I5UW06      -----------LR-DYELYKK---------S-PVQVKVEGISSE-GS-------Y-----
T0NN57          -----------LR-EYELYKK---------S-PIYAKVLGKRAE-DS-------Y-----
X5K347          -----------LR-EYELYKK---------S-PIYAKVLGKRAE-DS-------Y-----
A0A060RD97      -----------FR-KLDIYGE---------ETPIVVKNVAESEQ-SNNP-----V-----
A0A3C1ITV0      -----------IGYVTDWYDK---------T-PICVEYKNLPDH-VGEQPLNS-V-----
R7HN19          -----------IGYVTDWYDK---------T-PICVEYKNLPDH-VGEQPLNS-V-----
A0A350IHV0      -----------LR-SRELFTS---------S-PIALVQTGDNHA-SA-------Y-----
R5RVP0          -----------LR-SREKFTD---------S-PIALVLAGDNNA-SA-------F-----
R6A0L2          -----------LH-SITLYGK---------ELPFQVLFQKQYKG-KRG------Q-----
R7LG80          -----------LH-KVALYKN---------ERPIEVLFHDSLPS-ENPIPKNMIV-----
A0A2L2WX98      -----------LH-EVSLYRN---------R-PFRIEFSSECQR-PE-------------
A0A6N8KXI9      -----------LR-QVELYKD---------A-PVLIHLIHNNSY-EG-------F-----
G5GD56          -----------LH-SVALYTD---------R-PFEIAFQQKAE--NL-------V-----
R5KD55          -----------FY-DKTLYGK---------TLPVKVVFRDIPKD-ET-------A-----
A0A174QNT3      -----------LR-HDHIFGE---------L-PFEINFLDNYP--GY-------T-----
A0A4S2FGS1      -----------LR-HDNLFGD---------L-PFEVRFLDICP--GF-------T-----
R9I0H0          -----------LR-RDNLFGD---------L-PFEVRFLDIYP--GF-------T-----
K5BUT9          -----------LR-DTPLYAE---------S-PVDVHFIDPYN--QP-------V-----
A0A174FPA3      -----------LR-DAPLYAE---------S-PVEVHFIDPYN--QP-------V-----
R6S9Y6          -----------LR-DAPLYAE---------S-PVEVHFIDPYN--QP-------V-----
A0A642LIH6      -----------LR-DAPLYAE---------S-PVEVHFIDPYN--QP-------V-----
C9KX15          -----------LR-DAPLYAE---------S-PVEVHFIDPYN--QP-------V-----
A0A6H0KRK1      -----------FR-NTSLYAE---------S-PVEVNFIDPYH--AY-------Y-----
R6DAG6          -----------FR-NTSLYAE---------S-PVEVNFIDPYH--DY-------Y-----
A0A3L8AAP1      -----------FR-NTSLYAE---------S-PVEVNFIDPYH--AY-------Y-----
A0A4S2AYX2      -----------FR-NTSLYAE---------S-PVEVNFIDPYH--AY-------Y-----
A0A4Y9H477      -----------FR-NTSLYAE---------S-PVEVNFIDPYH--AY-------Y-----
A0A0E2M2Y7      -----------WR-HESLYGK---------S-PVSIRITDRDST-ES-------Y-----
A0A0K2J6Z0      -----------WR-HESLYGK---------S-PVSIRITDRDST-ES-------Y-----
B2RKZ8          -----------WR-HESLYGK---------S-PVSIRITDRDST-ES-------Y-----
A0A212GC82      -----------WR-HESLYGK---------S-PVSIRITDRDST-ES-------Y-----
A0A254MU12      -----------WR-HESLYGK---------S-PVSIRITDRDST-ES-------Y-----
R6CQ93          -----------LR-MNELYNL---------S-PVQVSFFNVLPE-RY-------F-----
A0A3D1NQW3      -----------LR-PQDLYGQ---------S-PIAVEFINDNDR-QG-------F-----
B0MT10          -----------LR-PQDLYGQ---------S-PIAVEFINDNDR-QG-------F-----
R7JGW9          -----------LR-PQDLYGQ---------S-PIAVEFINDNDR-QG-------F-----
A0A3D2BF46      -----------LR-TENLYRR---------S-PIDVTFIDDNER-QA-------L-----
A0A358R538      -----------LR-ARDLYGQ---------S-PLRVRFIDETED-LS-------A-----
A0A1Y4AAB8      -----------LR-TQDLYGR---------S-PIEADFVDEGEN-QS-------F-----
A0A1Y3WWY9      -----------LR-DRDLYGQ---------S-PIDVDFINGDDN-QS-------L-----
A0A1Y4U5L4      -----------LR-DRDLYGQ---------S-PIDVDFINGDDN-QT-------L-----
A0A1Y3VCJ1      -----------FQ-DRDLYGQ---------S-PVEVVFVNDNDN-LT-------L-----
A0A1Y3QTW7      -----------LR-TLDLYGR---------S-PIEVDFIDDDN--QR-------L-----
R6XWY7          -----------LR-TLDLYGR---------S-PIEVDFIDDDN--QR-------L-----
A0A4Y1X9Y9      -----------LR-TLDLYGR---------S-PIEVDFIDDDN--QR-------L-----
A0A4Y1WM66      -----------LR-TLDLYGR---------S-PIEVDFIDDDN--QR-------L-----
A0A6N4GYT3      -----------LR-TLDLYGR---------S-PIEVDFIDDDN--QR-------L-----
A0A174AVF1      -----------LR-TLDLYGR---------S-PIEVDFIDDDN--QR-------L-----
A0A656Q4F4      -----------LR-TLDLYGR---------S-PIEVDFIDDDN--QR-------L-----
A0A1Q6EIY0      -----------LR-TADLYGR---------S-PIEVDFINDNSK-QK-------L-----
A0A5B5VN71      -----------LR-TADLYGR---------S-PIEVDFINDNSK-QK-------L-----
E4M8L3          -----------LR-TADLYGR---------S-PIEVDFINDNSK-QK-------L-----
I3YQ50          -----------LR-TADLYGR---------S-PIEVDFINDNSK-QK-------L-----
R5UEY8          -----------LR-TADLYGR---------S-PIEVDFINDNSK-QK-------L-----
A0A1H4D866      -----------LR-RRDLYAQ---------S-PVEVTFVNDSDN-QS-------L-----
A0A5B3G4Y7      -----------LR-RRDLYGQ---------A-PIDVKFINDNDN-QS-------L-----
A0A374A9J5      -----------LR-RRDLYGQ---------A-PIDVKFINDNDN-QS-------L-----
A0A5B3GQN5      -----------LR-RRDLYGQ---------A-PIDVKFINDNDN-QS-------L-----
A0A1Q6E9S3      -----------LR-RRDLYGQ---------A-PIDVKFINDNDN-QS-------L-----
D4IJ36          -----------LR-RRDLYGQ---------A-PIDVKFINDNDN-QS-------L-----
A0A414Q925      -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
A0A415PUS9      -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
A0A108TCU0      -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
A0A413BA42      -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
S3Y344          -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
A0A4Q5G8Y8      -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
A0A412TGL3      -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
A0A413VJ33      -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
A0A414L0W6      -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
A0A412DP39      -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
A0A413ZSE8      -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
B0NP84          -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
R6AK43          -----------LR-KKELYTS---------T-PFAVTFLDATPS-QQ-------I-----
A0A412N2D9      -----------LR-KKELYTS---------T-PFTVNFLDADPA-QK-------I-----
A0A1Y4JYS9      -----------LR-KKELYTS---------T-PFTVNFLDADPA-QK-------I-----
R6LHA4          -----------LR-KKELYTS---------T-PFTVNFLDADPA-QK-------I-----
A0A3E5HPT8      -----------LR-PRELYTD---------S-PVRVAFLEAGLD-EV-------C-----
C6IJ48          -----------LR-PRELYTD---------S-PVRVAFLEAGLD-EV-------C-----
Q8A3U2          -----------LR-PRELYTD---------S-PVRVAFLEAGLD-EV-------C-----
A0A3R6S1H6      -----------LR-EIELYKE---------S-PVVLRFPDAEET-SS-------L-----
A0A3R6SD81      -----------LR-ELELYKE---------S-PVVLRFPDAEET-SS-------L-----
A0A354WXN6      -----------LR-TVDLYTQ---------S-PINLTFPEAEGE-QV-------F-----
R5IP14          -----------LR-DRSLYKD---------S-PLAVSFITKDNN-SQ-------F-----
A0A316SZX7      -----------LQ-TIDLYRN---------T-PIEVSFVDDDDK-SY-------S-----
A0A1Y4AIY1      -----------LR-TVELYRQ---------S-PVILSFPDASET-QS-------F-----
A0A0J6CIR2      -----------LR-TEELYTQ---------S-PIAVRFPEAEAS-QS-------F-----
A0A3D8HG59      -----------LR-TTELYTQ---------S-PVHLEFPDAEPN-QQ-------F-----
A0A3R6S408      -----------LR-TTELYTQ---------S-PVHLEFPDAEPN-QQ-------F-----
F3ZRU7          -----------LR-KKDLYGN---------N-PFEVVFLEASTE-QP-------I-----
A0A1C5Q1F3      -----------FR-DWDLYTT---------S-PVTLTFPEALET-SS-------F-----
R7A239          -----------FR-DWDLYTT---------S-PVTLTFPEALET-SS-------F-----
A0A3R6HIK7      -----------LR-MVELYTH---------S-PVVLSFPETEES-QS-------F-----
K5ZVW7          -----------LR-TVELYTH---------S-PVVLSFPETEES-QS-------F-----
A0A1Y4D5Z0      -----------LR-TVELYRE---------S-PVVLSFPEAGEG-QS-------F-----
A0A413VXJ7      -----------LR-NKELYTH---------S-PIILSFPEAEER-QS-------I-----
I9RSN9          -----------LR-NKELYTH---------S-PIILSFPEAEER-QS-------I-----
U6RJK5          -----------LR-NKELYTH---------S-PIILSFPEAEER-QS-------I-----
A0A1Q6GA32      -----------LR-NKELYTH---------S-PIILSFPEAEER-QS-------I-----
I9RPU6          -----------LR-NDELYTH---------A-PVTVSFPEAEER-QV-------I-----
I8YFS5          -----------LR-EDELYTH---------S-PITVLFPESEER-QV-------I-----
A0A6L3FCC6      -----------LR-EDELYTH---------S-PITVLFPESEER-QV-------I-----
I8Y597          -----------LR-EDELYTH---------S-PITVLFPESEER-QV-------I-----
A0A1Q6GBF5      -----------LR-EDELYTH---------T-PVTVSFPEAEER-QV-------I-----
I8YFZ3          -----------LR-NDELYTH---------A-PVTVSFPEAEER-QV-------I-----
A0A1Q6GDH2      -----------LR-NDELYTH---------A-PVTVSFPEAEER-QI-------I-----
U6RSB0          -----------LR-NDELYTH---------A-PVTVSFPEAEER-QV-------I-----
I9SIK1          -----------LR-NDELYTH---------A-PVTVSFPEAEER-QV-------I-----
I9GXM2          -----------LR-NDELYTH---------A-PVTVSFPEAEER-QI-------I-----
I9TP59          -----------LR-NDELYTH---------A-PVTVSFPEAEER-QV-------I-----
R5S343          -----------LC-TVDLYGI---------S-PIRVRFLDRGED-EA-------A-----
A0A1M6K7I9      -----------LR-TIELYTQ---------S-PIKVAFPDAEDN-QY-------I-----
A0A5M6A8C8      -----------LR-TIELYTQ---------S-PIKVAFLDAEDN-QY-------I-----
A0A6L3FBE6      -----------LR-DDELYTH---------S-PITVSFPESEER-QV-------I-----
A0A6L3FNG1      -----------LR-EDELYTH---------S-PIVVVFPESEER-QV-------I-----
A0A3R5ZMK1      -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A6L6NFJ9      -----------LR-TVELYTQ---------S-PVLLSFPDAEEA-QA-------F-----
A0A1Y3ZIA4      -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
K5Y1A4          -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A4Q5CIT0      -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A6L6NWL9      -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A3R6K8X4      -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A6N8D6C8      -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A3R6BKI7      -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A6N8CW60      -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A412M2W1      -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
K5ZX55          -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A415BDM7      -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A6L6MX19      -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A1Q6I3T6      -----------LR-MVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A414XX40      -----------LR-MVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A7AEU7          -----------LR-TVELYTQ---------S-PVQLSFPDAEEA-QA-------F-----
A0A5F0U645      -----------LR-TVELYSH---------S-PVVVRFPEANEN-LE-------F-----
K5ZBN2          -----------LR-TVELYSH---------S-PVVVRFPEANEN-LE-------F-----
A0A0J6CKW3      -----------LR-TVELYSH---------S-PVVVRFPEANEN-LE-------F-----
A0A0F5IQM7      -----------LR-TVELYSH---------S-PVVVRFPEANES-LE-------F-----
A0A496CDT3      -----------LR-TVELYSH---------S-PVVVRFPEANEN-LE-------F-----
A0A6G1ZKM3      -----------LR-TVELYSH---------S-PVVVRFPEANEN-LE-------F-----
S0GLB0          -----------LR-TVELYSH---------S-PVVVRFPEANEN-LE-------F-----
A0A3R6NLC1      -----------LR-TVELYSH---------S-PVVVRFPEINEN-LE-------I-----
A0A416WYC9      -----------LR-TVELYSH---------S-PVVVRFPEINEN-LE-------I-----
A0A0F5IT40      -----------LR-TEELYTQ---------S-PIAVRFPEAEAS-QS-------F-----
A0A496CX20      -----------LR-TEELYTQ---------S-PIAVRFPEAEAS-QS-------F-----
A0A5F0UBI0      -----------LR-TEELYTQ---------S-PIAVRFPEAEAS-QS-------F-----
A0A6G1ZHG0      -----------LR-TEELYTQ---------S-PIAVRFPEAEAS-QS-------F-----
S0GSI7          -----------LR-TEELYTQ---------S-PIAVRFPEAEAS-QS-------F-----
K5YB65          -----------LR-TEELYTQ---------S-PIAVRFPEAEAS-QS-------F-----
A0A0F5IWP9      -----------LR-TVELYTQ---------S-PIAVQFPEAEAT-QA-------F-----
A0A0F5IZT8      -----------LR-TVELYTQ---------S-PIAVQFPEAEAT-QA-------F-----
A0A417LKQ2      -----------LR-TVELYTQ---------S-PVAVQFPETEAV-QA-------F-----
A0A416TME1      -----------LR-TVELYTQ---------S-PVAVQFPEAEAT-QA-------F-----
A0A416XPE8      -----------LR-TVELYTQ---------S-PVAVQFPEAEAT-QA-------F-----
L8JI02          -----------FR-AEEKYGD---------F-PFIVELDSTISQMIDVPVYIEPL-----
A0A4Q5WS95      -----------FG-DRSAYTS---------S-PVVITAF-------------NLD-----
A0A501VZX6      -----------FK-TTSAYIT---------S-PVQIEVK-------------HPE-----
A0A399SH26      -----------FK-EVAAYTS---------S-PVIVTHY-------------NPD-----
A0A501W1A9      -----------FR-TVSAYTS---------S-PIKVILK-------------SFD-----
A0A0E3ZGV6      -----------LR-SVPAYTS---------S-PITITLK-------------DPE-----
A0A1I2N4S1      -----------FK-SIPAYNT---------S-PITISLK-------------SPE-----
A0A2T5YE44      -----------FK-SIPAYTT---------S-PITISLK-------------SPE-----
A0A1M5BA90      -----------IV-SRSAYTS---------S-PVTIELE-------------YPN-----
A0A512B879      -----------IA-SYSAFTS---------S-PVTVELA-------------DPD-----
A0A559PPI3      -----------IK-SVSAYNS---------S-PIQIKLK-------------NPD-----
A0A1T5CS78      -----------IK-AISAYTS---------S-PIKVIVK-------------EPN-----
A0A0Q9Z8F1      -----------IK-TISAYTS---------S-PIKVIVE-------------DPN-----
A0A2N0U0M7      -----------IK-TISAYTS---------S-PIRVIVQ-------------DPN-----
A0A1V9FHD0      -----------MH-ATSAYLS---------S-PITIVAQ-------------DPD-----
A0A4V4H170      -----------IH-ATSAYTS---------S-PITITAR-------------KPD-----
A0A1V9F098      -----------IK-PTSAYNS---------S-PVTIIAR-------------KPD-----
A0A4R2VU64      -----------LK-ATSAYTS---------S-PITIMAR-------------KPD-----
A0A4S8HY23      -----------IN-VTSAYTS---------S-PITITAR-------------KPD-----
A0A1V9F383      -----------FN-ETSAYVS---------S-PVSIVAK-------------DPD-----
G8TRZ6          -----------FN-ETSAYIS---------S-PVSIVAR-------------NPD-----
A0A4R5DL69      -----------IK-TAEIYDK---------S-PVILHLI-------------DPK-----
A0A1M4YED3      -----------WG-LRSAYNT---------S-PVKVIAQ-------------NPA-----
A0A2H3NSN0      ------------------------------------------------------------
A0A2P6C324      ------------------------------------------------------------
A0A7C2DZI7      ------------------------------------------------------------
A0A1M6XHU0      ------------------------------------------------------------
G2SF81          ------------------------------------------------------------
A0A5S9EYW1      ------------------------------------------------------------
D0MHQ9          ------------------------------------------------------------
A0A126PFG0      -----------LG-ARDLYGR---------S-PVQFTLV-------------PTH-----
A0A3M1N7Z3      -----------VG--RSLVFP---------H-PFQISF----------------------
                                                                            

A0A1T5MMH4      --------------------EKE---SPET---------FSL-VW-----------GEGT
A0A2W4R1L8      --------------------DLG---STEA---------VRL-RI-----------NQDG
A0A2E5CV79      ------------------------------------------------------------
A0A2D4ZVH1      ------------------------------------------------------------
A0A0K8QSK7      --------------------TFA---GDGK---------IRY-QA-----------EGEN
A0A1V6CN82      --------------------SVH---PDRS---------ITL-SG-----------FGEG
A0A1M4XZ45      --------------------TIQ---PDGK---------LRV-EM-----------DQED
A0A399D319      --------------------TIE---PNGK---------LKI-DM-----------EEEV
A0A1V5IPN7      ------------------------------------------------------------
A0A1M6GR99      --------------------ILN---SDGS---------YAL-KV-----------EKQD
A6EBM4          --------------------DPI---DHEK---------FTL-TW-----------TIGK
A0A7C5M4P4      --------------------TIL---DKER---------YLL-AY-----------SLDE
A0A1M6TTV4      --------------------EFV---GDNH---------FYL-SL-----------DHDQ
A0A4Q8RX32      --------------------EVL---SASE---------FVL-SA-----------KNEE
K0X1U5          --------------------KVQTGGSDDK---------IKVLLK-----------KG--
R5EXK3          --------------------KVQTGDSDDK---------IKVLLK-----------KG--
A0A401UAP7      --------------------DKK---SEAQ---------FEI-TL-----------SDGE
A0A1W2GF52      --------------------EIL---NETD---------FYI-SS-----------EYLG
A0A2G5L7B8      --------------------EIL---SDDH---------FVM-DF-----------ELHG
A0A523GAC0      --------------------AIS---NEDE---------FIL-GY-----------PDHT
L8JW09          --------------------NIV---DEKT---------YTI-NF-----------SGDE
A0A364XUP5      --------------------TET---DGNS---------FSI-KV-----------GESQ
A0A1M5RLA9      --------------------DDS---GSDE---------FTL-QV-----------GDEG
A0A385SFR9      --------------------DDT---GNDE---------FTL-QV-----------GDEG
A0A5M4A9J4      --------------------EFDAQPHSGR---------FIL-NV-----------TGEK
A0A5M4B1C7      --------------------EFTVDDKGHT---------SEL-KV-----------KGEK
A0A0D3LFR6      --------------------NIH---DLQE---------YTL-SY-----------FQGE
M7N6D4          --------------------RIH---NSEE---------YTL-SY-----------QLGD
A0A4D7K1D4      --------------------HIS---SKEH---------YTL-TY-----------ELGE
A0A5C7MX19      --------------------NII---DEEK---------FSI-NH-----------IYKD
A0A1Q3ZMZ7      --------------------------ILQD---------ENLIRY-----------QSKG
A0A2D8JJW3      TLIENISETIQIKNEKNALNNLSLHSDNTV---------FDLSGV-----------VIPD
A0A2W2AFF7      --------------------SVKI--NGDN---------IAL-KC-----------SGKK
R7PCR1          --------------------------DENS---------FELKNL-----------QFED
A0A1G9E2A9      --------------------EVL---NERE---------YRL-KY-----------ELNG
A0A098LL25      --------------------TFL---DKDK---------FLL-SY-----------KKND
A0A6J4H627      --------------------TIQ---DNSE---------FVL-AY-----------TEDG
A0A6C0GJI1      --------------------QLL---NNSQ---------YEL-TY-----------KQGS
A0A2T2YJE8      --------------------TLL---DATR---------FNL-SY-----------LEGD
A0A127B287      --------------------TFD---SRTR---------YTV-QI-----------GEDG
A0A6P1P2P6      --------------------NFE---SRTT---------YTT-QI-----------GEEG
A0A3M9N829      --------------------AFS---SPSR---------YEV-YV-----------GEEG
A0A0P0CSF9      --------------------KFT---SPSR---------FDL-YV-----------GENG
A0A5M8QQB8      --------------------KFQ---SPSR---------FDL-YV-----------GETG
A0A3M9MNC3      --------------------HFN---SPSK---------FDI-YI-----------GKEG
A0A5B6TAX2      --------------------KFE---SPSK---------FDV-YV-----------GEEG
A0A5N1IQ33      --------------------NFL---DANR---------FRL-TY-----------LLNG
A0A512AYT3      --------------------NFL---DENR---------FTL-SY-----------QVGE
A0A5M6CYN7      --------------------DFL---DANR---------FRL-SY-----------LVGE
A0A369QP10      --------------------SIL---DATR---------YNL-SY-----------VQGD
A0A126PDF2      --------------------AFT---SPTR---------YSI-SY-----------SGPG
A0A2Z3GKA1      --------------------EFT---SPTR---------YSI-SY-----------SGPG
A0A502GZP7      --------------------VFV---SPTR---------YSI-DY-----------SGTA
A0A519SBU8      --------------------SFP---APNQ---------YVV-SV-----------KSGA
A0A4Q3JNZ3      --------------------NFL---DSNR---------YTV-SV-----------KAHN
A0A519Q9V3      --------------------NFL---TPSK---------YEV-SV-----------KVHS
A0A0M3RW20      --------------------QFL---NKDK---------FIL-SY-----------ALRG
A0A495VFX4      --------------------QFL---SDEK---------FIL-SF-----------NLKN
A0A1S9B3W0      --------------------KLL---DAQR---------FKL-SY-----------PAGA
A0A1W1VRL3      --------------------NFS---SPTQ---------FRL-SY-----------LEGE
A0A1M6R305      --------------------VFT---SPQK---------FRI-SY-----------LQGG
A0A4Z0PHK3      --------------------TFT---GPQQ---------FRL-SY-----------LYQG
A0A2M9B9H9      --------------------NFT---GGKQ---------FRL-SY-----------LYLG
A0A4Z0QCY9      --------------------NFT---GPQQ---------FRL-SY-----------LYQG
A0A418R9X5      --------------------QLL---ENDR---------FSL-QL-----------PNG-
A0A428JSJ3      --------------------ELL---DNDQ---------FKL-HL-----------PGN-
A0A428KI59      --------------------QLL---ENDR---------FRL-QL-----------PGG-
W8F1I6          --------------------QLL---ENDR---------FRL-QL-----------PNG-
A0A246FQC0      --------------------NLL---SATT---------FQL-IL-----------PDGL
A0A372E5P8      --------------------RFL---SPTT---------FEL-IL-----------PEDL
A0A1H3EMW1      --------------------RFL---SPTT---------FEL-TL-----------PEQL
A0A1H9ZSN3      --------------------RFL---SPTT---------FEL-TL-----------PEEL
A0A5N1J2M4      --------------------EFL---NKDR---------FRL-TY-----------TLGN
A0A519S476      --------------------SFP---TPDT---------YQI-SV-----------KAHG
A0A4Q3JRW8      --------------------NFL---PSNR---------YQI-SV-----------KVRN
A0A519M923      --------------------SFP---TVSQ---------YQV-SV-----------KAHN
A0A4Z0ENW1      --------------------EYI---DTKH---------YRL-SI-----------TTAN
A0A519UDB4      --------------------EYI---DAKT---------YRL-SV-----------NVGS
A0A3S0QKV1      --------------------RLL---EGKR---------FRL-SY-----------LMGQ
A0A328BL48      --------------------EVL---DQNR---------FRL-SY-----------AQGQ
A0A5R8WLY4      --------------------EIL---DQNR---------FRL-SY-----------AQGQ
A0A1I5WSL8      --------------------RFI---NKQR---------FIL-EF-----------MGQG
A0A0U3JVM7      --------------------KFV---GPQR---------FAL-EF-----------TGQG
A0A1G1SSV2      --------------------RFT---GPSR---------FKL-DF-----------VAQG
A0A1G1SXV7      --------------------RFT---APGR---------FRL-EF-----------VGQG
A0A6G8CBJ6      --------------------SFI---SPTQ---------FRL-SY-----------LEDK
A0A0W8EDI5      --------------------VFS---DAKR---------FSL-VS-----------KAES
A0A3B7RBP8      --------------------NFI---DEQH---------FLL-LY-----------RKND
A0A3R9P8H7      --------------------QFM---SPTT---------FRL-TL-----------PESL
A0A238WIA7      --------------------KFL---SPNR---------VQL-TY-----------LEGG
A0A212UCJ7      --------------------RFL---TPQQ---------IEL-TY-----------QENG
A0A4Z0MQE1      --------------------HFL---SPQQ---------IEL-TY-----------QEGG
A0A4Z0PCF4      --------------------RFL---SPQQ---------VEL-TY-----------QEAG
A0A6M6BED0      --------------------RFL---SPQQ---------VEL-TY-----------QEAG
A0A5D6VDG1      --------------------LFT---SSTK---------FQL-SH-------------EG
A0A6H1CVS0      --------------------LFT---SATK---------FQL-SH-------------EG
A0A243WHR7      --------------------TFS---NPQQ---------FRL-SY-----------QYKG
A0A5B8A0P6      --------------------QFV---DNKH---------FKI-SY-----------NFQG
A0A076HRT9      --------------------RFK---DAQF---------FHL-SY-----------QKDG
A0A4Z0PVM7      --------------------NFT---GPQQ---------FRL-SY-----------MYQG
A0A1M6DHW8      --------------------VFT---GSQR---------IRL-SY-----------LYAG
A0A4Q5LC61      --------------------IFT---GPQR---------IRL-NY-----------LYGG
A0A2N5YXE2      --------------------EFVDYKCHLY---------YKI-----------------G
K0XJ09          --------------------KPL---NGNR---------FLLNQL-----------KIGT
R5EUZ0          --------------------KPL---NGNR---------FLLNQL-----------KIGT
W0EQS0          --------------------RPL---DDTH---------YLLKQF-----------SVGG
A0A1Y3WE15      --------------------KPV---DENR---------FLLKQL-----------SIGG
A0A1Y4GUK3      --------------------SPI---DENH---------YALKEL-----------NVGG
A0A2U1FKU2      --------------------K-----DEKT---------FRLTHF-----------KRHA
A0A0A2F954      --------------------N-----DAHS---------FQLTHF-----------EQKE
A0A0A2FW91      --------------------N-----DAHS---------FQLTHF-----------EQKE
A0A2D2N2N1      --------------------N-----DAHS---------FQLTHF-----------EQKE
Q7MWZ2          --------------------N-----DAHS---------FQLTHF-----------EQKE
T2NDT6          --------------------N-----DAHS---------FQLTHF-----------EQKE
W1R7P9          --------------------N-----DAHS---------FQLTHF-----------EQKE
A0A1R4AFZ0      --------------------N-----DAHS---------FQLTHF-----------EQKE
A0A1R4DVZ7      --------------------N-----DAHS---------FQLTHF-----------EQKE
A0A7C0WKI7      --------------------------EKDS---------LKL------------------
A0A2A8CVM9      --------------------------GEDG---------QAR------------------
A0A5M4B212      --------------------HIL---PDNR---------IEM-TV-----------RGKE
A0A3D1KEX9      --------------------ELL---PSKQ---------LKVSDM-----------QIDD
A0A358Y7S2      --------------------S-----VEND---------LILIDY-----------EKSG
A0A1X7J248      --------------------DII---DKTN---------FKI-ST-----------NQDG
E4TQD2          --------------------DII---DKEN---------FKL-TT-----------NPDE
A0A2J6HHN3      --------------------TI----HDDH---------LNV-SY-----------MNLD
A0A1Y3WMT8      --------------------KVQTNKGSDK---------IKVLLK-----------QG--
A0A1Y4GQU1      --------------------KVQTDKSSDK---------IKVVLK-----------RG--
A0A6A0R272      --------------------EFK---DENH---------FII-SY-----------EKNG
A0A1V5W8T5      --------------------DYNK--KTDK---------ITI-EY-----------SLDG
A0A2T8HKA9      --------------------K-----DSNH---------VDF-LL-----------MEND
A0A2I0QZ80      --------------------TT----EGNK---------IFL-NF-----------TH-Q
A0A3E1F1A3      --------------------SV----DEEK---------VLM-RF-----------NH-K
A0A2U2XBJ3      --------------------SS----MEDK---------IIM-NF-----------KF-N
A0A4Q4KU94      --------------------SA----FDDK---------VIM-NF-----------KY-N
A0A3B8INU3      --------------------TIL---DNDR---------YEI-RF-----------PWVG
A0A2W1NDY9      --------------------K-D---GQDG---------LYL-VF-----------NA-N
A0A5C8AQR5      --------------------EYM---GNNR---------IRL-NY-----------EL-H
A0A1G0CI31      --------------------E-L---KGNK---------VQL-SY-----------QV-G
A0A556N0M0      --------------------ETT---DNRR---------VKL-TY-----------VL-N
F2IKD6          --------------------ETL---ENRK---------IRL-SY-----------SL-L
A0A1I7BM74      --------------------YKD---NSNQ---------YKI-KY-----------NY-K
A0A2G2FJ17      --------------------KPK---AQGL---------VEL-SM-----------QR-H
A0A2E3R1D0      --------------------------LRD-------------------------------
A0A2T2USC0      --------------------------LTGP---------KDP------------------
A0A2T2V0F3      --------------------------LTG-------------------------------
A0A2T2S682      --------------------------LTT-------------------------------
D5H561          --------------------------AWA-------------------------------
A0A2H3NWA9      --------------------------YTA-------------------------------
A0A2A8CVB6      --------------------------LSD-------------------------------
A0A2P6C1S6      --------------------------LRG-------------------------------
A0A2T2UTM4      --------------------------LRG-------------------------------
A0A414ZBF2      --------------------TATAIDGNRA---------LLSDFV-----------LDEN
A0A1Q3Q573      --------------------RLV---NKNS---------MVV-SY-----------SF-N
A0A662BAY3      --------------------EIL---PDGK---------LLI-KV-----------EDEH
A0A4U3L369      --------------------KEV---NPTS---------YAL--F-----------DSKD
A0A357YNR3      --------------------------DKVS---------IDVVVY-----------PTGN
A0A5E8AX52      --------------------EII---SESE---------FEL-SF-----------EPAE
F4KK08          --------------------DKEAHNQVIL---------YDI-KS-----------SLIG
A0A6B5PK86      --------------------TY----VNQL---------VNL-NY-----------VH-E
A0A2G2F510      --------------------DY----DGEN---------ISL-SY-----------LK-N
A0A316JZ08      --------------------TT----RNDQ---------VIL-SY-----------SK-G
A0A496LCF9      --------------------KR----DSHS---------FTITIY-----------DNTD
A0A5P2G2A9      --------------------SSW---DEKG---------IAL-IR-----------KIKD
A0A3C0ZQC7      --------------------------TNSE---------RILIIW-----------DRAE
A0A419VXB7      --------------------SPI---NDRE---------FKI-EV-----------KSKA
A0A0B0BTJ4      --------------------KSIEDADGSF---------KALLEY-----------RLPG
A0A3B9CNN6      --------------------KSIEDADGSF---------KALLEY-----------RLPG
R5X290          --------------------KSIEDADGSF---------KALLEY-----------RLPG
A0A1Q6E6I7      --------------------KSIEDADGSF---------KALLEY-----------RLPG
C3J7R8          --------------------VDA---SHVS---------LLCEES-----------SIEA
A0A1G8BVM8      --------------------TLL---KNNK---------AKL-TY-----------NISE
A0A1I1FXP9      --------------------LFI---DEKQ---------FSL-KY-----------KL-G
A0A3N4H5N3      --------------------IHLK--EENK---------FEL-IL-----------EDEK
A0A2P8EAX2      --------------------IKVL--NEKK---------FEI-EF-----------AKNK
A0A4V2F6N9      --------------------ITIL--GDKK---------FEI-NF-----------KDNK
A0A3B9FXJ0      --------------------RPI---GDQK---------IRC-AY-----------EW-K
R5GSU5          --------------------DLI---DNQK---------FRIFDV-----------RYKD
A0A2A3UE91      --------------------ELNKQLTGGV---------LKIGTQ-----------KL--
A0A0A2G557      --------------------SFI---EENK---------VSLSNF-----------EGDF
A0A2N2WFW8      --------------------TV----GDST---------FVI-ST-----------KTAG
A0A1F3IU95      --------------------EV----HDTG---------FVI-T-------------EIN
A0A3D0VUF6      --------------------EV----HDTG---------FVI-T-------------EIN
A0A1T4PT95      --------------------SFE---GSDK---------VRLSHF-----------KG--
A0A6I6JYY3      --------------------QID---ANGK---------LHL-KA-----------QGEN
A0A2A4PYG9      --------------------SFP---STKK---------IYT--S-----------YYVG
A0A1F3K695      --------------------DFI---SSKE---------TKA--L-----------YKIG
A0A353KZR1      --------------------DFI---SSKE---------TKA--L-----------YKIG
A0A2N2WYB5      --------------------DFT---DDKN---------GIITTY-----------VKKE
A0A1F3K4G0      --------------------EFD---GSEK---------ALI--Y-----------YGDG
A0A356H8Y3      --------------------EFD---GSEK---------ALI--Y-----------YGDG
A0A351HSA6      --------------------EFD---GSEK---------ALI--Y-----------YGDG
A0A1F3Q014      --------------------DFV---DSTH---------GTI-SY-----------SFDN
A0A2D5KD44      --------------------SFA---NSSS---------GKL-SW-----------GEG-
A0A6N9NIX1      --------------------DFS---NKTN---------GSI-SY-----------TNTN
A0A2A4YXP3      --------------------KFI---DTHK--------------F-----------ELVV
A0A1F3R158      --------------------EIT---NNNK--------------F-----------KLYE
A0A2M8ADX2      --------------------ELT---QNDK--------------F-----------KLFE
A0A1J5B2H0      --------------------NFN---DDKQ---------IKI-SY-----------CISD
A0A1V5N756      --------------------SFL---SNSN---------IHI-DF-----------EAEK
A0A651GU15      --------------------RNL---ADGR---------YEL-HL--------------N
A0A3Q9FR88      --------------------EFSN--GGKD---------FII-TY-----------KI-G
A0A553GEX3      --------------------EFSN--GGKN---------FII-TY-----------KI-G
A0A150ADJ9      --------------------NFSG--DGKS---------YQL-TY-----------NQ-G
A0A1B1FWQ4      --------------------QFSN--EGKE---------YVI-TY-----------KV-G
A0A1S1Z228      --------------------QFLN--GGDQ---------YQV-TY-----------KT-G
A1ZKR2          --------------------EII---DDQR---------FQL-SY-----------VL-G
A0A1Q3GX01      --------------------RIK---NQNE---------FEL-SF-----------QV-G
A0A349DQI4      --------------------KLK---SQKE---------FEL-SF-----------QT-G
A0A4P5TMD1      --------------------IFK---SARE---------FQI-EY-----------RI-L
A0A2N3IIZ0      --------------------ESE---DGHS---------YNI-EV-----------KNDK
A0A1F3SJM1      --------------------AVAY--NNGK---------VVL-SY-----------LK-N
A0A2G2EB96      ---------------------TSS--GNSK---------VKL-TY-----------VK-N
A0A2G6PRA9      ---------------------VSK--GRNK---------VEL-SY-----------VK-G
A0A497D5Z2      --------------------SFL---PGGK---------LEL-SV-----------DGEN
A0A662B170      --------------------SFL---PGGK---------LEL-SV-----------DGEN
A0A2A5FYT6      --------------------QFD---DEFK---------AIA-SY-----------TI-N
A0A2E6SYP1      --------------------EFV---KGCA---------LLS-FN-----------DD--
A0A2E5RLE8      --------------------NFS---NGSA---------IIS-KV-----------DV--
A0A2E7TQF6      --------------------NFS---NGSA---------IIS-KV-----------DV--
A0A2E6GVY9      --------------------NFK---NGSA---------VIS-KM-----------DV--
A0A350JJ90      --------------------EFE---TPTS---------GTI-NY-----------LV-G
A0A3M1CDV2      --------------------DFNDNLQTGK---------IKI-LL-----------SE--
A0A6C1QGZ7      --------------------DFV---SQEN---------III-SF-----------TH-R
A0A4P5U6G4      --------------------EFI---NNKS---------FKI-SY-----------RI-G
A0A2E2TFD1      --------------------YFP---NTTQ---------IHL-SI-----------DEPI
A0A2E4ELE6      --------------------YFE---SEKE---------LIL-TI-----------ENGK
A0A522EYA6      --------------------YFD---SETS---------GEI-TY-----------TV-G
A0A2E3XZI5      --------------------KF----EKNY---------FSL-VD-----------EE-N
A0A6I7QXV0      --------------------NII---DRNT---------FTL-EY-----------EI-N
A0A2M7NLQ9      --------------------QII---DEEE---------FVL-TY-----------QTAT
I4AFR0          --------------------QII---DEEE---------FVL-TY-----------ETPT
A0A2N2Y3E5      --------------------DFE---NITD---------GWL-YF-----------QN-N
A0A2D9D7T6      --------------------KE----KKGK---------LEI-SY-----------TH-N
A0A1F3PPL5      --------------------DFE---NPTT---------YHL-KI-----------NS-D
A0A357QK06      --------------------DFE---NPTT---------YHL-KI-----------NS-D
A0A662AEA4      --------------------NFN---NKNS---------FSI-QY-----------EI-N
A0A0S2HYK8      --------------------SFK---DKKN---------VVF-EY-----------EY-N
A0A2N5ZWN6      --------------------QFI---DENN---------AKI-EF-----------EI-G
A0A2E0FJ09      --------------------LLK---PDKT---------IHL-KY-----------TV-D
A0A1F3FZ62      --------------------EFK---GNNK---------YIL-RY-----------LL-N
A0A1F3K211      --------------------EFK---GNNK---------YIL-RY-----------LL-N
A0A1V6I2U9      --------------------EF----KDYK---------CHI-AY-----------TL-G
A0A2H0B957      --------------------SFS---LNGD---------AAI-KY-----------TY-N
A0A1F3CFW6      --------------------SFD---KNGD---------SNI-KY-----------KT-N
A0A2M7E2T8      --------------------SFD---KNGD---------SNI-KY-----------KT-N
A0A2M7NC69      --------------------SFD---KNGD---------SNI-KY-----------KT-N
A0A1F3KLL5      --------------------SFL---NKNS---------FTL-EY-----------YI-N
A0A359D1M1      --------------------SFL---NKNS---------FTL-EY-----------YI-N
A0A0F2NS19      --------------------EKT---NNEK---------FNL-FQ-----------SE--
A0A2A5H8X6      --------------------EKT---NNEK---------FNL-FQ-----------SE--
A0A2H0GAU8      --------------------EIT---KNNK---------FNL-FE-----------NE--
A0A2M8FTK1      --------------------EIT---KNNK---------FNL-FE-----------NE--
A0A2A5B3B0      --------------------EFI---DDYK---------FRL-TQ-----------ND--
A0A5C6RXM7      --------------------VIN---DINQ---------FEL-RD-----------GE--
A0A1F3C1M2      --------------------EFI---DKLN---------FNL-SF-----------TI-N
A0A1F3DS87      --------------------EFI---DKIN---------YNL-SY-----------EI-N
A0A6A0R6K9      --------------------DFVSKEKGTL---------SWH-EG-----------EK-I
A0A2E7CT70      --------------------QK----KGDY---------FIL-TD-----------FD-N
A0A2D5V560      --------------------LF----DGNY---------FSL-TD-----------EK-A
A0A2D7K5A8      --------------------LY----DGTY---------FSL-TD-----------EN-E
A0A2E1XQ82      --------------------SF----DGTY---------FSL-KD-----------KN-Q
A0A5C8A5B4      --------------------PIEVEVDRAARTYRVKAQGKNVRLY-----------NVKT
A0A4Y9ITE2      --------------------ATKDGKVDIKLKK---GRFSTIAET---------------
A0A5M8NYX7      --------------------GSFILDKKGDTFS-----IEAQGAD---------------
A0A3D5KRY6      --------------------SKTKYEISCDEKIRIGGWSKHIQFH---------------
A0A0E3V905      --------------------SNKAVKINEQVYP-----VNHAIET---------------
A0A553ETH6      --------------------NKTKYQISFDGED-----VSGAAEY---------------
A0A640Q161      ---------------------AEFMPKDEEPSF-----VDALKAN---------------
A0A640QU49      ---------------------DDFMPAEDESSI-----VDDIKAQ---------------
A0A1Q3PII2      ----------------------HIERRTGNTFT-----VRTPSNI---------------
A0A351BXT2      ------------------------------------------IDE---------------
A0A2K8Z965      --------------------GDNTVTINEHVYP-----LNKSIET---------------
A0A418M8U8      --------------------DSSSVEINEQVYP-----LNQRIKT---------------
I2GTA4          --------------------DSSSVEINEQVYP-----LNQRIKT---------------
A0A2K8ZAJ2      --------------------DSKMVKLNGHMYP-----VNQSIKT---------------
A0A368JPA3      --------------------SPTTVRLNDWVYP-----ANQIINT---------------
A0A5N1JI29      --------------------SPTTVRLNDWVYP-----ANQIINT---------------
A0A3P1BT12      --------------------SPTTIRLNDWVYP-----ANQIINT---------------
A0A3P1CI15      --------------------SPTTVRLNDWVYP-----ANQVINT---------------
A0A4R8CUK1      --------------------SPTMVQLNDGVYP-----ANQSVTT---------------
A0A3D0MYJ7      ----------------------NLYIKNKENTY-----NLINEDG---------------
A0A662AH13      ----------------------NIFDPKFEIIE-----ENNNP-----------------
A0A5C7QA01      ----------------------KINQNNYQLLD-----ANTAEVL---------------
A0A3D3LS70      ----------------------YLINRNKKVNS-----EHILQDE---------------
A0A1G1TM36      ----------------------IVLQDTASFAV-----RAADGTL---------------
A0A1G7ZF38      ----------------------LIIRETDSTFR-----LQTSDHY---------------
C6VS52          ----------------------HIVRQAGDFYI-----IEISGSR---------------
A0A7C1LGX3      --------------------SLSVNFMAND---------IEVTDS-----------NGNN
A0A2A4G4B1      --------------------TFDFALLDSE--------NFSLS-------------INGS
A0A0P7X1V8      --------------------------------------PVIWRAF---------------
A0A6P1P355      --------------------KVYFAFDKGK--Q-----QVTVGH----------------
A0A5C8KAD6      --------------------QVYFTYNNKT--K-----KVKFDG----------------
A0A5N1J695      --------------------QVYFTFNEGT--H-----KIKFQE----------------
A0A3B0C2S4      --------------------VYDISLDAFE---------ARITNM-----------DGAT
A0A3N2M1H3      --------------------SFKMELSADG--N------IKMREF-------RKFTIDGK
A0A4S2G8T2      --------------------SFKMELSADG--N------IKMREF-------RKFTIDGK
A0A212K7W5      --------------------SFYIELLPQN--K------IRLANL-------T---LNGE
F5IU11          --------------------SFQIELLSQN--K------IRLSDL-------I---LNGE
A0A7C1QWC7      --------------------TYRLRIAEDN---------VSLYNY-------LDNKITSS
A0A352Z1R7      --------------------TFTVKDDDDK--------------------------LVGE
A0A3N2N6F7      --------------------RMRMTILEDG--K------VEVSD--------M---YDHL
A0A4P7VVU7      --------------------SMELDIRDDG--K------IDISKM-------M---LNGV
A0A2V1ILM4      --------------------SMELDIRDDG--K------IDISKM-------M---LNGV
A0A3N2L0E8      --------------------SMGLDIRDDG--K------IDISKM-------M---LNGV
A0A3N2LFC5      --------------------SMELDIRDDG--K------IDISKM-------M---LNGV
A0A0A2F501      --------------------SLTLTILANG--Q------FAISNL-------M---LNDN
R5B7P0          --------------------GFTVS-ENGG--R------VTLNDF-------I---HKNE
R5B0L5          --------------------SVIVKINKKG--V------IVLSDL-------V---LNNI
A0A6I1TEC0      --------------------SMTVYLKGGD--K------FELTDF-------KGTSSNGT
A0A3R5XWG1      --------------------SMTVYLKGGD--K------FELTDF-------KGTSSNGT
A0A5P0Y910      --------------------SMTVYLKGGD--K------FELTDF-------KGTSSNGT
A0A414YFM3      --------------------SMTVYLKGGD--K------FELTDF-------KGTSSNGT
A0A6A7UIA7      --------------------SMTVYLKGGD--K------FELTDF-------KGTSSNGT
A0A6A7VPS3      --------------------SMTVYLKGGD--K------FELTDF-------KGTSSNGT
A0A374THP7      --------------------SFQLQLKGDG--S------YVISKI-------KGSNRDNL
A0A6G1VND1      --------------------SFQLQLKGDG--S------YVISRL-------KGITRDNL
A0A0A2EVS5      --------------------SLSVTVRGDG--M------VEVSDM-------I---LDGE
A0A1T4NAJ7      --------------------SLSLTVRGDG--M------VEVSDM-------I---LDGE
A0A255T941      --------------------SFVIKLNDEH--S------FTLYDF-------K---MYTE
A0A3N2KCL3      --------------------SFRVEVDGDG--K------VSVSDV-------K---SGDL
A0A4P7VSV0      --------------------SFRVEVDGDG--K------VSVSDV-------K---SGDL
A0A2V1IJY1      --------------------LFRVEVDGAG--K------VSVSDV-------K---SGDL
A0A4P7VXK7      --------------------LFRVEVDGAG--K------VSVSDV-------K---SGDL
A0A1Y4CHN5      --------------------SFTIKPAADG--T------LGFSDF-------V---RNGE
A0A1M6I2S6      --------------------SFKIDFSSKE--E------FTISDV-------M---INGE
A0A1Y3V692      --------------------SFKIDFSSKE--E------FTISDV-------M---IDGE
F3PXM2          --------------------AFDLELTSRN--D------FLLSGF-------K---VEGE
A0A174AHH7      --------------------SFDIEVDTQN--K------FYLSNF-------I---VAGK
A0A174JCE8      --------------------SFDIEVDTQN--K------FYLSNF-------I---VAGK
A0A3E4JMC4      --------------------SFDIEVDTQN--K------FYLSNF-------I---VAGK
A0A412SND6      --------------------SFDIEVDTQN--K------FYLSNF-------I---VAGK
A0A414IEQ9      --------------------SFDIEVDTQN--K------FYLSNF-------I---VAGK
A0A6I0U0V8      --------------------SFDIEVDTQN--K------FYLSNF-------I---VAGK
A0A6L5S9H7      --------------------SFDIEVDTQN--K------FYLSNF-------I---VAGK
A0A0M1W8D8      --------------------SFDIEVDTQN--K------FYLSNF-------I---VAGK
A0A3R6GKX5      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A7V4S1          --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
B0NU19          --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
D4V601          --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A4Q0U3M9      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A4R4H1Q2      --------------------SFDIEVDAQN--K------FYLSNF-------I---VAGE
A0A6I0GII7      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A6I0KYU7      --------------------SFDIEVDAQN--K------FYLSNF-------I---VAGE
A0A397WLT5      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A6A2J529      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A6L6P8N9      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A6N8DDD8      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A015XH67      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A078RZN2      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A4R4I3T9      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A6L0K5          --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A7ACT5          --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A6KY94          --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A173UQR8      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A3R6HK75      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A412B7D1      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A412VNY9      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A414LTU9      --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
I9Q4U4          --------------------SFDIEVGAQN--K------FYLSNF-------I---VAGE
A0A373ISF0      --------------------SFTIRIDSKD--A------FTISGL-------K---VAGV
U6RF62          --------------------SFTIRIDSKD--A------FTISGL-------K---VAGV
A0A662ZZD5      --------------------GFTIDISSKE--T------FVISDM-------E---VNGK
A0A3A5TI83      --------------------GFTIDISSKE--T------FVISDM-------E---VNGK
A0A415NEB6      --------------------GFTIDISSKE--T------FVISDM-------E---VNGK
A0A6I0I238      --------------------GFTIDISSKE--T------FVISDM-------E---VNGK
A7AJ60          --------------------GFTIDISSKE--T------FVISDM-------E---VNGK
A0A6A2JF01      --------------------GFTIDISSKE--T------FVISDM-------E---VNGK
A0A6I0Y2Y2      --------------------GFTIDISSKE--T------FVISDM-------E---VNGK
A0A6I2Q447      --------------------GFTIDISSKE--T------FVISDM-------E---VNGK
A0A395YYT3      --------------------GFTIDISSKE--T------FVISDM-------E---VNGK
A0A015UXN7      --------------------GFTIDISSKE--T------FVISDM-------E---VNGK
A0A5M5W148      --------------------GFTIDISSKE--T------FVISDM-------E---VNGK
A0A6I2NTL0      --------------------GFTIDISSKE--T------FVISDM-------E---VNGK
A0A016E4F9      --------------------SFTINLPSKK--E------FTISDV-------M---IDGE
A0A4Q5CFJ7      --------------------SFTINLPSKK--E------FTISDV-------M---IDGE
A0A6N3HG44      --------------------SFTINLPSKK--E------FTISDV-------M---IDGE
A0A6H9P0U9      --------------------SFTIKFSSKE--A------FAISEL-------E---ISGE
A0A108TH71      --------------------SFTIKFSSKE--A------FAISEL-------E---ISGE
I8VXH0          --------------------SFTIKFSSKE--A------FAISEL-------E---ISGE
A0A412S0N6      --------------------SFTIKFSSKE--A------FAISEL-------E---ISGE
A0A412IIJ0      --------------------SFTIKFSSKE--A------FAISEL-------E---ISGE
A0A0P0FM97      --------------------SFTIKFSSKE--A------FAISEL-------E---ISGE
R6KTP3          --------------------SFTIKFSSKE--A------FAISEL-------E---ISGE
A0A139LU87      --------------------SFTIKFSSKE--A------FAISEL-------E---ISGE
A0A1C6B3Y5      --------------------SFTIKFSSKE--A------FAISEL-------E---ISGE
A0A6L3KCD1      --------------------SFTIKFSSKE--A------FAISEL-------E---ISGE
E2NMQ4          --------------------SFTIKFSSKE--A------FAISEL-------E---ISGE
A0A412YDB9      --------------------SFTIEFSSKD--T------FTISDL-------K---VSDE
R7DY01          --------------------SFTIEFSSKD--T------FTISDL-------K---VSDE
A0A414LGK8      --------------------SFTIEFSSKN--T------FTISDL-------K---VSDE
A0A415IPQ4      --------------------SFTIEFSSKE--A------FTISEF-------E---ISGE
A0A3E5BRW7      --------------------SFTIEFSSKD--M------FTISEF-------E---ISEE
K9DXS6          --------------------SFTIEFSSKD--M------FTISEF-------E---ISEE
A0A1M6KFV3      --------------------SFTIEFSSKD--T------FAISEF-------E---VSGV
A0A1Q6G7L3      --------------------SFTIEFSSKD--T------FAISEF-------E---VSGV
A0A413H235      --------------------SFTIEFSSKD--T------FAISEF-------E---VSGV
A0A1M5B2J8      --------------------AFQLHLGKDG--H------YTISDL-------T---RNGT
A0A255RCT5      --------------------SFRLHLGTNG--R------YTLYEL-------T---RNGE
A0A1Y4GLF5      --------------------SFTVEIRPGR--S------FGLSDF-------T---RNGD
A0A1H3XSC0      --------------------GFTLQVQPDS--T------VRLSDF-------T---RNGN
A6LE40          --------------------GFTLEVQPDG--T------LFLSDF-------T---RNGT
A0A4Y1VPX5      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A6N2XMM4      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
B3JI46          --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A358R8U0      --------------------RFTLKVRPGG--E------VELSEF-------V---RNGE
R6WSB6          --------------------RFTLKVRPGG--E------VELSEF-------V---RNGE
A0A401LPX7      --------------------TFELYLAKDG--A------VELSSF-------T---RNGT
A0A6G0GNY9      --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
A0A6I1BFM0      --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
A0A3A5Z900      --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
A0A285TGL6      --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
A0A3A5RFX4      --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
A0A1Q6IUW9      --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
A0A413XDP6      --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
A0A6N8CVT6      --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
K6AP24          --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
A0A6I2NHV3      --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
A0A662ZYI7      --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
A0A078RYI7      --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
C7XEQ8          --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
D7INX6          --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
K5ZG55          --------------------TFELHLAKDG--A------VELSSF-------T---RNGT
A0A3N2N9B8      --------------------EMNVDISPEG--K------ASISEL-------R---YAGK
A0A3N2NMI0      --------------------TLELNISADK--K------VTIREL-------K---QGEL
A0A359I8H7      --------------------GFRIELGKDG--N------VVLRKF----HLET---PDGD
A0A3N2KA63      --------------------GFRIELGKDG--N------VVLSKF----HLET---PDGD
A0A4Q0IMT7      --------------------GFRIELGKDG--N------VVLSKF----HLET---PDGD
A0A3B9FAU3      --------------------AMQMELQPNG--V------VKLSNF-------M---RNGK
A0A3C1E5L7      --------------------AMQMELQPNG--V------VKLSNF-------M---RNGK
A0A4Q0UAV1      --------------------YYSFTITMVSATR------FTLSDF------------AGG
A0A354SN68      --------------------SFEIQLEKGG--K------AILSHFKGDFGDEV---VNDE
A0A6L5XFL0      --------------------DFTLELPSSG--V------VKLSNF-------V---VNGV
A0A3N2N595      --------------------KFDLMVNGDG--N------VTISGM-------K---IGEK
A0A0A2DUD9      --------------------ECILSQLPSG--E------LQLHSF-------V---LNGE
A0A3P1ZBJ5      --------------------RLSINYQQDG--S------FELTGF-------E---SANT
R5FHS9          --------------------KFTVKMEGTR---------FVLSKF-------I---RNKE
A0A413TW79      --------------------SLDVEVKHGNLFS-----IVHVSGT-------D---KAGN
A0A3E5E9M7      --------------------NLDVEVKHGNLFS-----IVHVSGT-------D---KAGN
A0A3E4SK73      --------------------NLDVEVKHGNLFS-----IVHVSGT-------D---KAGN
A0A415GGC6      --------------------SLDVEVKHGNLFS-----IVHVSGT-------D---KAGN
A0A413DBH9      --------------------NLDVEVKHDDLFS-----IVHVSGT-------D---KDGN
A0A1Y4PQK7      --------------------GFTVNVYKDG--H------VQLSDF-------V---LKGE
A0A1Y4IH41      --------------------GFTVNVYKDG--R------VQLSDF-------V---LKGE
A0A3A6AAP4      --------------------GFTVNVYKDG--R------VQLSDF-------V---LKGE
A0A6I0ZRD2      --------------------GFTVNVYKDG--R------VQLSDF-------V---LKGE
A0A1Y4DYA7      --------------------SFTIFPVSGN--K-----GVELTDF-------I---HGGE
A0A1Y3X4I9      --------------------SLTILPVSGN--K-----GVELTDF-------V---RGEE
A0A1Y4FNK8      --------------------SFTVNPSSIG--Q------VKLTDF-------V---HNGE
A0A355FD59      --------------------KLTLRVSEDS--T------VVLSDF-------V---WGDG
A0A359CEZ9      --------------------KLTLRVSEDS--T------VVLSDF-------V---WGDG
A0A353Q7B4      --------------------KLTLRVSEDS--T------VVLSDF-------V---WGDG
F8X3A5          --------------------ELIIKLLADG--T------FECSDF-------A---CDNK
A0A1M3KVR9      --------------------ELVIKLLADG--T------FECSDF-------T---SDNK
A0A4Y9IJS3      --------------------ELVIKLLADG--T------FECSDF-------T---SDNK
A0A495WI87      --------------------ALTVKILADS--T------VELSDF-------I---RNGE
A0A354M4S6      --------------------ALTVKILADS--T------VELSDF-------I---RNGE
R7DH52          --------------------ALTVKILADS--T------VELSDF-------I---RNGE
A0A4Q5E7L5      --------------------GFTLEIHPDS--T------LLLSDF-------T---RNGT
A0A4P8LP09      --------------------GFTLEVRPDS--T------LLLSGF-------T---RNGT
A0A4R4GZU7      --------------------GFTLEVRPDS--T------LLLSGF-------T---RNGT
A0A016CWA4      --------------------GFTLEVRPDS--T------LLLSGF-------T---RNGT
A0A1C6H117      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A0M1W0V2      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A139KA16      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A174VQ92      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A1Q6HCG0      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A1Y4JYM9      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A3A5QW67      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A3A5RQE6      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A3A6BP07      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A3E5E153      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A3Q9IP20      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A412WV15      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A413ICP6      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A414KYB9      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A5B3FWR2      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6L4P3V7      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
E5WX00          --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
K0X3P3          --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A415TAH7      --------------------RFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A078T2W6      --------------------GFTLKIQPDG--T------LYLSDF-------I---RNGT
A0A6I1AQV4      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A5C6L2P1      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A412MJT7      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A3E4WKT5      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A3A5YY33      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A078TAH2      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A1E9CFZ7      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A373FYU5      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A3A5TZ72      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A3A5XBP2      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A3A6MEG9      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A3E4JP35      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A3E4KP40      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A3E4NX82      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A3E4XFU8      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A412RG70      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A412TD37      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A413GAA4      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A414M7I4      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A496BTA0      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A496D2V6      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A4Q5G1P5      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A5C6KCA6      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A5M5AHM5      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A6I0KZV6      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A6I0Y5K7      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A6I1BFB8      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A6I2P5W5      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A6N8DC51      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
E5UZA2          --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A069SMG6      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A6A2RTB3      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A6I0VY00      --------------------GFTLEIQPDG--T------LYLSDF-------I---RNGT
A0A1M4YZ07      --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
A0A0P0FQW1      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A5M5C0W6      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6I0H151      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A642LZ22      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6I0HI59      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A642NJ89      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6I0HI52      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6L3JTQ2      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6L4EED9      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6I0YVB5      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6L5RHE2      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6N3AEV2      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6L3KG29      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6G0G4T5      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6I0HFG9      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A4Q5E5M7      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
A0A6L4F5W0      --------------------GFTLEVQPDS--T------LLLSDF-------T---RNGT
C3RFN5          --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
A0A3A5Z014      --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
A0A6I0ING7      --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
A0A6L5S265      --------------------GFTLEVQSDG--T------LFLSDF-------I---RNGT
A0A078S3Q8      --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
A0A069SJV7      --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
A0A3E5DXI5      --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
A0A3E5EM98      --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
A0A3E5F453      --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
A0A6N2YYD4      --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
I9T3G6          --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
A0A3E4SYU0      --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
A6LGY1          --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
K5ZSH4          --------------------GFTLEVQPDG--T------LFLSDF-------I---RNGT
A0A1H4ADG3      --------------------SYEFTLNGKS--------GFTVSSD-----------KHV-
A0A5B8VUR8      --------------------RYEFHIISTS--------GFEISSA-----------DHI-
A0A0D3L8Q3      --------------------VIKVHLKGNN--------SYDI-EY-----------NEK-
A0A2N3U785      --------------------TLRVQIKDKN--------NFVLND------------EEK-
A0A5B6TJH8      --------------------ELIIHTKDNN--------SFVLEEQ-----------DGK-
A0A519U664      --------------------SFVVFLKADN--------SFQLQDY-----------TGT-
A0A519MA34      --------------------SFTVFLKADN--------SFQLQDY-----------TGA-
A0A519UCX0      --------------------SFTVFLKADN--------SFQLQDY-----------TGA-
A0A0E3ZG78      --------------------SFVIHIKSDS--------TYNLDDN-----------EGK-
A0A1I6BRK6      --------------------SIIIHLKKNN--------FFDLEDY-----------KGI-
A0A243WAB1      --------------------SITLHLHPDN--------SFQLEDY-----------DGT-
A0A6G8C8X6      --------------------SFAVYLKGGN--------SFTLDDY-----------SGK-
A0A416GA42      --------------------SFRLRLLPGR--------KVELSQL-----------KYQA
A0A1T3IYP5      --------------------SFIITPFDSK--------TVILKGW-----------DQSG
A0A1T5K9D4      --------------------TIKATPRDSK--------TIELD-------------LSSL
A0A077ENE7      --------------------NFTVIPLDGN--------SVIIKNW-----------NPEN
A0A6I5UW06      --------------------NFTVIPLDGN--------SVIIKNW-----------NPEN
T0NN57          --------------------SFVITPIDSR--------SVIIKNW-----------SKNG
X5K347          --------------------SFVITPIDSR--------SVIIKNW-----------SKNG
A0A060RD97      --------------------SFTVTPKNSE--------AFQLSYI-----------DENE
A0A3C1ITV0      --------------------TFVAEKEGQS--------QLTVKDF-----------KING
R7HN19          --------------------TFVAKKEGQS--------QLTVKDF-----------KING
A0A350IHV0      --------------------SFELTKTGDS--------TFVIKNL-----------RVA-
R5RVP0          --------------------SFEIVNEKDS--------TFVIKDL-----------AVV-
R6A0L2          --------------------HIDVVKKGSN--------TVTLKGM-----------TDRM
R7LG80          --------------------SLKIKKLDQN--------TVEIKGF-----------RNKK
A0A2L2WX98      --------------------KFEVVKTGDR--------KFALSNF-----------ERGK
A0A6N8KXI9      --------------------EFDLKGIDKE--------TVELFGF-----------SKGD
G5GD56          --------------------RFEAKIQADG--------TVKLSDF-----------VCYN
R5KD55          --------------------SLHIRLKKDG--------SIKMSEF-----------VKNG
A0A174QNT3      --------------------ELKVSVVNDK--------QCRISNI-----------EIEE
A0A4S2FGS1      --------------------KFTVSVINEK--------GVRLSQL-----------EIDG
R9I0H0          --------------------ELTVSIINEK--------GVRISQL-----------EIDG
K5BUT9          --------------------SFNITPLNTT--------KFRISDW-----------KVMG
A0A174FPA3      --------------------SFNITPLNTT--------KFRISDW-----------KVAG
R6S9Y6          --------------------SFNITPLNTT--------KFRISDW-----------KVAG
A0A642LIH6      --------------------SFNITPLNTT--------KFRISDW-----------KVAG
C9KX15          --------------------SFNITPLNTT--------KFRISDW-----------KVAG
A0A6H0KRK1      --------------------HTKVTPLDVK--------NYTILG----------------
R6DAG6          --------------------RTKVTPLDVK--------NYTILG----------------
A0A3L8AAP1      --------------------RTKVTPLDVK--------NYTISD----------------
A0A4S2AYX2      --------------------RTKVTPLDVK--------NYTISD----------------
A0A4Y9H477      --------------------RTKVTPLDVK--------NYTISD----------------
A0A0E2M2Y7      --------------------SFKIDIKDSR--------SFQLSDF-----------KQQK
A0A0K2J6Z0      --------------------SFKIDIKDSR--------SFQLSDF-----------KQQK
B2RKZ8          --------------------SFKIDIKDSR--------SFQLSDF-----------KQQK
A0A212GC82      --------------------SFKIDIKDSR--------SFQLSDF-----------KQQK
A0A254MU12      --------------------SFKIDIKDSR--------SFQLSDF-----------KQQK
R6CQ93          --------------------SFVVTPKDET--------SVELSEI-----------EGIP
A0A3D1NQW3      --------------------RFEVSLRPDS--------IVKLNYF-----------EIF-
B0MT10          --------------------RFEVSLRPDS--------IVKLNYF-----------EIF-
R7JGW9          --------------------RFEVSLRPDS--------IVKLNYF-----------EIF-
A0A3D2BF46      --------------------AFELTPVDNE--------KFSLTKF-----------VNRT
A0A358R538      --------------------ELTVTPLPDG--------RLRLSDF-----------DDGF
A0A1Y4AAB8      --------------------SFRARPLAGG--E-----QVELTDF-----------DDGY
A0A1Y3WWY9      --------------------SMTVTPRGEQ--------QIEISQF-----------QDGF
A0A1Y4U5L4      --------------------SMTITPRGEQ--------QIEISQF-----------QDGF
A0A1Y3VCJ1      --------------------SLEVTPVDDQ--------NIRLSNF-----------HDPF
A0A1Y3QTW7      --------------------SLEVTELEDG--------RIKLADF-----------DDKY
R6XWY7          --------------------SLEVTELEDG--------RIKLADF-----------DDKY
A0A4Y1X9Y9      --------------------SLEVTELEDG--------RIKLADF-----------DDKY
A0A4Y1WM66      --------------------SLEVTELEDG--------RIKLADF-----------DDKY
A0A6N4GYT3      --------------------SLEVTELEDG--------RIKLADF-----------DDKY
A0A174AVF1      --------------------SLEVTELEDG--------RIKLADF-----------DDKY
A0A656Q4F4      --------------------SLEVTELEDG--------RIKLADF-----------DDKY
A0A1Q6EIY0      --------------------SLEVTPLRNG--------KIELTDF-----------EDKF
A0A5B5VN71      --------------------SLEVTPLRNG--------KIELTDF-----------EDKF
E4M8L3          --------------------SLEVTPLRNG--------KIELTDF-----------EDKF
I3YQ50          --------------------SLEVTPLRNG--------KIELTDF-----------EDKF
R5UEY8          --------------------SLEVTPLRNG--------KIELTDF-----------EDKF
A0A1H4D866      --------------------SMEITPLEGD--------KVRLTNF-----------EDRF
A0A5B3G4Y7      --------------------AMEITPIDDD--------KIRLSGF-----------EDQF
A0A374A9J5      --------------------AMEITPIDDD--------KIRLSEF-----------KDQF
A0A5B3GQN5      --------------------AMEITPIDDD--------KIRLSEF-----------KDQF
A0A1Q6E9S3      --------------------AMEITPIDDD--------KIRLSEF-----------KDQF
D4IJ36          --------------------AMEITPIDDD--------KIRLSEF-----------KDQF
A0A414Q925      --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
A0A415PUS9      --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
A0A108TCU0      --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
A0A413BA42      --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
S3Y344          --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
A0A4Q5G8Y8      --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
A0A412TGL3      --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
A0A413VJ33      --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
A0A414L0W6      --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
A0A412DP39      --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
A0A413ZSE8      --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
B0NP84          --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
R6AK43          --------------------SLTVTMSDNG--------KVTLADM-----------TLQ-
A0A412N2D9      --------------------SLTVTMTDNG--------KVTLTDM-----------VLQ-
A0A1Y4JYS9      --------------------SLTVTMTDNG--------KVTLTDM-----------VLQ-
R6LHA4          --------------------SLTVTMTDNG--------KVTLTDM-----------VLQ-
A0A3E5HPT8      --------------------SLSVIPKNKQ--------QVELADF-----------SLD-
C6IJ48          --------------------SLSVIPKNKQ--------QVELADF-----------SLD-
Q8A3U2          --------------------SLSVIPKNKQ--------QVELADF-----------SLD-
A0A3R6S1H6      --------------------QMVVTPLDDK--------TVMLAGW-----------KGD-
A0A3R6SD81      --------------------QMVVTPLDDK--------TVMLAGW-----------KGD-
A0A354WXN6      --------------------SLKATPLDDK--------KVLLHDF-----------KIA-
R5IP14          --------------------SFDIVPISDQ--------EVLLSDF-----------TSN-
A0A316SZX7      --------------------GFTAKK-KGK--------EIYLSDL-----------RTS-
A0A1Y4AIY1      --------------------SLTAIPLSKE--------KVRLFDF-----------VTV-
A0A0J6CIR2      --------------------SLVATPLSAG--------EILLSGF-----------STN-
A0A3D8HG59      --------------------RLVATAIDEG--------KVALSDF-----------EAD-
A0A3R6S408      --------------------RLVATAIDES--------KVALSDF-----------EAD-
F3ZRU7          --------------------QLKG-KLKEN--------QVQFTDV-----------KTW-
A0A1C5Q1F3      --------------------SFKVTPLNDK--------EVLLSDF-----------PEM-
R7A239          --------------------SFKVTPLNDK--------EVLLSDF-----------PEM-
A0A3R6HIK7      --------------------ALKVTPLSKE--------KVRLSDF-----------IMA-
K5ZVW7          --------------------ALKVTPLSKE--------KVRLSDF-----------ITA-
A0A1Y4D5Z0      --------------------SLTVTPMSDK--------EVVLSKF-----------ITR-
A0A413VXJ7      --------------------LVTVTPIDSA--------RVRLSDL-----------KMS-
I9RSN9          --------------------LVTVTPIDSA--------RVRLSDL-----------KMS-
U6RJK5          --------------------LVTVTPIDSA--------RVRLSDL-----------KMS-
A0A1Q6GA32      --------------------LVTVTPIDSA--------RVRLSDL-----------KMS-
I9RPU6          --------------------TVVVTPVDSV--------TVRLSGF-----------SLA-
I8YFS5          --------------------EMTVTPVDSA--------TVRLSDF-----------SLS-
A0A6L3FCC6      --------------------EMTVTPVDSA--------TVRLSDF-----------SLS-
I8Y597          --------------------EMTVTPVDSA--------TVRLSDF-----------SLS-
A0A1Q6GBF5      --------------------KVAVVPVDSV--------TVRLSGF-----------SLA-
I8YFZ3          --------------------RVVVTPVDSI--------MVRLSGF-----------SLA-
A0A1Q6GDH2      --------------------TVVVTPVDSV--------TVRLSGF-----------SLA-
U6RSB0          --------------------TVVVTPVDSV--------TVRLSGF-----------SLA-
I9SIK1          --------------------KVVVTPVDSA--------TVRLSGF-----------SLA-
I9GXM2          --------------------KVVVTPVDSV--------TVRLSDF-----------SLA-
I9TP59          --------------------KVVVTPVDSA--------TVRLSGF-----------SLA-
R5S343          --------------------TCAVTFMTCE--------RVLLSGF-----------KEE-
A0A1M6K7I9      --------------------HVCVTPLSEN--------KVRLSEL-----------LMI-
A0A5M6A8C8      --------------------RVCVTPLSEK--------KVRLSEL-----------LMI-
A0A6L3FBE6      --------------------EMKVTPVDSV--------TVKLSDL-----------TLT-
A0A6L3FNG1      --------------------KTAITPIDSV--------TVRLSDF-----------VLS-
A0A3R5ZMK1      --------------------SLKAVPVSGK--------EVVLSGF-----------TLG-
A0A6L6NFJ9      --------------------SLRAKPISAE--------EVVLSDF-----------VID-
A0A1Y3ZIA4      --------------------SLQAVPVSGK--------EVMLSGF-----------TLG-
K5Y1A4          --------------------SLQAVPVSGK--------EVMLSGF-----------TLG-
A0A4Q5CIT0      --------------------SLKAVPVSGK--------EVVLSGF-----------TLD-
A0A6L6NWL9      --------------------SLKAVPVSGK--------EVILSGF-----------TLG-
A0A3R6K8X4      --------------------SLKAVPVSGK--------EVILSGF-----------TLG-
A0A6N8D6C8      --------------------SLKAVPVSGK--------EVILSGF-----------TLG-
A0A3R6BKI7      --------------------SLKAVPVSGK--------EVVLSGF-----------TLG-
A0A6N8CW60      --------------------SLKAVPVSGK--------EVVLSGF-----------TLG-
A0A412M2W1      --------------------SLKAVPVSGK--------EVVLSGF-----------TLG-
K5ZX55          --------------------SLKAVPVSGK--------EVVLSGF-----------TLG-
A0A415BDM7      --------------------SLKAVPVSGK--------EVVLSGF-----------TLG-
A0A6L6MX19      --------------------SLKAVPVSGK--------EVVLSGF-----------TLG-
A0A1Q6I3T6      --------------------SLKAVPVSGK--------EVVLSGF-----------TLG-
A0A414XX40      --------------------SLKAVPVSGK--------EVILSGF-----------TLG-
A7AEU7          --------------------SLKAVPVSGK--------EVILSGF-----------TLG-
A0A5F0U645      --------------------GLTVVPVSDK--------EVSLSGF-----------FSEE
K5ZBN2          --------------------GLTVVPVSDK--------EVSLSGF-----------FSEE
A0A0J6CKW3      --------------------GLTVVPVSDK--------EVSLSGF-----------FSEE
A0A0F5IQM7      --------------------GLTVVPVSDK--------EVSLSGF-----------FSEE
A0A496CDT3      --------------------GLTVVPVSDK--------EVSLSGF-----------FSEE
A0A6G1ZKM3      --------------------GLTVVPVSDK--------EVSLSGF-----------FSEE
S0GLB0          --------------------GLTVVPVSDK--------EVSLSGF-----------FSEE
A0A3R6NLC1      --------------------GLTVVPVSDK--------EVSLSGF-----------TSEE
A0A416WYC9      --------------------GLTVVPVSDK--------EVSLSGF-----------TSEE
A0A0F5IT40      --------------------SLVATPLSAG--------EILLSGF-----------STN-
A0A496CX20      --------------------SLVATPLSAE--------EILLSGF-----------STN-
A0A5F0UBI0      --------------------SLVATPLSAG--------EILLSGF-----------STN-
A0A6G1ZHG0      --------------------SLVATPLSAG--------EILLSGF-----------STN-
S0GSI7          --------------------SLVATPLSAG--------EILLSGF-----------STN-
K5YB65          --------------------SLVATPLSAG--------EILLSGF-----------STN-
A0A0F5IWP9      --------------------SLNVTPLTET--------EVMLSDF-----------STD-
A0A0F5IZT8      --------------------SLNVTPLTET--------EVMLSDF-----------STD-
A0A417LKQ2      --------------------SLTVTPLSEK--------EVMLSDF-----------STD-
A0A416TME1      --------------------SLVVTPLSEK--------EVLLSDF-----------SMA-
A0A416XPE8      --------------------SLVVTPLSEK--------EVLLSDF-----------SMA-
L8JI02          --------------------PGGSYRIEAV--------GRDVDVY-----------NFLT
A0A4Q5WS95      --------------------QVRTTPNIP------------FTYD-----------AAA-
A0A501VZX6      ------------------------ALKETA--------KVYFHYN-----------RAS-
A0A399SH26      --------------------AILATEDEPQ--------KIYFTYN-----------PDL-
A0A501W1A9      ------------------------KVQEQP--------AVYFTYD-----------EAK-
A0A0E3ZGV6      ------------------------KATENP--------MIFFTYD-----------ESS-
A0A1I2N4S1      ------------------------TAVEYP--------AVYFTYD-----------QAT-
A0A2T5YE44      ------------------------TAAEYP--------AVYFTFD-----------QAT-
A0A1M5BA90      --------------------NIQ---D-TD--------RIDFVYN-----------KGN-
A0A512B879      --------------------MIV---EVVE--------RIDFTYN-----------KIK-
A0A559PPI3      --------------------EIVIEKDVPA--------EHYFTVD-----------FSK-
A0A1T5CS78      --------------------RISISNEEPE--------KHFFNYN-----------FNE-
A0A0Q9Z8F1      --------------------KISLSEDEPE--------KHFFKYN-----------AND-
A0A2N0U0M7      --------------------RISISADEPE--------KHFFKYN-----------AND-
A0A1V9FHD0      --------------------QVKETGDTDV--------LFSVNYF-----------PGPN
A0A4V4H170      --------------------DLKETGEVDV--------QFTVNYF-----------SDNN
A0A1V9F098      --------------------ELKSTGDSVV--------HFQVNYY-----------DDNN
A0A4R2VU64      --------------------DLKETGDSDV--------YFMVNYY-----------ANNN
A0A4S8HY23      --------------------ELKETGEVDV--------PFSVNYF-----------SNNN
A0A1V9F383      --------------------ELIETGDTDI--------VMSVNYY-----------TDKE
G8TRZ6          --------------------ELTETGDTDI--------AIAVNYY-----------SPKE
A0A4R5DL69      --------------------SDQIKRTEVT--------YKI-------------------
A0A1M4YED3      --------------------DLKRTEEIDL--------SVNATTN-----------VVTV
A0A2H3NSN0      ------------------------------------------------------------
A0A2P6C324      ------------------------------------------------------------
A0A7C2DZI7      ------------------------------------------------------------
A0A1M6XHU0      ------------------------------------------------------------
G2SF81          ------------------------------------------------------------
A0A5S9EYW1      ------------------------------------------------------------
D0MHQ9          ------------------------------------------------------------
A0A126PFG0      --------------------SVPRQHVL---------------DI-----------VLKD
A0A3M1N7Z3      --------------------SSPRAESLFW--------QGGRVRV-----------IFDA
                                                                            

A0A1T5MMH4      QKI-------------------SGRY-GAPVH-ISGIELTLRKNENFLDENDID------
A0A2W4R1L8      DQV-------------------SGKY-GEPID-LNGLTVTIHRNPAFTSESGLN------
A0A2E5CV79      ----------------------EEHY-TEPYS----------------------------
A0A2D4ZVH1      ------------------------------------------------------------
A0A0K8QSK7      VRVHDFVTGENIRTIPNVNIDETRLL-GERFS-GNDYSFAIRVKENAPSGLSGT------
A0A1V6CN82      VGVYNYSENRGAGYFPEVKIEQKVQS-GEEVVIPGQCSFKINLNEGFFPPVTDY------
A0A1M4XZ45      VAVYNYLDEKIVERLPQFSFSRDISA-GTKLK-AEQFSITILLNEKFNPNAANS------
A0A399D319      ISAYSYTEEEVVKRIPGYSFSRTIDP-GTKIT-SDEFSFTILLNELFDSNASNN------
A0A1V5IPN7      ------------------------------------------------------------
A0A1M6GR99      AMVYNYNTGHKIGERKDLEFSINGNV-GQVVE-TDDFKILVTINENDSLLSSDNRR----
A6EBM4          EDIRK-----------------NFRF-NSRIK-VGNVSFMIRNTAQAAPSSS--------
A0A7C5M4P4      KTVEE-----------------EHRF-DIPVE-NEDLKLTVHLQPIWNPSMGHE------
A0A1M6TTV4      TEGRP-----------------KYKF-GEMIS-HRLGELTIQKTSNFASQKNLVE-----
A0A4Q8RX32      CMLYDFQKERNDREVANFEMSQKFNF-GKTIE-SEYFKFTVLLKEGVALEEVSAND----
K0X1U5          ----------------------FFTT-LAEME-ATSFPIKVDYGEGIVIDKTEFYKPG--
R5EXK3          ----------------------FFTT-LVEME-ATSFPIKVDYGEGIIIDKTQFYEPG--
A0A401UAP7      KL--------------------TGNF-GKVVQ-MEGFKVLIESAKGYTYEPKNT------
A0A1W2GF52      GRIGE-----------------KQQF-GNPIV-TKDFSFTLEKTNFFDDQKNLID-----
A0A2G5L7B8      TSHRT-----------------RYPF-GKKIN-TAFGELIVSKTIFFKEQQNLID-----
A0A523GAC0      QIPDQ-----------------SCRF-SQ--T-IQNEHFALRLTMNLPLNEVDKDQL---
L8JW09          QEKAM-----------------KYNF-GEHAN-LPDIEFIIYLTNYF---DPKGDKN---
A0A364XUP5      RKI-------------------TGKF-NEPIN-LDASVVTIKRNPNFKESDEEIE-----
A0A1M5RLA9      QKT-------------------TGRY-NSKVS-LNGVDLYIEKNEAFRKGD-EIG-----
A0A385SFR9      QKA-------------------AGRY-NSKVS-LNGVDLYIEKNEAFKKGD-EIG-----
A0A5M4A9J4      PRTWDFRHRQAIHQYSDYSVTLPVRL-NEVIE-RSEFAFRIIPVNGATLPEGT-------
A0A5M4B1C7      PAIYNYENKTVLQKPEEIDKTIPFSI-NKTTT-DSQFSFCVVPKNGEPIPSGT-------
A0A0D3LFR6      NEVSN-----------------RYRF-GQAVE-TGSFNLTLTLLEGTTGDAINSN-----
M7N6D4          QEISG-----------------RHRF-GQTVE-TDPLTFSLSLRNGINKDIPESR-----
A0A4D7K1D4      VTQRF-----------------EANF-GKPLV-VNGGIITLFLTEHYSRGEGFDD-----
A0A5C7MX19      GEFER-----------------IYRF-GQDIY-SPSFKGVVIKKVPKFQKQDFRGV----
A0A1Q3ZMZ7      KTYTF-----------------PFVF-GKLIS-TPHFEVIINGDKESFSSSRDND-----
A0A2D8JJW3      GDFKDGCDLPKYRQLHVLNTRDYKPV-GWRET-FNSAISLFGLWPVSNQKKHDLVN----
A0A2W2AFF7      CNNVDW----------------KGKF-GQTVS-LPIGKLQVIKNPLVKADEEE-------
R7PCR1          FDSEFNY---------------KGTF-GRPFS-TPVGKIVLNKNSQYISEFVGKK-----
A0A1G9E2A9      EEIQG-----------------NFLF-DKSYE-NQHFRFEI--HKTRFFTVPGSIRR---
A0A098LL25      EEIKS-----------------EHYF-GEKIS-TDNYSFTLY--PTTFWSTNETGAK---
A0A6J4H627      KELSH-----------------TGTF-GHPIK-ARDFELVI--RKMPGFDPKASPGA---
A0A6C0GJI1      NDVSN-----------------TYTF-GQAVN-LDNFRFTI--DTTAQYSSELDNNK---
A0A2T2YJE8      QEITE-----------------EHTI-GKPVE-KPGFSFTL--TLRVPLSADVIAQK---
A0A127B287      KK-SD-----------------VHTV-GSPIS-LSGNNINVL--TNPSFSANHIGES---
A0A6P1P2P6      EK-SK-----------------AHTV-GTPIT-LSGNNLVVY--TNSRFNTNHIGES---
A0A3M9N829      ERLV-------------------ATV-GQPVN-ISGNNITI--TTTSSFSSAKVGET---
A0A0P0CSF9      NQSS-------------------YTV-GNPIT-VSGSTFSI--NPVNNFSSSNVGIV---
A0A5M8QQB8      TPSS-------------------HAV-GEPVS-VVGSRVTI--KTAPSFSSASVGVE---
A0A3M9MNC3      KHSS-------------------HAV-GVPFA-LSGSTITV--NSLPSFTSVNVGET---
A0A5B6TAX2      SHTS-------------------HIV-GVPFK-FSGSTLTV--NPSSSFTTSNVGET---
A0A5N1IQ33      QEAGG-----------------EYRF-GQPIS-TPQMELTIY-RTSPATGAEELKVN---
A0A512AYT3      EEISG-----------------EYRF-GEKID-KKEISLTLY-PNN-NFNEDAQGRK---
A0A5M6CYN7      EEISG-----------------DYRF-GEKID-KKEISLTLY-PNN-NFGEGTLDGK---
A0A369QP10      QEVTE-----------------EHTI-GEPVQ-KPGFTFTL--KLTAPLNSDILAQK---
A0A126PDF2      TALDG-----------------EYDL-EKQVS-LPGLDLKVT-PT-QYFGPASLIAK---
A0A2Z3GKA1      AALDG-----------------EYNL-GQQVS-LPGLDLKVT-PT-RYFGPATLTAK---
A0A502GZP7      ATLSG-----------------EYAV-GQQVT-LPGLDLTVT-TT-SYFGPATLGEK---
A0A519SBU8      ETLTS-----------------TRAL-GQWAK-LPGIDLLVE-AAPDQTIPTSESSP---
A0A4Q3JNZ3      QTLAG-----------------TYTV-GQWAT-FPGMQLLLE-AVPGRALPVGDDPQ---
A0A519Q9V3      QTLTG-----------------TYTV-GQWAA-FPGMQLLLE-AAPGRTLPVGNDPQ---
A0A0M3RW20      NEIKE-----------------EKVV-GSAII-QPGINLQLN-LT-PQFSSDVIGKD---
A0A495VFX4      EEYTR-----------------EYKV-GDAII-LPGIHLKLV-KA-PYFSDEAIGRD---
A0A1S9B3W0      GETEG-----------------EYRF-GQPIT-TPGFTLELQ-PT-KHFNPQDTEGA---
A0A1W1VRL3      QEVSG-----------------VYSV-GQPLN-LAGLDLRLT-THGTYFDANALDAQ---
A0A1M6R305      QEQTS-----------------EHTV-NQPFR-IGGMTLRLR-PT-AYMGATTLDNN---
A0A4Z0PHK3      QERTA-----------------DHAL-GQPVL-VPGMELLLT-AT-PLLTDESREKN---
A0A2M9B9H9      QERSA-----------------TYTL-GQPVV-VPGMTLVVT-AT-PLLDEEALEKN---
A0A4Z0QCY9      QEKTG-----------------DYTL-GQPII-VPGMELKVT-ST-ALLDADAREKN---
A0A418R9X5      ASATQ-----------------ALKF-GQPID-IAGFTLYMY-KT-AQYEGANRDAN---
A0A428JSJ3      GSETS-----------------ALTF-GQPFQ-AAGFTLRVY-KT-AQYTSADRDAT---
A0A428KI59      AAETG-----------------ELSY-GQPIE-AAGFTLQVY-KT-PQHASADPDAN---
W8F1I6          GTETG-----------------ELSY-GQPIE-AAGFTLQVY-KT-PQHANADPEAN---
A0A246FQC0      GGGEQ-----------------EYRF-DEPFT-AAGFRLVIS-KA-ANYNESVLEEQ---
A0A372E5P8      GGTEQ-----------------QHTF-GQPFT-AAGFRLTIR-QT-KDYNLAALDGQ---
A0A1H3EMW1      GGGEQ-----------------QHSF-GQPFT-VAGFRLTVR-PT-REYSPEALDGE---
A0A1H9ZSN3      GGTEQ-----------------QHTF-GQPFT-VAGFRLTIR-KA-ADSGAAAPEGQ---
A0A5N1J2M4      KTNTG-----------------EYGF-GEIIS-NNDLDLKVL-K-TNTFSNQVINQH---
A0A519S476      QTLTG-----------------TYPV-GTWAK-LPGVELVLE-AVPGRPLPTAEAAQ---
A0A4Q3JRW8      QTLTG-----------------TYAV-GQWAS-FPGMQLLLE-DVPGRALPVGDDPQ---
A0A519M923      QALTG-----------------TYPV-GQWVT-FPGMQLRLT-PVAGRALPTGDASP---
A0A4Z0ENW1      TTLGG-----------------NYEF-GQLVK-LPGISLQLL----EILVPTQLDAT---
A0A519UDB4      NILTG-----------------NYAF-GQFVK-LPGISFRLLLTSPEGLNENFSENP---
A0A3S0QKV1      QEIDG-----------------EYQL-EQPVT-TPGFNLRLV-P-TKYFSGQLADAT---
A0A328BL48      AEQGG-----------------EYSF-GETLT-TPGFTLTLV-R-TRFFNEQTPETK---
A0A5R8WLY4      GEQGG-----------------EYRF-GEPLT-TPGFTLNLT-R-TRFFNEQTPETK---
A0A1I5WSL8      RPTSG-----------------EYAL-GQTID-LSGITLQIV-GTPAL-KGDVQDEN---
A0A0U3JVM7      RPLGG-----------------EYSL-GQEIK-LPGITLAVL-GTNEL-TNAAQDAS---
A0A1G1SSV2      RPLGG-----------------EYAL-GQQIT-FPGIQLQVL-ETESFAANNTADAS---
A0A1G1SXV7      RPLGG-----------------EYAL-GQQIK-FPGIQLQVL-GTKNLVTDTPDDAS---
A0A6G8CBJ6      EEVSG-----------------DYAV-GQPIN-LPGISLKLT-TDSSFFDASALEAQ---
A0A0W8EDI5      GDVRV-----------------DGVF-NQPLK-IGNSFIVLK-P-TEQAIQPNI--P---
A0A3B7RBP8      VEQKV-----------------NGKI-NQTLN-IEGSSISVY-S-TNKSPQAGV--N---
A0A3R9P8H7      GGGVQ-----------------EHTI-GTPFT-AGGFRMEVR-K-TPQFNDKAFEGE---
A0A238WIA7      QEVVK-----------------ETGF-DAPVE-TTGFRLRLY-R-TAFYQPSDLERN---
A0A212UCJ7      QEVIQ-----------------KAIL-GNQIE-TLGFWFRIY-P-TSLFRPSDTERN---
A0A4Z0MQE1      QEKSQ-----------------KAAV-GDPIE-TAGFTFKIL-Q-TPLFRPVDTDRS---
A0A4Z0PCF4      QEKTD-----------------KANI-NEVIE-TAGFRFKIQ-Q-TSRFRPTDVERS---
A0A6M6BED0      QERTE-----------------KAAI-GEIVE-TAGLRLKIE-Q-TPLFRPTDVDRS---
A0A5D6VDG1      HEATS-----------------EYAI-DVPIE-LPGITLYLS-K-NKNFTEDALNRS---
A0A6H1CVS0      HETAA-----------------EYTI-DTPIE-LPGVTLRLA-K-TKNFTEDALNRS---
A0A243WHR7      QEISA-----------------EYRF-GQPIV-TPAMELVLA-S-TPWMNESVVGKK---
A0A5B8A0P6      QEVNR-----------------EHSV-GQTIS-TPDMVLAIT-T-TPAFNDQAINKK---
A0A076HRT9      QEQGG-----------------DYAL-NQPIR-LGGMTLRIL-P-EGKIDASVIERN---
A0A4Z0PVM7      QEKTG-----------------DYTI-GQPVV-VPGLELRIT-T-TDLMNQEARDKN---
A0A1M6DHW8      QERSG-----------------EYSL-GQPIV-LPGMELLFI-G-TSFLNAEALDKK---
A0A4Q5LC61      QEQSG-----------------EYSL-GQPIV-IPGMEMRIL-A-TPLLNAEAQDKK---
A0A2N5YXE2      NQDYEY----------------LISP-EEWQS-VFGMEVFIHFPSKKDMEFELNPDNK--
K0XJ09          KKSDNEGQ--------------EFLF-GDTII-SAAGRFIVEDIPDKISAYYNVP-----
R5EUZ0          KKSDNEGQ--------------EFLF-GDTII-SAAGRFIVEDIPDKISAYYNVP-----
W0EQS0          VKSEDREQ--------------EIAF-GDTLV-SEAGRIVVEAVPEYLPAYYNIP-----
A0A1Y3WE15      GKKSESEQ--------------EIAF-GDTLV-TNAGRMVVTAVPEFLPNYYTLL-----
A0A1Y4GUK3      KKTNEGNQ--------------QIAF-GDTLV-SDAGRIVVESVPEFLPAYYNVP-----
A0A2U1FKU2      GRGLSGMEV-------------DGTF-GQPVA-TPVGELQIDQTPFFVAAWKGQV-----
A0A0A2F954      RNGIGDIKI-------------DGSF-GRPIA-TPVGELKLDTTLFFADSWKGEV-----
A0A0A2FW91      RNGIGDIKI-------------DGSF-GRPIA-TPVGELKLDTTLFFADSWKGEV-----
A0A2D2N2N1      RNGIGDIKI-------------DGSF-GRPIA-TPVGELKLNTTLFFADSWKGEV-----
Q7MWZ2          RNGIGDIKI-------------DGSF-GRPIA-TPVGELKLNTTLFFADSWKGEV-----
T2NDT6          RNGIGDIKI-------------DGSF-GRPIA-TPVGELKLNTTLFFADSWKGEV-----
W1R7P9          RNGIGDIKI-------------DGSF-GRPIA-TPVGELKLNTTLFFADLWKGEV-----
A0A1R4AFZ0      RNGIGDIKI-------------DGSF-GRPIA-TPVGELKLNTTLFFADSWKGEV-----
A0A1R4DVZ7      RNGIGDIKI-------------DGSF-GRPIA-TPVGELKLNTTLFFADSWKGEV-----
A0A7C0WKI7      ------------------------------------------------------------
A0A2A8CVM9      ------------------------------------------------------------
A0A5M4B212      AIRYDFQNEKELKPAREIEQTRTFPV-NSYVA-SDDYAFRIIPAADTQLEGS--------
A0A3D1KEX9      SDVDFKQ---------------VVSY-GQSFN-SPAGNIRISQA--------EFDPEF--
A0A358Y7S2      AKNKL-----------------KLKP-NSRFK-NPQFDIMFKVK-NIDELKEHCAENE--
A0A1X7J248      EEWVSQ------------------KF-GQEFI-VDGCKYKLEITPHFFNTES--------
E4TQD2          DQWINQ------------------KF-GEYFT-FNGCGYKLETTPHFFNTER--------
A0A2J6HHN3      GSMEDK----------------SFQP-YESVV-LPKVIFSVEPVDTVNFMQKFKNRE---
A0A1Y3WMT8      ----------------------FFTT-LAETE-ATSFPIRVDYGEGIVIDTTRYYNPD--
A0A1Y4GQU1      ----------------------FFET-LAETE-ATSFPIKVDYGEGIVIDKTSYYKPG--
A0A6A0R272      IRDTSI----------------NLTY-NQPFK-IFEESYSIDRV-----YSEPLKSIE--
A0A1V5W8T5      EKSIKH----------------EIKR-NEWTQ-IQGLKLYVNII-NVEQILENKGNK---
A0A2T8HKA9      NIIHSQ----------------RIKL-REETT-TPIGKLTISSNKLYKPSIFGEE-----
A0A2I0QZ80      NKAHHI----------------AIQP-NEILK-NNLFDIKMKVN-DFQELKTDAETNQ--
A0A3E1F1A3      GVDYNY----------------KFIP-NSLVQ-TPFFKMRVDIL-NWNQFKTNSSNNK--
A0A2U2XBJ3      GGNYNY----------------KFAP-NSLLK-TPFFDMRVIVD-NWSQFVLNSTSNK--
A0A4Q4KU94      GGNYNY----------------KFSP-NSLLK-TPFFDMRVSID-NWDQYLANTTSNK--
A0A3B8INU3      EDVQPE----------------EHRF-GETLS-VPHLDLRLEST-------SHLNSSY--
A0A2W1NDY9      QKKNEI----------------PVAH-DQLVD-NEYFKFVFKIN-NEKVFKADLEKDD--
A0A5C8AQR5      GQKISI----------------NGSL-NDVIQ-NNHFKIVVKTA-SIGAFKFASEANQ--
A0A1G0CI31      GKSYSM----------------LKPI-NSRFS-NQHFDIAFKVD-NIENLRSDDEQNE--
A0A556N0M0      GQTYSK----------------TSEI-NKTIH-TRHFDIAFKVE-NWNILKQDDEANR--
F2IKD6          GRNYSK----------------VSAI-NQTIK-TSHFEIGFKVN-NWQSLKQEDVSND--
A0A1I7BM74      GKEYIE----------------EVFL-NQAHK-NEFFHIFIKSE-NEEVLKRDINDNE--
A0A2G2FJ17      GERLKW----------------DIES-NKLLA-TPYFDLEIEIP-NWESFVTDAETNV--
A0A2E3R1D0      ------------------------------------------DDPSTP------------
A0A2T2USC0      ----------------------SDTS-EQSAS-ETVAGLLMSPEEERR------------
A0A2T2V0F3      ------------------------------------------PEGERR------------
A0A2T2S682      ------------------------------------------PSGEGR------------
D5H561          ------------------------------------------WAGQGTGGAEGGASGD--
A0A2H3NWA9      ------------------------------------------ETQERL------------
A0A2A8CVB6      ------------------------------------------VEGNRL------------
A0A2P6C1S6      ------------------------------------------PEGEQR------------
A0A2T2UTM4      ------------------------------------------PEGKRR------------
A0A414ZBF2      DFDEVV----------------TVQM-GDTTD-TPVGKVVVASTLFMNEEYMGKP-----
A0A1Q3Q573      GDEFEK----------------EIKP-EQKLK-TPYFQATISLK------PDKLSDGS--
A0A662BAY3      AAIFDFLNSEIVTYVTNLSFSKEAAY-NEVIK-TDYFSFIIKPKRERNKIETAT------
A0A4U3L369      KQVV------------------TGTY-GDTVH-YNKFVFYINRNKYIKIDKDNEDK----
A0A357YNR3      YNFSVE----------------YNKN-NFHYN-LSPGDSTLKFPFGEIEVATTPIIHS--
A0A5E8AX52      QSGAS-----------------RHKF-GETIS-TPDYNLLIEKTENFAEDNGIGK-----
F4KK08          KVQEPI----------------AATL-GDTIA-TPIGKVVVEAT-------PYYSNFP--
A0A6B5PK86      GKAYTV----------------KGKL-GEHLI-SQHFDVVVKSE-NISAFLEETESNE--
A0A2G2F510      GETKVV----------------KGYV-NEHLK-NEDFDVVVKVI-SDDALRDASTINE--
A0A316JZ08      GKNVKL----------------KGPL-NKHVT-NDDMNVVVKSA-NPKVFRKMASENE--
A0A496LCF9      NEIETI----------------EGTF-NEPIG-CKYFLVKVIPNSDFMDLKT--------
A0A5P2G2A9      EDDSTF----------------FVKW-GDSIP-LSKGKFVIYKQTFFDKKKAN-------
A0A3C0ZQC7      SGPEDI------------------------------------------------------
A0A419VXB7      NLLGINTEVDFEG---------TGVF-GEKFE-NRYFSFTLQKK-----------VLP--
A0A0B0BTJ4      QKTTEKTI--------------TGAF-GETIR-DTVGVFRLERAVATAGYNPKAANS---
A0A3B9CNN6      QKTTEKTI--------------TGAF-GETIR-DTVGVFRLERAVATAGYNPKAANS---
R5X290          QKTTEKTI--------------TGAF-GETIR-DTVGVFRLERAVATAGYNPKAANS---
A0A1Q6E6I7      QKTTEKTI--------------TGAF-GETIR-DTVGVFRLERAVATAGYNPKAANS---
C3J7R8          ARGTTS----------------QVQI-GVPQD-TPMGRVLVTATEHFPSSEASFS-----
A0A1G8BVM8      TRDDGEIISNDVVD--------DISL-DSVVA-FSHGKIKIKPTIFMHSGYIGQN-----
A0A1I1FXP9      NVNYSR----------------NFNF-DKTYE-NQDVKFKITKTPFYKPDVINYE-----
A0A3N4H5N3      KA--------------------EFEF-NEKIR-TNFGVFSLVKKEEEGERLESVSS----
A0A2P8EAX2      KT--------------------EFNF-GDKIK-TEFGVFSLEKKSEEDAISFPFST----
A0A4V2F6N9      KA--------------------EFNF-GDKIK-TEFGVFSIEKKSEESAVSFPFST----
A0A3B9FXJ0      GETWSQ----------------ELEY-NKPYS-TPAFSISVSRNGKGKVLAES-------
R5GSU5          EDCRIDK---------------VVAY-GQRIA-TPAGNVYLTRKMNLEGLEPTTVTVS--
A0A2A3UE91      ----------------------NFAL-NSWLK-TADFDINIYLN-PNIQASVINEIVK--
A0A0A2G557      EQLSSAPKM-------------IVSL-GETIE-TPIGSFFLTSN-TIATSKKEP------
A0A2N2WFW8      GTESET----------------EFRF-HETVS-LPQVNFLLT---PVAGDAKSFFAAN--
A0A1F3IU95      GIQTDK----------------SFRF-HEPVS-LPQVNFVLT---PINNDAHAFFKSN--
A0A3D0VUF6      GIQTDK----------------SFRF-HEPVS-LPQVNFVLT---PINNDAHAFFKSN--
A0A1T4PT95      --DFSK----------------TSPL-SDRVV-LFGETIETPIG-SFVLTGNPSTEVE--
A0A6I6JYY3      AEVYSYSEDEVLKKISNFSFSKDMDP-GVRLT-ANEFSFTILLNEKFDPQAPNE------
A0A2A4PYG9      EEQFNK----------------PIXI-GXWXA-LEHLEVKIDVT-DFSLISTQQNQFA--
A0A1F3K695      EENHEF----------------AIYS-NVWSN-IGLAEIKLKID-DTSQIQAQLSDLK--
A0A353KZR1      EENHEF----------------AIYS-NVWSN-IGLAEIKLKID-DTSQIQAQLSDLK--
A0A2N2WYB5      GYDQK------------------IEL-NQWTA-IQGGEIKVSIL-NIDDIESQQEYYK--
A0A1F3K4G0      GVNASY----------------PIEI-GKWSA-IRADSIRCTVS-DYLTIESQKENYK--
A0A356H8Y3      GVNASY----------------PIEI-GKWSA-IRADSIRCTVS-DYLTIESQKENYK--
A0A351HSA6      GVNASY----------------PIEI-GKWSA-IRADSIRCTVS-DYLTIESQKENYK--
A0A1F3Q014      ETEQQH----------------NFIS-NKWMK-FPEMDLFISIK-NFTEIANEQNVVK--
A0A2D5KD44      -KESSV----------------DFYA-GKSCH-LPFAEVIVTVT-DYSRIKKEVEAVK--
A0A6N9NIX1      LEVNNY----------------DVTF-NEWVG-VPEGRIKIIIK-NFDFIKNFNNQIK--
A0A2A4YXP3      NKLVLG----------------EYQT-NTTIH-LPKVDLKITLL-RKE----NYEILK--
A0A1F3R158      NEKLIG----------------EFSD-REKIQ-TNLAEFTVIFN-NYEEAKNAQSDIK--
A0A2M8ADX2      NETFLG----------------EFIN-NQDIK-LSKVDFKISID-GYEELKKSQSDIK--
A0A1J5B2H0      NSKIEK----------------TFGL-TEKIV-FQDVDLDVKVT-NPEVVFNKSGILN--
A0A1V5N756      KSN-QY----------------EFSI-LDTLK-TEYFDMFVTLK-DPG-YFKNISFID--
A0A651GU15      NNAISD----------------PFLP-NDYVR-TRFFEGRIDLAPPLEENSDKGSYNE--
A0A3Q9FR88      EQQIEI----------------AGKS-GQRFS-LGGRPIIIRSK----------SPNV--
A0A553GEX3      EQENEI----------------EGKS-GQRFS-LGGQPIIIRSK----------SPNV--
A0A150ADJ9      KS--VV----------------EGIS-GKPLF-FEGADIIIEPN----------SKST--
A0A1B1FWQ4      QTEKEI----------------KGSS-GESII-LGGQSLIITPK----------NKIL--
A0A1S1Z228      DQENTI----------------SGKS-GEQII-LGGQPLIVTPK----------NKIL--
A1ZKR2          TQTVKK----------------TYRF-DQPIV-TSYYSFKVI---KTSFYKPAFRQIP--
A0A1Q3GX01      TNLKKQ----------------IYKF-DQTIN-HSGLSFKVI---KTPFYKKRFHNIP--
A0A349DQI4      KVLNKQ----------------VYKF-NQTVK-YPGFSFKVI---KTPFYKKRFHNIP--
A0A4P5TMD1      KVKYSF----------------NGKF-NQKTI-TPHFNFIAKLT--AHDFKNNPNVYL--
A0A2N3IIZ0      KTLAEY----------------KGKF-GEWLK-NKDVELLITQKMPLSTYSEN-------
A0A1F3SJM1      GKKKTI----------------RGNL-NEHFV-NDDMDVVIKST-NKQLFISTSQNDD--
A0A2G2EB96      GKQVIL----------------SGKL-NERIK-NEDFDVVVKAT-DPHSFYQVSKENE--
A0A2G6PRA9      GEKQRV----------------EGML-NEHIQ-NSDFDIVVKAA-DPDNFHKVSKEND--
A0A497D5Z2      VPVYDYLNDKVIKRLPDLAWFGEGDA-GTPVG-TDNFSFTVYADGNANYDLNNYDE----
A0A662B170      VPVYDYLNDKVIKRLPDLSWFGEVDA-GTPVV-TDNFSFTVYADGNANYDLNNYDE----
A0A2A5FYT6      DSVYSR----------------EAPI-NEIII-LPHVNLRIKDV-DFIQITTSKKQLK--
A0A2E6SYP1      -PSSNT----------------IVPV-NTWTD-FEGLALKINIS-NINQNKLSDQNLK--
A0A2E5RLE8      -DSGTV----------------LIPV-NKWVS-IDGLELKINIS-NRKLNELNNSGKK--
A0A2E7TQF6      -DSGTV----------------LIPV-NKWVS-IDGLELKINIS-NRKLNELNNSGKK--
A0A2E6GVY9      -DSGSF----------------IIPV-NKWIS-INGLELKINIS-NRNLNDLNDSGKR--
A0A350JJ90      TKSFSE----------------KFAE-EDTIQ-TPHFSFTIV---RLDEAQAQSSGLT--
A0A3M1CDV2      DNLIQI----------------PFHI-NTWTK-HEWLDFFIRLN-EKRDTTSIRKDLY--
A0A6C1QGZ7      GQSKKY----------------EIHV-NGPNS-LPEMDIIINVH-NFNMIREEQSLFS--
A0A4P5U6G4      QQKFIY----------------NGSY-GKKIR-TPHFDFTANT--DQEVLKSNIESLK--
A0A2E2TFD1      GDANYQ----------------VFKI-DGDIE-LPFVTLSIKIL-DFDIIKNDQETGT--
A0A2E4ELE6      ETVEKR----------------LSTN-KWE-D-LGFVELKFIII-DFDIIKSEQTDLS--
A0A522EYA6      DQIKTH----------------KFKQ-GTAVS-APEMNFTITVL-NFPEIQSQQNAVK--
A0A2E3XZI5      EKIYAE----------------YIEA-NKFFS-SKYISGILKIDWELEEFKKNLEKSN--
A0A6I7QXV0      RNRIRE----------------TLSF-DRFFE-NNYFILKASLT-ESAAEQIHSHVGE--
A0A2M7NLQ9      GEDFSK----------------IYKF-NTRIK-NQYFKLIISLS-DTFDKLKSTSDS---
I4AFR0          GDNFSK----------------IYKF-NTRIK-NQYFTLIISLN-NTFDKLQSPSSN---
A0A2N2Y3E5      SSAEKV----------------KIKT-GEWLN-FYGSWLRIEIR-DTAALLEYENMLK--
A0A2D9D7T6      GQSKKI----------------SGEL-NKPIK-TKSFEIIVKAK-NKFGITEINKNNR--
A0A1F3PPL5      DLEFE-----------------NLSV-GKWEN-INGIDVKVTIT-NYKGIEELHKSLN--
A0A357QK06      DLEFE-----------------NLSV-GKWEN-INGIDVKVTIT-NYKGIEELHKSLN--
A0A662AEA4      GNEYKY----------------ELKT-NTWNL-ICGGEIKLNIN-NYKRIELQQSNLK--
A0A0S2HYK8      GETYSY----------------PGEA-GKWTD-LGILSCKAEIL-RYNVIKSMYESAK--
A0A2N5ZWN6      DNIITK----------------DIEI-NEWNE-LGYFKIFVTIN-NFAAIQSMYEKES--
A0A2E0FJ09      EETFEF----------------NESL-NESFS-TEHFICSIQIS-DLNRFYAQQNDGE--
A0A1F3FZ62      EKLNIR----------------EFYF-NETVK-LPEMEFVLKLN-PKSSIKTDLNADE--
A0A1F3K211      EKLNIR----------------EFYF-NETVK-LPEMEFVLKLN-PKSSIKTDLNADE--
A0A1V6I2U9      NQKYEY----------------TIQP-EELQT-IYGMDIYVHFP-SKKDLEQELDPQN--
A0A2H0B957      NQIVQK----------------SLKS-NAWTD-IGGFEIILNIT-DLAAIREQSNKIK--
A0A1F3CFW6      NTNFEK----------------TIKK-NKWTD-INGLEIKIEVT-DIDAIRTQINKIK--
A0A2M7E2T8      NTNYEK----------------TIIK-NQWTD-INGLEIKIEVT-DIDAIRTQINKIK--
A0A2M7NC69      NTNYEK----------------TIIK-NQWTD-INGLEIKIEVT-DIDAIRTQINKIK--
A0A1F3KLL5      GVKSHY----------------SLKP-DRWNK-INKTEIKININ-NIDDLLADKQNLK--
A0A359D1M1      GVKSHY----------------SLKP-DRWNK-INKTEIKININ-NIDDLLADKQNLK--
A0A0F2NS19      --KLIG----------------EFSS-NVPIE-LKEVTLRIVFD-NYNEFGADKNNS---
A0A2A5H8X6      --KLIG----------------EFSS-NVPIE-LKEVTLRIVFD-NYNEFGADKNNS---
A0A2H0GAU8      --TLLG----------------EFEV-DTPIK-LKQVDLKIQID-EYESLKDVKNNK---
A0A2M8FTK1      --TLLG----------------EFEV-DTPIK-LKQVDLKIQID-EYESLKDVKNNK---
A0A2A5B3B0      --KVIG----------------DFNV-NETIN-HPKVELKISLL-DKDLYVTPQGGD---
A0A5C6RXM7      --EILG----------------VFKS-GELIV-IDKIDFKIKIL-KEKV-TDFIGAV---
A0A1F3C1M2      EKTIEK----------------KFTI-GEWID-LDLIEFKLTVN-NYNAILEEHDELT--
A0A1F3DS87      DKKFER----------------KYTI-GEWID-LSLVELKLTVS-NYTAILEEHDELK--
A0A6A0R6K9      VRQNVH----------------FNQK-VELPF-AHLVISINNYE-HIKNETTAVKPIS--
A0A2E7CT70      QKSYAK----------------FIKP-GDFFS-SNYISGKLIID-DIPTFSESLDKFN--
A0A2D5V560      EIIYAK----------------YILP-NKFFS-SEFISGKLKFS-S-NNWKDNLNSMS--
A0A2D7K5A8      EIEYAN----------------YILP-NKFFS-SKFISGKLSFS-N-GNWKDLLSSLS--
A0A2E1XQ82      EIEYAN----------------YILP-NKFFS-SKFLSGKLSFS-N-EDWKDFLSSLS--
A0A5C8A5B4      QEVLPE---------------LIEKY-EVDQV-VPMDSMFVGDRLSFRIKFPEDRMYD--
A0A4Y9ITE2      ---------------------SGKTF-PAKFD-TPYGDFVFQKKDAFYEEG---------
A0A5M8NYX7      ---------------------FQKTF-KIDEE-INSPWGTLTFEKNPFGTG---------
A0A3D5KRY6      ---------------------KEQTL-GEAFK-NEFFQFTISAKTGVAPQE---------
A0A0E3V905      ---------------------PYGRL-KIVTK-KQTF------------DS---------
A0A553ETH6      ---------------------KTGEL-VSTPQ-LNFT---LELTEHYDENG---------
A0A640Q161      ---------------------IVEAL-PFLPQ-DDPK-------------E---------
A0A640QU49      ---------------------LTEWL-PFLPQ-EEVK-------------T---------
A0A1Q3PII2      ---------------------YKGTF-GIPMA-LPHG-LSIIDTTRFKPAS---------
A0A351BXT2      ---------------------DKKKF-YYILN-HGEN-----------------------
A0A2K8Z965      ---------------------PYGRL-KIVSR-KATA-------------R---------
A0A418M8U8      ---------------------PQGRF-LIKTR-RSVG------------DT---------
I2GTA4          ---------------------PQGRF-LIKTR-RAVG------------DT---------
A0A2K8ZAJ2      ---------------------PYGQL-RIFVR-KPLS------------SK---------
A0A368JPA3      ---------------------PFGRL-QIFIK-QPVV------------YT---------
A0A5N1JI29      ---------------------PFGRL-QIFIK-QPVV------------YT---------
A0A3P1BT12      ---------------------PFGRM-QIFIK-QPVV------------YS---------
A0A3P1CI15      ---------------------PFGRL-KIFIK-QPVV------------YS---------
A0A4R8CUK1      ---------------------PFGRL-RMLVN-EPVD------------YA---------
A0A3D0MYJ7      ---------------------LRKRL-EGMAS-ITAP-----------------------
A0A662AH13      ----------------------------KPLK-SVPAIAKMLEDTKIEQK----------
A0A5C7QA01      ---------------------LQAQL-NKKVK-IHNRMGLWTVEINSKDIQ---------
A0A3D3LS70      ---------------------LTELL-GGIVS-ISQK-----------------------
A0A1G1TM36      ---------------------TRHAF-GRPIS-DSLGTWQLNATASLRGFE---------
A0A1G7ZF38      ---------------------YKGSF-GKKLS-LPHG-AAIMDTTRFKPSS---------
C6VS52          ---------------------FRGRF-SSPLA-LPQGVAVIVDTTRFKPSA---------
A0A7C1LGX3      FTLFYKQSE------------------NALKT-SPFRILMIDTLQNLNL-----------
A0A2A4G4B1      EE-------------------MPLHF-NKEIG-YENVRFRIIPLLDINAL----------
A0A0P7X1V8      ----------------------------------PEDSSIVTADTVFA------------
A0A6P1P355      ---------------------KAYPM-NTWVN-TPYGELMFLPNDNKRDT----------
A0A5C8KAD6      ---------------------MKYPL-NEWVD-TPYGEMKFSKNKNMLFA----------
A0A5N1J695      ---------------------KEYPL-DEWVR-TPYGIMLFQRNEKQSAA----------
A0A3B0C2S4      T--------------------VVGLAEKDTVP-IQLPFNITFLENAQPIAY---------
A0A3N2M1H3      IELAGEATL------------PKG---KESVK-TPIGIVKVTPNPEY---DGLPIT----
A0A4S2G8T2      IELAGEATL------------PKG---KESVK-TPIGIVKVTPNPEY---DGLPIT----
A0A212K7W5      ELDFPD---------------EEINL-SESVN-TPLGSIRINPTAFYS--KVY-------
F5IU11          ELDFTD---------------KEINL-SEPVN-TPLGNITIHPTAFYS--KGY-------
A0A7C1QWC7      G--IQVYSD------------TVCKF-NQTVT-TPYFKFSVTRDLNTT---GSNKG----
A0A352Z1R7      G--------------------SSGRL--------------MQAKGFSLLLNDLKGE----
A0A3N2N6F7      GNELDV---------------MTVTL-GDTVS-TSFGRMVISAGPNFS--P----D----
A0A4P7VVU7      ECDPSE---------------MTVNI-GDTVA-TSFGPITINPGPAYA--K----R----
A0A2V1ILM4      ECDPSE---------------MTVNI-GDTVA-TSFGPITINPGPAYA--K----R----
A0A3N2L0E8      ECDPSE---------------MTVNI-GDTVA-TSFGPITINPGPAYA--K----R----
A0A3N2LFC5      ECDPSE---------------MTVNI-GDTVA-TSFGPITINPGPAYA--K----R----
A0A0A2F501      E--LQTQR-------------ITCSL-GDTIS-APIGKLVIVRSESYL--ADKSKT----
R5B7P0          K--VGGKP-------------VVGHY-GDTLQ-TPVGRIIVQKTKDYS--GEA-------
R5B0L5          P--VDLPNS------------GVAIP-GDTIR-TQSGNLVVSLTGRGN--P---------
A0A6I1TEC0      P--VETNKT------------VTGKL-GKLVQ-TPLGKVKLEAAPSYA--AFIKGS----
A0A3R5XWG1      P--VETNKT------------VTGKL-GKLVQ-TPLGKVKLEAAPSYA--AFIKGG----
A0A5P0Y910      P--VETNKT------------VTGKL-GKLVQ-TPLGKVKLEAAPSYA--AFIKGG----
A0A414YFM3      P--VETNKT------------VTGKL-GKLVQ-TPLGKVKLEAAPSYA--AFIKGG----
A0A6A7UIA7      P--VETNKT------------VTGKL-GKLVQ-TPLGKVKLEAAPSYA--AFIKGG----
A0A6A7VPS3      P--VETNKT------------VTGKL-GKLVQ-TPLGKVKLEAAPSYA--AFIKGS----
A0A374THP7      P--VDDSDE------------ISGRL-GQIIH-TPLGKIKVDKAPSYS--QFVKNG----
A0A6G1VND1      P--VDDSDE------------ITGRL-GQIIH-TPLGKIKVDKAPSYT--QFVKNG----
A0A0A2EVS5      P--MGEGQI------------FLGEL-VDSIP-TPMGIVRVGLNSAYS--DEKSIQ----
A0A1T4NAJ7      P--MGEGQI------------FLGEL-VDSIP-TPMGIVRVGLNSAYS--DEMSIQ----
A0A255T941      DGKVEYDKE------------VKGNI-GKVVM-TPIGQMTVHGTKTAR--EDF-------
A0A3N2KCL3      K--SEER--------------VQGAM-NDTIM-TAVGPMVVVAAEGYK--PG--------
A0A4P7VSV0      K--SEER--------------VQGAM-NDTIM-TAVGPMVVVAAEGYK--PG--------
A0A2V1IJY1      K--SEER--------------VQGAM-NDTLM-TVVGPMVVVAAEGYK--PG--------
A0A4P7VXK7      K--SEER--------------VQGAM-NDTLM-TVVGPMVVVAAEGYK--PG--------
A0A1Y4CHN5      E--SDAE--------------ATGKL-NDTIE-TPVGRIVVSTTPYYS--GTF-------
A0A1M6I2S6      E--LETE--------------FSGKM-GDSIR-MEVGTFVINPTKYWN--DSF-------
A0A1Y3V692      E--LETE--------------FSGKM-GDSIR-MEVGTFVINPTKYWN--DSF-------
F3PXM2          E--TGET--------------FSGKT-GDTLR-TSVGTLLIDATPYAT--DDF-------
A0A174AHH7      E--TGER--------------FEGNI-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A174JCE8      E--TGER--------------FEGNI-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A3E4JMC4      E--TGER--------------FEGNI-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A412SND6      E--TGER--------------FEGNI-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A414IEQ9      E--TGER--------------FEGNI-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A6I0U0V8      E--TGER--------------FEGNI-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A6L5S9H7      E--TGER--------------FEGNI-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A0M1W8D8      E--TGER--------------FEGNI-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A3R6GKX5      E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A7V4S1          E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
B0NU19          E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
D4V601          E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A0A4Q0U3M9      E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A0A4R4H1Q2      E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--IFF-------
A0A6I0GII7      E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A0A6I0KYU7      E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--IFF-------
A0A397WLT5      E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A0A6A2J529      E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A0A6L6P8N9      E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A0A6N8DDD8      E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A0A015XH67      E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A0A078RZN2      E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A0A4R4I3T9      E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A6L0K5          E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A7ACT5          E--TGER--------------FEGII-GDSIQ-TSAGTLAISLTSQYE--NFF-------
A6KY94          E--TGER--------------LEGII-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A173UQR8      E--TEER--------------LEGII-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A3R6HK75      E--TEER--------------LEGII-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A412B7D1      E--TEER--------------LEGII-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A412VNY9      E--TEER--------------LEGII-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A414LTU9      E--TGER--------------LEGII-GDSIQ-TSAGTLAISLTSQYE--NSF-------
I9Q4U4          E--TEER--------------LEGII-GDSIQ-TSAGTLAISLTSQYE--NSF-------
A0A373ISF0      E--SENT--------------FAGRM-GDSIQ-TVAGTLFISPTKFYS--DAC-------
U6RF62          E--SENS--------------FAGRM-GDSIQ-TAAGTLFISPTKFYS--DAC-------
A0A662ZZD5      A--FGED--------------FSGKM-GDSIR-TEIGTLVINFTKYWN--DSF-------
A0A3A5TI83      A--FGED--------------FSGKM-GDSIR-TEIGTLVINFTKYWN--DSF-------
A0A415NEB6      A--FGEE--------------FSGKM-GDSIR-TEIGTLVINFTKYWN--DSF-------
A0A6I0I238      A--FGED--------------FSGKM-GDSIR-TEIGTLVINFTKYWN--DSF-------
A7AJ60          A--FGED--------------FSGKM-GDSIR-TEIGTLVINFTKYWN--DSF-------
A0A6A2JF01      A--FGED--------------FSGKM-GDSIR-TEIGTLVINFTKYWN--DSF-------
A0A6I0Y2Y2      A--FGED--------------FSGKM-GDSIR-TEIGTLVINFTKYWN--DSF-------
A0A6I2Q447      A--FGED--------------FSGKM-GDSIR-TEIGTLVINFTKYWN--DSF-------
A0A395YYT3      A--FGED--------------FSGKM-GDSIR-TEIGTLVINFTKYWN--DSF-------
A0A015UXN7      A--FGED--------------FSGKM-GDSIR-TEIGTLVINFTKYWN--DSF-------
A0A5M5W148      A--FGED--------------FSGKM-GDSIR-TEIGTLVINFTKYWN--DSF-------
A0A6I2NTL0      A--FGED--------------FSGKM-GDSIR-TEIGTLVINFTKYWN--DSF-------
A0A016E4F9      E--LGID--------------FSGKM-GDSIR-MEIGTFVINLTKYWN--DSF-------
A0A4Q5CFJ7      E--LGTD--------------FSGKM-GDSIR-MEIGTFVINPTKYWN--DSF-------
A0A6N3HG44      E--LGTD--------------FSGKM-GDSIR-MEIGTFVINPTKYWN--DSF-------
A0A6H9P0U9      D--IGET--------------LSAQM-GDSIQ-TSAGIMIVSPTQEFT--DAF-------
A0A108TH71      D--IGET--------------LSAQM-GDSIQ-TSAGIMIVSPTQEFT--DVF-------
I8VXH0          D--IGET--------------LSAQM-GDSIQ-TSAGIMIVSPTQEFT--DVF-------
A0A412S0N6      D--IGET--------------LSAQM-GDSIQ-TSAGIMIVSPTQEFT--DVF-------
A0A412IIJ0      D--IGET--------------LSAQM-GDSIQ-TSAGIMIVSPTQEFT--DAF-------
A0A0P0FM97      D--IGET--------------LSAQM-GDSIQ-TSAGIMIVSPTQEFT--DAF-------
R6KTP3          D--IGET--------------LSAQM-GDSIQ-TSAGIMIVSPTQEFT--DAF-------
A0A139LU87      D--IGET--------------LSAQM-GDSIQ-TSAGIMIVSPTQEFT--DAF-------
A0A1C6B3Y5      D--IGET--------------LSAQM-GDSIQ-TSAGIMIVSPTQEFT--DAF-------
A0A6L3KCD1      D--IGET--------------LSAQM-GDSIQ-TSAGIMIVSPTQEFT--DAF-------
E2NMQ4          D--IGET--------------LSAQM-GDSIQ-TSAGIMIVSPTQEFT--DAF-------
A0A412YDB9      S--TGET--------------FSAQM-GDSIR-TSAGTMILHPAQKNA--NAF-------
R7DY01          S--TGET--------------FSAQM-GDSIR-TSAGTMILHPAQKNA--NAF-------
A0A414LGK8      S--TGET--------------FSAQM-GDSIR-TSAGTMILHPAQKNA--DAF-------
A0A415IPQ4      S--IGET--------------FSAQI-GDSIR-TSAGIIIISPTEKFT--DAF-------
A0A3E5BRW7      S--TRET--------------FSARP-GDSIH-TSVGTMIISLTQEFT--DAL-------
K9DXS6          S--TGET--------------FSARP-GDSIH-TSVGTMIISLTQEFT--DAL-------
A0A1M6KFV3      D--TRET--------------FSAQT-GDSIH-TPAGTMIISPTQAPS--DAF-------
A0A1Q6G7L3      D--TREN--------------FSAQT-GDSIH-TPAGTMIISSTQASS--DAF-------
A0A413H235      D--TREN--------------FSAQT-GDSIH-TPAGTMIISSTQASS--DAF-------
A0A1M5B2J8      P--VEG-E-------------VNGQL-GDTIQ-SPFGKMAVTATAHYR--KG--------
A0A255RCT5      H--VGG-E-------------VKGKL-GDTVQ-SPFGKMSVTATAHYR--KG--------
A0A1Y4GLF5      D--MKSDK-------------ITGTL-ADTIA-TPLGRMVVNATANYV--DA--------
A0A1H3XSC0      E--FDD-E-------------ISGRL-SDTIT-TPLGILKIETTPYYK--SK--------
A6LE40          E--LDGKD-------------IKGSL-LDSIP-TPLGKIIIHTTPNYV--KG--------
A0A4Y1VPX5      D--LEEKD-------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--KG--------
A0A6N2XMM4      D--LEEKD-------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--KG--------
B3JI46          D--LEEKD-------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--KG--------
A0A358R8U0      E--IPSEKV------------IKGNL-TDTLT-TPLGRVEITPTPYYD--ID--------
R6WSB6          E--IPSEKV------------IKGNL-TDTLT-TPLGRVEITPTPYYD--ID--------
A0A401LPX7      E--IENDDI------------VKGSL-NDSIQ-SPLGPIVVIPSAAYS--GK--------
A0A6G0GNY9      E--TGDDNA------------VKGKL-NDSIQ-SPLGPIVITPSATYS--DK--------
A0A6I1BFM0      E--TGDDNA------------VKGKL-NDSIQ-SPLGPIVITPSATYS--DK--------
A0A3A5Z900      E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--GK--------
A0A285TGL6      E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--DK--------
A0A3A5RFX4      E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--DK--------
A0A1Q6IUW9      E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--DK--------
A0A413XDP6      E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--DK--------
A0A6N8CVT6      E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--DK--------
K6AP24          E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--DK--------
A0A6I2NHV3      E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--DK--------
A0A662ZYI7      E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--DK--------
A0A078RYI7      E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--DK--------
C7XEQ8          E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--DK--------
D7INX6          E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--DK--------
K5ZG55          E--IENDGF------------VKGNL-NDSIQ-SPLGPIVVIPSAAYS--DK--------
A0A3N2N9B8      E--FKG--T------------FTGSI-GDTIS-TPAGLVVINPSAYYL--P----K----
A0A3N2NMI0      K--WEE--S------------FTGSL-GDSIA-TPVGIVIVNPSPAYT--P----G----
A0A359I8H7      E--EIE-KE------------VKAKIGAGPIE-TPVGKVSIIANGNYTAPKGKKNK----
A0A3N2KA63      E--EIE-KE------------VKAKIGAGPIE-TPVGKVSITANGNYTAPKGKKNK----
A0A4Q0IMT7      E--EIE-KE------------VKAKIGAGPIE-TPVGKVSITANGNYTAPKGKKNK----
A0A3B9FAU3      P--VGS-PEVT----------VTGRT-STIIG-TPVGNVLVTPTQYYG--SFVT-H----
A0A3C1E5L7      P--VGS-PEVT----------VTGRT-STIIG-TPVGNVLVTPTQYYG--SFVT-H----
A0A4Q0UAV1      A--GDT-KNLI----------LSGEV-GRTYK-TPVGPFRINTTEYFT--KEYINE----
A0A354SN68      E--AEM-KT------------ILSQE-GDTLL-TPIGKIFLQKSNSFD--K---AF----
A0A6L5XFL0      E--KQV-QP------------VTMRF-GTITK-TPVGNVIVNPTSYYV--G----K----
A0A3N2N595      D--IIK-AD------------FSGKL-NDTIK-TDAGPIVILPTDYYK--P----G----
A0A0A2DUD9      K--TEVQDP------------VTLVL-GKATE-TPLGKVLVNKNQGDD--L----D----
A0A3P1ZBJ5      K--KKD-KELR----------IKGRF-KQVVK-TPVGDILVTPTKNFE--L---------
R5FHS9          E--LDG-ED------------VTAKL-NQTVH-TPIGRVTIKPSHYYN--S-WPGG----
A0A413TW79      Q--VESDEE------------VQGKL-GQTVR-TVMGYVCVDQAPGYS--AFVNGY----
A0A3E5E9M7      Q--VESDEE------------VQGKL-GQTVR-TAMGYVCVDQAPGYS--AFVNGH----
A0A3E4SK73      V--VESDEE------------VQGKL-GQTVR-TAMGYVCVDQAPGYS--AFVNGH----
A0A415GGC6      V--VESAVE------------VQGKL-GQTVR-TAMGYVCVDQAPGYS--AFVNGY----
A0A413DBH9      Q--VESDEE------------VQGKL-GQTVR-TAMGYVCVDQAPGYS--AFINGH----
A0A1Y4PQK7      S--LKEVKP------------VTGKF-PCTLN-TPLGKVTLETTSGYV--R----G----
A0A1Y4IH41      L--LKEVKP------------VTGKF-PGTLN-TPLGKVTLEATSGYV--R----G----
A0A3A6AAP4      L--LKEVKP------------VTGKF-PGTLN-TPLGKVTLEATSGYV--R----G----
A0A6I0ZRD2      L--LKEVKP------------VTGKF-PGTLN-TPLGKVTLEATSGYV--R----G----
A0A1Y4DYA7      E---SD-KR------------IVVEF-NDTIS-TPVGRLLIKPTHGIK--D----F----
A0A1Y3X4I9      E---SG-QA------------VKALF-NDTVS-TPVGRLLVKPMAGAE--T----W----
A0A1Y4FNK8      D---VD-GE------------VTATL-NDTAD-TPIGKLSIKAMNDTV--T----Y----
A0A355FD59      S--KSS-KA------------IDTRL-GTIVD-TPLGKLSVMPTSHYT--N----E----
A0A359CEZ9      S--KSS-KA------------IDTRL-GTIVD-TPLGKLSVMPTSHYT--N----E----
A0A353Q7B4      S--KSS-KT------------IDTRL-GTIVD-TPLGKLSVMPTSHYT--N----E----
F8X3A5          D--IAN-NV------------IKGKL-NDTID-TPLGKIIVFPTSYYT--K----T----
A0A1M3KVR9      D--IAN-NV------------IKGKF-NDTID-TPLGKIIVVPTSYYT--K----N----
A0A4Y9IJS3      D--IAN-NV------------IKGKF-NDTID-TPLGKIIVVPTSYYT--K----N----
A0A495WI87      E--LPG-KL------------VKGQL-TDTIM-TPVGKVTVCPTPYYT--S----Q----
A0A354M4S6      E--LPG-KL------------LKGQL-RDTIM-TPVGKVTVCPTPYYT--S----Q----
R7DH52          E--LPG-KL------------LKGQL-RDTIM-TPVGKVTICPTPYYT--S----Q----
A0A4Q5E7L5      D--LDG-KD------------IKGRL-LDSIP-TPLGKVIIHTTPNYV--K----G----
A0A4P8LP09      D--LEG-KD------------IKGRL-LDSIT-TPLGKIVVHTTPNYV--E----G----
A0A4R4GZU7      D--LEG-KD------------IKGRL-LDSIT-TPLGKIVVHTTPNYV--E----G----
A0A016CWA4      D--LEG-KD------------IKGRL-LDSIT-TPLGKIVVHTTPNYV--E----G----
A0A1C6H117      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A0M1W0V2      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A139KA16      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A174VQ92      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A1Q6HCG0      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A1Y4JYM9      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A3A5QW67      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A3A5RQE6      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A3A6BP07      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A3E5E153      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A3Q9IP20      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A412WV15      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A413ICP6      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A414KYB9      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A5B3FWR2      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A6L4P3V7      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
E5WX00          E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
K0X3P3          E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A415TAH7      E--LDG-KD------------IKGRL-LDSIT-TPLGKIIIHATPNYV--K----G----
A0A078T2W6      D--LDE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A6I1AQV4      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A5C6L2P1      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A412MJT7      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A3E4WKT5      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A3A5YY33      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A078TAH2      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A1E9CFZ7      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A373FYU5      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A3A5TZ72      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A3A5XBP2      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A3A6MEG9      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A3E4JP35      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A3E4KP40      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A3E4NX82      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A3E4XFU8      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A412RG70      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A412TD37      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A413GAA4      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A414M7I4      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A496BTA0      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A496D2V6      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A4Q5G1P5      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A5C6KCA6      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A5M5AHM5      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A6I0KZV6      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A6I0Y5K7      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A6I1BFB8      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A6I2P5W5      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A6N8DC51      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
E5UZA2          D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A069SMG6      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A6A2RTB3      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A6I0VY00      D--LEE-KD------------VKGSL-LDSIT-TPLGKIIIHTTPNYV--K----G----
A0A1M4YZ07      D--LDG-KD------------IKGNL-LDSIP-TPLGKIIIHTTPNYV--K----G----
A0A0P0FQW1      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A5M5C0W6      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A6I0H151      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A642LZ22      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A6I0HI59      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A642NJ89      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A6I0HI52      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A6L3JTQ2      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A6L4EED9      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A6I0YVB5      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A6L5RHE2      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A6N3AEV2      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A6L3KG29      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A6G0G4T5      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A6I0HFG9      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A4Q5E5M7      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
A0A6L4F5W0      E--LDG-KD------------IKGNL-LDSIT-TPLGKIIIHITPNYV--K----G----
C3RFN5          D--LDE-KD------------IKGSL-FDSIP-TPLGKIIINTTPNYV--K----G----
A0A3A5Z014      D--LDE-KD------------IKGSL-LDSIP-TPLGKIIINTTPNYV--K----G----
A0A6I0ING7      D--LDE-KD------------IKGNL-LDSIP-TPLGKIIINTTPNYV--K----G----
A0A6L5S265      D--LDE-KD------------IKGNL-LDSIP-TPLGKIIINTTPNYV--K----G----
A0A078S3Q8      D--LDE-KD------------IKGNL-LDSIP-TPLGKIIINTTPNYV--K----G----
A0A069SJV7      D--LDE-KD------------IKGNL-LDSIP-TPLGKIIINTTPNYV--K----G----
A0A3E5DXI5      D--LDE-KD------------IKGNL-LDSIP-TPLGKIIINTTPNYV--K----G----
A0A3E5EM98      D--LDE-KD------------IKGNL-LDSIP-TPLGKIIINTTPNYV--K----G----
A0A3E5F453      D--LDE-KD------------IKGNL-LDSIP-TPLGKIIINTTPNYV--K----G----
A0A6N2YYD4      D--LDE-KD------------IKGNL-LDSIP-TPLGKIIINTTPNYV--K----G----
I9T3G6          D--LDE-KD------------IKGNL-LDSIP-TPLGKIIINTTPNYV--K----G----
A0A3E4SYU0      D--LDE-KD------------IKGSL-LDSIP-TPLGKIIINTTPNYV--K----G----
A6LGY1          D--LDE-KD------------IKGSL-FDSIP-TPLGKIIIHTTPNYV--K----G----
K5ZSH4          D--LDE-KD------------IKGSL-FDSIP-TPLGKIIINTTPNYV--K----G----
A0A1H4ADG3      ---------------------WKGKW-SVPVV-LPIGQLTLEKNELTN--DWDGSQ----
A0A5B8VUR8      ---------------------WKGSW-DEPIQ-LPIGKVTLVKNQAMS--SWDPAR----
A0A0D3L8Q3      ---------------I-----SSHKF-GQRVN-VGFGEFTIVSDSR------LIRN----
A0A2N3U785      ---------------E-----TLHEF-GQKIV-LPYATFTVTAAPGF-----STTN----
A0A5B6TJH8      ---------------R-----SIHSF-GKRIQ-KPYATFTVLATYKLN--STPTSN----
A0A519U664      ---------------T-----NTYKL-GQQIK-KPYGSFTIVASSI------KNAV----
A0A519MA34      ---------------V-----TTHKF-GQQIE-KPYGSFTIVAAST------KNAV----
A0A519UCX0      ---------------V-----TTHRF-GQEIK-MPYGSFTIVASAT------KSAV----
A0A0E3ZG78      ---------------M-----YTYKF-GQQIQ-KPYGVFTVVPDSGLT--ASSKSI----
A0A1I6BRK6      ---------------T-----TSHRF-GQKIH-KAFGSFTVITAGG------QYNV----
A0A243WAB1      ---------------V-----TSHSF-GQQIA-KPYGLFTIIAASG------GNTA----
A0A6G8C8X6      ---------------V-----TTHSF-GQQIT-KPYGKFTVVAATV------KDLG----
A0A416GA42      QELTE----------T-----KTFVL-NDTVQ-TAVGQLVVVPTGFYQ----KFDR----
A0A1T3IYP5      K--------------D-----VKVAL-NQLVE-TPVGKVFVTPSKNYK----D-YY----
A0A1T5K9D4      GQK------------N-----VVVSY-GDKVK-IGDGSFTIDKTRNLG----KHWF----
A0A077ENE7      KDK------------E-----IKIAL-NKLTS-TPVGKILITPSKYYK----KDYY----
A0A6I5UW06      KDK------------E-----IKIAL-NKLTS-TPVGKILITPSKYYK----KDYY----
T0NN57          NEK------------E-----IKVSI-NQSVK-TPFGEVLIVPSKFYG----TDFY----
X5K347          NEK------------E-----IKVSI-NQSVK-TPFGEVLIVPSKFYG----TDFY----
A0A060RD97      TRV------------S-----IEKKF-GDTVL-IRNVLIEIKPTI-SA----EKFV----
A0A3C1ITV0      IKSDAP---------A-----QTVKL-GQPFK-TPVGTVVLKATKEYG----KNFE----
R7HN19          IKSDAP---------A-----QTVKL-GQPFK-TPVGTVVLKATKEYG----KNFE----
A0A350IHV0      ---GEKMKYKG----K-----IKGSF-REELQ-TPVGKIKIVPTMHID----KWHD----
R5RVP0          ---GETIKHTE----K-----ITGRL-RDTIS-TPVGKIVIVPTEFID----K--W----
R6A0L2          GNDVPD---------------VDVQL-GQMTQ-TPYGPLCVVRGPGF-----GRWT----
R7LG80          GKKTDE---------K-----IKANF-GQTVK-TPAGRLSVVRSKMF-----NKWE----
A0A2L2WX98      DKYKG----------K-----VSIAV-GETKK-TPLGNLHLIADTYID----KMPT----
A0A6N8KXI9      PSV------------R-----IKAKF-NEEIQ-TPVGKMTLTANNNYD----EYFF----
G5GD56          RSTGKKKIFKE----H-----LSVRP-GVMVK-TPIGDLAINKTTFFS----RFPV----
R5KD55          KPQNSY---------D-----LTCHV-GQTVN-TPLGRLTIERQPHYP----SAVA----
A0A174QNT3      ETRDYD---------------KIVAF-NDTLF-TPVGRIIVTPKAEYV----RLYI----
A0A4S2FGS1      NAQSYE---------------QAVAF-NDTLS-TPAGRILVLPHVESI----PHYQ----
R9I0H0          NAPSYE---------------QVVAF-NDTLS-TPAGRILVLPHAESI----PHYQ----
K5BUT9          EKGEIQ---------E-----QELAY-NDTIR-TEAGRIVVQLRPENL----SAYL----
A0A174FPA3      EKGRMQ---------E-----QDLTY-NDTIR-TEAGRIVVQLRPENL----SAYL----
R6S9Y6          EKGRMQ---------E-----QDLTY-NDTIR-TEAGRIVVQLRPENL----SAYL----
A0A642LIH6      EKGRMQ---------E-----QDLTY-NDTIR-TEAGRIVVQLRPENL----SAYL----
C9KX15          EKGRMQ---------E-----QDLTY-NDTIR-TEAGRIVVQLRPENL----SAYL----
A0A6H0KRK1      ---------------------EKYAY-GDTIQ-TEAGRIVVNLKPENL----SAYI----
R6DAG6          ---------------------EKYAY-GDTIQ-TEAGRIVVNLKPENL----SVYI----
A0A3L8AAP1      ---------------------KKYAY-GDTVQ-TEAGRIVVNLKPENL----SAYI----
A0A4S2AYX2      ---------------------KKYAY-GDTVQ-TEAGRIVVNLKPENL----SAYI----
A0A4Y9H477      ---------------------KKYAY-GDTVQ-TEAGRIVVNLKPENL----SAYI----
A0A0E2M2Y7      LNRISEI--------K-----VEGSF-GRPIA-TPVGELQIDKTIFFA----DSWK----
A0A0K2J6Z0      LNRISEI--------K-----VEGSF-GRPIA-TPVGELQIDKTIFFA----DSWK----
B2RKZ8          LNRISEI--------K-----VEGSF-GRPIA-TPVGELQIDKTIFFA----DSWK----
A0A212GC82      LNRISEI--------K-----VEGSF-GRPIA-TPVGELQIDKTIFFA----DSWK----
A0A254MU12      LNRISEI--------K-----VEGSF-GRPIA-TPVGELQIDKTIFFA----DSWK----
R6CQ93          GAQE-----------T-----YKVQL-NDTLS-IGGEKILVTSTDHWS----KSWV----
A0A3D1NQW3      --GPDKQKFKQ----E-----ISAVF-GDTIS-TPVGQMIIRPTLYMS----PDYY----
B0MT10          --GPDKQKFKQ----E-----ISAVF-GDTIS-TPVGQMIIRPTLYMS----PDYY----
R7JGW9          --GPDKQKFKQ----E-----ISAVF-GDTIS-TPVGQMIIRPTLYMS----PDYY----
A0A3D2BF46      SADSDKDKDSEIYEVE-----MTGRF-NDTIT-TPCGLLVVTPTLYMS----DDYF----
A0A358R538      LPKSERRT-------Q-----IVVES-GDTAA-TPVGKVVVERTPYLT----PAYE----
A0A1Y4AAB8      ISDEERGR-------V-----VTAAY-GDTVS-TPLGRMIIRKTLYLS----PADE----
A0A1Y3WWY9      VSKQESRS-------V-----VTAQY-GDTIP-TPIGEIVVHKTLYMN----PKFN----
A0A1Y4U5L4      VSKQESRS-------V-----VTAQY-GDTIP-TPIGEIVVHKTLYMN----PEFN----
A0A1Y3VCJ1      ISKQESED-------R-----VSARF-GDTVA-SPIGQIIVRKTLYME----PSYR----
A0A1Y3QTW7      LTKQEKRR-------V-----IRGQY-GDTIP-TPLGQMVVHKTPFMD----STYV----
R6XWY7          LTKQEKRR-------V-----IRGQY-GDTIP-TPLGQMVVHKTPFMD----STYV----
A0A4Y1X9Y9      LTKQEKRR-------V-----IRAQY-GDTIP-TPLGQMVVHKTPFMD----STYV----
A0A4Y1WM66      LTKQEKRR-------V-----IRAQY-GDTIP-TPLGQMVVHKTPFMD----STYV----
A0A6N4GYT3      LTKQEKRR-------V-----IRAQY-GDTIP-TPLGQMVVHKTPFMD----STYV----
A0A174AVF1      LTKQEKRR-------V-----IRAQY-GDTIP-TPLGQMVVHKTPFMD----STYV----
A0A656Q4F4      LTKQEKRR-------V-----IRAQY-GDTIP-TPLGQMVVHKTPFMD----STYV----
A0A1Q6EIY0      VTRQETKR-------V-----ILAEY-GDTVA-TPVGQVVVHKTLFMD----STYL----
A0A5B5VN71      VTRQETKR-------V-----ILAEY-GDTVA-TPVGQVVVHKTLFMD----STYL----
E4M8L3          VTRQETKR-------V-----ILAEY-GDTVA-TPVGQVVVHKTLFMD----STYL----
I3YQ50          VTRQETKR-------V-----ILAEY-GDTVA-TPVGQVVVHKTLFMD----STYL----
R5UEY8          VTRQETKR-------V-----ILAEY-GDTVA-TPVGQVVVHKTLFMD----STYL----
A0A1H4D866      VTKQETRS-------S-----ITAAY-GDTIP-TPVGQVIVRKSLYMK----PEYT----
A0A5B3G4Y7      VTKHESRS-------V-----ITAAY-GDTIP-TPVGQVVVQKSLYMA----PDYI----
A0A374A9J5      VTKHESRS-------V-----ITAAY-GDTIP-TPVGQVVVQKSLYMA----PDYI----
A0A5B3GQN5      VTKHESRS-------V-----ITAAY-GDTIP-TPVGQVVVQKSLYMA----PDYI----
A0A1Q6E9S3      VTKHESRS-------V-----ITAAY-GDTIP-TPVGQVVVQKSLYMA----PDYI----
D4IJ36          VTKHESRS-------V-----ITAAY-GDTIP-TPVGQVVVQKSLYMA----PDYI----
A0A414Q925      -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFTD----ENSI----
A0A415PUS9      -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFTD----ENSI----
A0A108TCU0      -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFTD----ENSI----
A0A413BA42      -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFTD----ENSI----
S3Y344          -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFTD----ENSI----
A0A4Q5G8Y8      -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFTD----ENSI----
A0A412TGL3      -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFTD----ENSI----
A0A413VJ33      -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFMD----ENSI----
A0A414L0W6      -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFTD----ENSI----
A0A412DP39      -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFTD----ENSI----
A0A413ZSE8      -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFTD----ENSI----
B0NP84          -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFTD----ENSI----
R6AK43          -NEEEEEEFDE----I-----LTVQP-GDTVN-TPVGKMVVASTLFTD----ENSI----
A0A412N2D9      -NELEEEEFDE----S-----LTVQP-GDTVS-TPVGKIAVQPTLFTN----ESYI----
A0A1Y4JYS9      -NELEEEEFDE----S-----LTVQP-GDTVN-TPVGKIAVQPTLFTN----ESYI----
R6LHA4          -NELEEEEFDE----S-----LTVQP-GDTVS-TPVGKIAVQPTLFTN----ESYI----
A0A3E5HPT8      -------ELEQ----R-----KTVNL-NDTVD-TPLGKLIVFAAENYS----ESYF----
C6IJ48          -------ELEQ----R-----KTVNL-NDTVD-TPLGKLIVFTAENYS----ESYF----
Q8A3U2          -------ELEQ----R-----KTVNL-NDTVD-TPLGKLIVFTAENYS----ESYF----
A0A3R6S1H6      -------DEEW----K-----QKVAL-KDTVE-TPVGKVVVTPTLYYS----KMYY----
A0A3R6SD81      -------DEEW----K-----QKVAL-KDTVE-TPVGKVVVTPTLYYS----KMYY----
A0A354WXN6      NTEGKLVEAGK----P-----MEVLL-GDSVD-TPVGPLKIEASLDYS----ERYW----
R5IP14          --------EDW----S-----KKVQL-GDTVS-TPVGVLVVNNTGIPL----TKFK----
A0A316SZX7      -AQVSDIDRDL----T-----IKASL-YDTIS-TPIGKLVIKPTPYFD----S--W----
A0A1Y4AIY1      NEAGEPVEIKN----P-----QEVVL-NDTVT-TPVGRIVVQPSLYYT----DTYY----
A0A0J6CIR2      -----E---AK----S-----LKVAL-NDTVS-TPVGKLVVTPTLYYA----DKYF----
A0A3D8HG59      -----SVDVSD----A-----VTVAL-NDTVQ-TPVGRVVVTPTLFYT----TAYF----
A0A3R6S408      -----SVDVSD----A-----MTVAL-NDTVQ-TPVGRVVVTPTLFYT----TAYF----
F3ZRU7          --TGGEEVELP----H-----FSVQL-NDTVD-SPLG-LLLVKTTGLG----KAYE----
A0A1C5Q1F3      ----EGVKPVE----Q-----MKVHL-NDTVA-TPVGKLVVTPTLYYT----QDYY----
R7A239          ----EGVKPVE----Q-----MKVHL-NDTVA-TPVGKLVVTPTLYYT----QDYY----
A0A3R6HIK7      DSNGQRVEIKK----A-----QDVAL-NDTVQ-TPVGRVVVVPSLYYA----DNYY----
K5ZVW7          DSNGQRVEIKK----A-----QDVAL-NDTVQ-TPVGRVVVVPSLYYA----DNYY----
A0A1Y4D5Z0      NEEGKLVEIEK----A-----QRVAL-NDTVT-TPVGKLVVVPSLYYT----DLCY----
A0A413VXJ7      -VGDGEVTSNE----V-----LEVNL-HDTIQ-TPVGAMVVMPTLYYS----DNFY----
I9RSN9          -VGDGEVTSNE----V-----LEVNL-HDTIQ-TPVGAMVVMPTLYYS----DNFY----
U6RJK5          -VGDGEVTSNE----V-----LEVNL-HDTIQ-TPVGAMVVMPTLYYS----DNFY----
A0A1Q6GA32      -VGDGEVTSNE----V-----LEVNL-HDTIQ-TPVGAMVVMPTLYYS----DNFY----
I9RPU6          -VGGGGVHSEE----A-----LDVHL-NDTVS-TPIGPMVITPTLYYT----DAFY----
I8YFS5          -IAGEEIRSAE----V-----VDARL-NDTIS-TPVGTMVVTPTLYYT----DTYY----
A0A6L3FCC6      -IAGEEIRSAE----V-----VDARL-NDTIL-TPVGTMVVTPTLYYT----DTYY----
I8Y597          -IAGEEIRSAE----V-----VDARL-NDTIS-TPVGTMVVTPTLYYT----DTYY----
A0A1Q6GBF5      -VGGGIIHSEE----I-----LDVHL-NDTVS-TPIGTMVVTPTLYYT----DVFY----
I8YFZ3          -VGGGEVHSEE----V-----LDVRL-NDTVS-TPIGPMVITPTLYYT----DVFY----
A0A1Q6GDH2      -VGGGGVHSEE----V-----LDVHL-NDTVS-TPIGPMVITPTLYYT----DAFY----
U6RSB0          -VGGGGIHSEE----V-----LDVHL-NDTVS-TPIGPMVVTPTLYYT----DVFY----
I9SIK1          -VGGGGVRSEE----V-----LDVHL-NDTVS-TPIGPMVITPTLYYT----DVFY----
I9GXM2          -VGGGEISSEE----V-----LDVHL-NDTVS-TPIGPMVITPTLYYT----DVFY----
I9TP59          -VGEGEIHSEE----V-----LDVHL-NDTVS-TPIGPMVITPTLYYT----DVFY----
R5S343          ---------NR----E-----IEAVL-NDTVD-TPSGRAVVAPTGYYN----KNDL----
A0A1M6K7I9      -VNNEEIQSVD----E-----PEVAL-GDTIK-TAIGNIVVTPTLYYT----NEYY----
A0A5M6A8C8      -VNNEEIQSVD----E-----PEVAL-GDTIK-TALGNIVVTPTLYYT----NEYY----
A0A6L3FBE6      -IGDEELRSTE----T-----IDVHL-NDTVS-TPVGTVVITPSLYYT----DAFY----
A0A6L3FNG1      -VNGEESHFAE----T-----VDVHL-NDTVS-TPIGTVVVTPTLYYT----DTFY----
A0A3R5ZMK1      ---GQEVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A6L6NFJ9      ---DE--SAGE----P-----MTVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A1Y3ZIA4      ---DQEVSDGK----P-----MKVAL-NDTVT-TPIGRVVVVPSLYYG----DKYF----
K5Y1A4          ---DQEVSDGK----P-----MKVAL-NDTVT-TPIGRVVVVPSLYYG----DKYF----
A0A4Q5CIT0      ---GQEVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A6L6NWL9      ---GQEVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A3R6K8X4      ---GQEVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A6N8D6C8      ---GQEVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A3R6BKI7      ---GQEVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A6N8CW60      ---GQEVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A412M2W1      ---GQEVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
K5ZX55          ---GQEVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A415BDM7      ---GREVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A6L6MX19      ---GREVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A1Q6I3T6      ---GQEVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A414XX40      ---GQEVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A7AEU7          ---GQEVADGK----P-----VKVAL-NDTVT-TPVGRVVVVPSLYYG----DKYF----
A0A5F0U645      LEEEGQVQEDQ----T-----LTVAL-NDTVS-TPIGKVVVTPSLYYT----DLYY----
K5ZBN2          LEEEGQVQEDQ----T-----LTVAL-NDTVS-TPIGKVVVTPSLYYT----DLYY----
A0A0J6CKW3      LEEEGQVQEDQ----T-----LTVAL-NDTVS-TPIGKVVVTPSLYYT----DLYY----
A0A0F5IQM7      LEEEGQVLEDQ----T-----LTVAL-NDTVS-TPIGKVVVTPSLYYT----DLYY----
A0A496CDT3      LEEEGQVLEDQ----T-----LTVAL-NDTVS-TPIGKVVVTPSLYYT----DLYY----
A0A6G1ZKM3      LEEEGQVQEDQ----T-----LTVAL-NDTVS-TPIGKVVVTPSLYYT----DLYY----
S0GLB0          LEEEGQVQEDQ----T-----LTVAL-NDTVS-TPIGKVVVTPSLYYT----DLYY----
A0A3R6NLC1      LEEEGQSLEDQ----T-----LTVAL-NDTVS-TPIGKVVVTPSLYYT----DLYY----
A0A416WYC9      LEEEGQTLEDQ----T-----QTVAL-NDTVS-TPIGKVVVTPSLYYT----DLYY----
A0A0F5IT40      --------EAK----S-----LKVAL-NDTVS-TPVGKLVVTPTLYYA----DKYF----
A0A496CX20      --------EAK----S-----LKVAL-NDTVS-TPVGKLVVTPTLYYA----DKYF----
A0A5F0UBI0      --------EAK----S-----LKVAL-NDTVS-TPVGKLVVTPTLYYA----DKYF----
A0A6G1ZHG0      --------EAK----S-----LKVAL-NDTVS-TPVGKLVVTPTLYYA----DKYF----
S0GSI7          --------EAK----S-----LKVAL-NDTVS-TPVGKLVVTPTLYYA----DKYF----
K5YB65          --------EAK----S-----LKVAL-NDTVS-TPVGKLVVTPTLYYA----DKYF----
A0A0F5IWP9      --------ETK----M-----LKVVL-NDTVI-TSIGKLVVTPTLYYS----DKYF----
A0A0F5IZT8      --------ETK----M-----LKVVL-NDTVI-TSIGKLVVTPTLYYS----DKYF----
A0A417LKQ2      --------EGK----M-----QKIAL-NDTVT-TPVGKLVVTPTLYYS----DKYF----
A0A416TME1      --------EGK----M-----QKVVL-NDTVA-TPAGKLVVTPTLYYS----DKYF----
A0A416XPE8      --------EGK----M-----QKVVL-NDTVA-TPAGKLVVTPTLYYS----DKYF----
L8JI02          NRTEDTFDEINLREVVEAG--KPFRT-HSLA--------FTIRPNELY----APKE----
A0A4Q5WS95      ------------RQVRIGA--AAYPL-DQLVA-TPYGS-LTFSPNPRY----KAGS----
A0A501VZX6      ------------KQVIINN--DEYST-GKWVQ-TPYGI-IRFSLNTRK----EGIA----
A0A399SH26      ------------EEVTVDG--KSYPL-NKSIR-MPYGV-IKFIPNDHQ----SSQA----
A0A501W1A9      ------------KQVIIDN--KPYNL-NTWAK-TPYGE-LQFIENPQF----SWAA----
A0A0E3ZGV6      ------------KEVIIDS--KKYSI-GTWEK-TPYGV-MLFSENEKQ----TSTT----
A0A1I2N4S1      ------------QKVQIDG--KEYPL-STWVV-TPYGE-MLFEKNLLQ----NGSA----
A0A2T5YE44      ------------QKVKIDG--KEYPL-STWVV-TPYGE-MLFEKNLLQ----NGSA----
A0A1M5BA90      ------------NTVAIEG--KMYSL-NKWIS-TPFGV-ARITRNLNL----KTAS----
A0A512B879      ------------KTIDIAG--KSYPL-DQWVT-TSFGT-AKFNINRYF----KTAT----
A0A559PPI3      ------------KNVKVDG--RIYPL-NEWVD-SPFGK-IMFYPNKNK----VQQA----
A0A1T5CS78      ------------ENVVFSG--KEYSL-NKWFE-ISNGQTIMFVKNDNV----NKKA----
A0A0Q9Z8F1      ------------EKVIFSG--KEYSL-NEWFE-FSAGQTIMFVKNDHV----NKKA----
A0A2N0U0M7      ------------EKVVFSG--KEYSL-NEWFE-FSAGQTIMFVKNDNV----NKNA----
A0A1V9FHD0      GKASK-----EIKEVVIDK--KAYPM-NTWCN-TPYGV-LKFEKNARQ----TTDS----
A0A4V4H170      GGEFRDVIK-KVREIVIGE--KIYPI-KKWVS-TPWGE-LKFEHNDRQ----LSMA----
A0A1V9F098      AGEFRNVDEPKVKEVVIGK--KVFPI-NQWVS-TKYGE-LKFEKNERQ----TEAP----
A0A4R2VU64      AGEFKELSNLKVKEVVIKK--KTYPV-NQWVT-TPYGE-LKFVENQKQ----ADTP----
A0A4S8HY23      AGEFNGLIKQKVKEVIIDN--NAYPI-NTWCA-TPYGE-LKFENNNRQ----SDTV----
A0A1V9F383      RRAATNVYKDKVKEVVIEN--RKYPL-RVWCN-TRWGE-LKFIPNDRQ----TTAP----
G8TRZ6          MQVAHNGYKDKVKEVVIEN--KKYPL-REWCQ-TRWGV-VKFMPNERQ----TSKP----
A0A4R5DL69      ---------------------TVKAN-DQFTL-TDKVHTWNQSFGDTF----LLPTGEAT
A0A1M4YED3      DG-------------------KSYPM-NKFVT-TPFGVLKFTKNDKAN----A-AP----
A0A2H3NSN0      ---------------------TTDT---PFQL-FA-------------------AV----
A0A2P6C324      ---------------------TTQGV--QFTL-LA-------------------PV----
A0A7C2DZI7      ---------------------AAGTR-DRFPI-LA-------------------PD----
A0A1M6XHU0      ---------------------TAGAK-ERFPI-LA-------------------PT----
G2SF81          ---------------------TAGAK-DRFPI-LA-------------------PT----
A0A5S9EYW1      ---------------------TAGAK-DRFPI-LA-------------------PT----
D0MHQ9          ---------------------TAGAK-DRFPI-LA-------------------PA----
A0A126PFG0      QTSFYMAATNGNLTAHPFGRPVSDSI-GTWQL-TPVPAFAL-------------PA----
A0A3M1N7Z3      ERKVEIWRAETLI--------VSGKI-GQWMA-LPGASSAQLRIDCDP----NCPS----
                                                                            

A0A1T5MMH4      --------------LFFIINSPDALLGYL-----ISGLSV-EPLN-------Y-----A-
A0A2W4R1L8      --------------CFFVINSPEVLMNYL-----MRNLTV-EPIN-------F-----N-
A0A2E5CV79      --------------------------DAI-----GEKFSQ-NVMNGISIKRRN-----A-
A0A2D4ZVH1      ----------------------------------RELIRF-SEPD-------P-----E-
A0A0K8QSK7      --------------YAIEFNTVQQTGKLY-----ASRLTV-AQSN-------R-----Q-
A0A1V6CN82      --------------FFFRFHTPDELINAY-----RSRMTV-SLRD-------W-----E-
A0A1M4XZ45      --------------YKFRFNTKKSLVDKY-----RKSLEV-TLSG-------K-----E-
A0A399D319      --------------YKFRFNSKKALLKRY-----REQLDV-TLND-------K-----E-
A0A1V5IPN7      ----------------------------------------------------R-----D-
A0A1M6GR99      --------------FAFKLSTIKQLVSHY-----EQKLEF-NIPD-------R-----L-
A6EBM4          --------------YLFRFNTPEDFLDRI-----REGLRI-GEAG-------K-----N-
A0A7C5M4P4      --------------FYFRINSHDALINYL-----EKNLRV-EPVN-------L-----D-
A0A1M6TTV4      --------------FYFIINSEDALINYF-----QKNIVV-EPIN-------F-----N-
A0A4Q8RX32      --------------YFFDVKGKTQLVGEL-----KEQLTI-EPAN-------V-----D-
K0X1U5          ----------KKLKFVAHVNGYDGEAEIL-----EKRLDI-DLSD-------K-----K-
R5EXK3          ----------KKLKFVAHVNGYDGEAEIL-----EKRLDI-DLSD-------K-----K-
A0A401UAP7      --------------YSFMLNDAQALRAYF-----TERLMV-TPKN-------Y-----N-
A0A1W2GF52      --------------FYFVLNSKESLINYL-----ESHVTV-EPIN-------F-----N-
A0A2G5L7B8      --------------FYFVINSREALIDYF-----QQNIIV-EPIN-------F-----N-
A0A523GAC0      --------------YSFKINSQNSLLLYL-----ENNITV-EPLN-------L-----T-
L8JW09          --------------FFFIINSKAAQIKYL-----GSNLTV-EPLN-------L-----N-
A0A364XUP5      --------------FFFIINSRDVLMNYL-----IANLTV-EPLN-------F-----Y-
A0A1M5RLA9      --------------YFFVLNTRDALLGYL-----LRSLTA-EPLN-------Y-----N-
A0A385SFR9      --------------YFFVLNTRDALLGYL-----LRNLTA-EPLN-------F-----N-
A0A5M4A9J4      --------------YRFRFNTHGALVDYF-----RHSLTV-ATVN-------K-----D-
A0A5M4B1C7      --------------YRFSFHNHNGLVNVF-----RKNLTI-ETVN-------K-----D-
A0A0D3LFR6      --------------YYFIINSDQSLIDYL-----STNLTV-TILN-------P-----N-
M7N6D4          --------------YYFIINSDNALINYF-----RQNLSV-SILN-------P-----S-
A0A4D7K1D4      --------------YSFKINNKESQINFI-----QQNLKV-EAQS-------L-----A-
A0A5C7MX19      --------------FYVRKYDKSFVIADV-----INKVSI-EPLD-------F-----K-
A0A1Q3ZMZ7      --------------LYFIIQDPGLLTRQM-----MSSLKI-IPLN-------P-----E-
A0A2D8JJW3      --------------YTFKDGDIRAAVERL-----QESLNI-NHV--------K-----E-
A0A2W2AFF7      --------------YRVDVQSTDEAVEDY-----RKALTA-NVVN-------K-----Q-
R7PCR1          --------------ISITRISVKDAAKIY-----VKRISA-TPVD-------K-----Q-
A0A1G9E2A9      --------------YYFVINSRGALISYL-----AENLTV-NVVN-------A-----N-
A0A098LL25      --------------YFFTMNSKEALVKNL-----MDNVSV-SILN-------L-----D-
A0A6J4H627      --------------YYFVINSIDALNNYL-----ASNLRV-DVLN-------P-----S-
A0A6C0GJI1      --------------YYFRINSAGALINYL-----ASNIRV-DVLN-------Q-----M-
A0A2T2YJE8      --------------YYFIVNSNAAIRQYL-----TSNVAV-NIVN-------L-----D-
A0A127B287      --------------FYFIVHSSGALKRYL-----NDNLSV-AVLN-------P-----E-
A0A6P1P2P6      --------------FYFIVHSNGALKRYL-----NENLTV-AVLN-------P-----E-
A0A3M9N829      --------------YYFIVHSSQRLKRYI-----DENLST-AILN-------P-----E-
A0A0P0CSF9      --------------YYFIVNSDQRLKGYI-----DTNLTT-AILN-------P-----E-
A0A5M8QQB8      --------------YYFVINSDQRLKGYI-----DGNLTT-AILN-------P-----E-
A0A3M9MNC3      --------------YYFIVHSNQSLKGYI-----DNNLTT-AILN-------P-----E-
A0A5B6TAX2      --------------YYFIVHSNQALKGYI-----DNNLTT-AILN-------P-----E-
A0A5N1IQ33      --------------YYFVINDDGAMARYF-----DENLVV-EIVN-------P-----E-
A0A512AYT3      --------------YFFVINSDGALNSYF-----NQNLSV-EIVN-------P-----D-
A0A5M6CYN7      --------------YYFVINSDGALNAYF-----NQNLSV-EIVN-------P-----D-
A0A369QP10      --------------YYFTINSTGAIRQYL-----TSNVAV-NIVN-------L-----D-
A0A126PDF2      --------------YHFTIQDQGTVNAYL-----EKNLAV-DISS-------A-----D-
A0A2Z3GKA1      --------------YHFTVQDEGTVNAYL-----EKNLAV-DISS-------A-----D-
A0A502GZP7      --------------YHFTIQDEGTVNGYL-----EKNLAV-DISS-------A-----D-
A0A519SBU8      --------------YFFVILDDGALNAYL-----DRNLDV-AVVN-------P-----S-
A0A4Q3JNZ3      --------------YHFVVLSDGDISGYL-----NRNLDV-TVVN-------P-----S-
A0A519Q9V3      --------------YHFVILDDGAVSDYL-----DTNLDV-AVVN-------P-----S-
A0A0M3RW20      --------------YHFVVKDNGAINQYI-----DQNLTV-EIIN-------P-----E-
A0A495VFX4      --------------YHFVVNDKSSINQYI-----DQNLIV-EIIN-------P-----E-
A0A1S9B3W0      --------------YYFIIKDPGSINGYL-----GSNLGV-SVIN-------P-----D-
A0A1W1VRL3      --------------FYFVILDEGTLNTYL-----NTNLSV-QIVN-------P-----D-
A0A1M6R305      --------------YHFTINDEGTINSYL-----DRNLLV-EIVN-------P-----D-
A0A4Z0PHK3      --------------YHFVINDEGAVNNYL-----NTNLSV-DIVN-------P-----D-
A0A2M9B9H9      --------------YHFVINDDGAVNNYL-----NTNLSV-DIVN-------P-----D-
A0A4Z0QCY9      --------------YHFVINDDGAVNAYL-----NTNLSV-DIVN-------P-----D-
A0A418R9X5      --------------YSFIINDQNAINGYL-----NQNLSV-DIIN-------P-----D-
A0A428JSJ3      --------------YSFVIQDGGTVNAYL-----TQNLAV-DIVN-------P-----D-
A0A428KI59      --------------YSFVINDDGTVNGYL-----NQNLAV-EIVN-------P-----D-
W8F1I6          --------------YSFVINDDGTVNGYL-----NQNLAV-EIVN-------P-----D-
A0A246FQC0      --------------YSFRINSNSALNEYF-----DTNLLV-DIVN-------L-----D-
A0A372E5P8      --------------YSFVINSAGALGNYF-----NTNLLV-DIVN-------L-----D-
A0A1H3EMW1      --------------YSFMINSPGALSNYF-----NTNLLV-DIVN-------V-----D-
A0A1H9ZSN3      --------------YSFMVNSPGALSNYF-----NSNLLV-DIVN-------V-----D-
A0A5N1J2M4      --------------YYFTINSPAAVLNYI-----GSNLSA-QVVN-------F-----D-
A0A519S476      --------------YHFVILNDGAINAYL-----DKNLDV-KVIN-------P-----N-
A0A4Q3JRW8      --------------YHFVILNDGAVSGYL-----DRNLDV-AVVN-------P-----N-
A0A519M923      --------------YYFTILNDGAVNAYL-----DKNLDV-AVVN-------P-----S-
A0A4Z0ENW1      --------------YYFIILDDNTINSYL-----DRNLKA-EVLN-------P-----S-
A0A519UDB4      --------------YHFVLLEDNAITAYL-----DRNLTA-EVLN-------P-----S-
A0A3S0QKV1      --------------YYFTINDAAAINGYL-----SANLTV-SVIN-------P-----E-
A0A328BL48      --------------FFFVINTPEAINGYL-----AQNLTV-SVIN-------P-----D-
A0A5R8WLY4      --------------YFFVVNTPEAINSYL-----AQNLAV-SIIN-------P-----D-
A0A1I5WSL8      --------------YHFTILSDGAVNQYL-----DKNLAV-EIVN-------P-----E-
A0A0U3JVM7      --------------YHFTILDDRTVNEYL-----DKNLTV-EIVN-------P-----E-
A0A1G1SSV2      --------------YHFTIQDDRSVNAYL-----DKNLTV-EIVN-------P-----E-
A0A1G1SXV7      --------------YHFTIQDDYTVNAYL-----DKNLTV-EIIN-------P-----E-
A0A6G8CBJ6      --------------FYFIILDDGSVNGYL-----NKNISV-EIVN-------P-----E-
A0A0W8EDI5      --------------YYFIIHDNSSVWSYI-----DQGLTV-EIIN-------P-----E-
A0A3B7RBP8      --------------YYFVIHDDATVWGYI-----GENLTV-EIIN-------P-----E-
A0A3R9P8H7      --------------YFFTINSNGALNAYF-----NKNLLV-DIVN-------V-----D-
A0A238WIA7      --------------LFFIIHDEGTINGYL-----SQNLQV-QVVN-------P-----D-
A0A212UCJ7      --------------FYFVIRDEGFINQYL-----SSNLQV-QIIN-------P-----D-
A0A4Z0MQE1      --------------FYFIIRDEGFINGYL-----SSNLQA-QIVN-------P-----D-
A0A4Z0PCF4      --------------FYFIIRDDAFINGYL-----SSNLQV-QVVN-------P-----D-
A0A6M6BED0      --------------FYFIIRDDGFINGYL-----SSNLQV-QVVN-------P-----D-
A0A5D6VDG1      --------------FQFVIRDDASINRYF-----DENLTV-EIVN-------P-----E-
A0A6H1CVS0      --------------FQFVIHDDASINRYF-----DENLTV-EIVN-------P-----E-
A0A243WHR7      --------------YFFVINDDGTISNYL-----NKGLNV-QVVN-------P-----D-
A0A5B8A0P6      --------------YYFIINDEGTLNSYF-----EKNISV-DIIN-------P-----N-
A0A076HRT9      --------------YFFTINDEAAINAYL-----DRNLLV-EIVN-------P-----D-
A0A4Z0PVM7      --------------YHFVINDDGAVNAYL-----NTNLSV-DIVN-------P-----D-
A0A1M6DHW8      --------------YHFVINDEGTLNAYL-----SSNLSV-DIIN-------A-----D-
A0A4Q5LC61      --------------YHFVINDDGGLNAYL-----SNNLSV-EIVN-------A-----D-
A0A2N5YXE2      ----------SQ--YFFTINNTKTVLTNI-----ASNLEI-QVLN-------E-----N-
K0XJ09          --------------VEVSRIDLNTAANIY-----HSFIST-SLAG-------E-----R-
R5EUZ0          --------------VEVSRIDLNTAANIY-----HSFIST-SLAG-------E-----R-
W0EQS0          --------------VEVSRISLDAASGMY-----HA--SA-SLAG-------E-----R-
A0A1Y3WE15      --------------IEVSRMDLNTAANIY-----HSLISA-ALAG-------E-----R-
A0A1Y4GUK3      --------------VEVSRMDLNTAADIY-----HSLISA-ALAG-------E-----R-
A0A2U1FKU2      --------------VYVVKEDMRKVVERY-----NQELQV-ALAD-------K-----K-
A0A0A2F954      --------------LYVKKENTRKVAERY-----NQDLQV-SLAD-------K-----K-
A0A0A2FW91      --------------LYVTKENTRKVVERY-----NQDLQV-SLAD-------K-----K-
A0A2D2N2N1      --------------LYVTKENTRKVVERY-----NQDLQV-SLAD-------K-----K-
Q7MWZ2          --------------LYVTKENTRKVVERY-----NQDLQV-SLAD-------K-----K-
T2NDT6          --------------LYVTKENTRKVVERY-----NQDLQV-SLAD-------K-----K-
W1R7P9          --------------LYVTKENTRKVVERY-----NQDLQV-SLAD-------K-----K-
A0A1R4AFZ0      --------------LYVTKENTRKVVERY-----NQDLQV-SLAD-------K-----K-
A0A1R4DVZ7      --------------LYVTKENTRKVVERY-----NQDLQV-SLAD-------K-----K-
A0A7C0WKI7      --------------FYVEKAKGPVNYRVLGVARIRRNLSI-SPV--------R-----D-
A0A2A8CVM9      --------------------STNEVMSHM-----MQRVSF-VPM--------Q-----S-
A0A5M4B212      --------------YRIAFHSLDQLTNEY-----MEKLTV-APVS-------K-----E-
A0A3D1KEX9      ----------VGKIIHVTRIKKEDAITKF-----NKAVTA-SEVN-------K-----E-
A0A358Y7S2      --------------VYFEFIQREKLIEEI-----KEKLTV-IAVN-------P-----E-
A0A1X7J248      --------------LTFTISTPESLMSYV-----ESNLSV-APEN-------L-----N-
E4TQD2          --------------LFFTISTPESLINYV-----ESNLSV-APEN-------L-----N-
A0A2J6HHN3      --------------FIVVFNNIDNLVYKY-----SRKINI-SVVS-------D-----A-
A0A1Y3WMT8      ----------KKLRFVAHINGYDTQTELL-----EKRLEI-DLSD-------K-----K-
A0A1Y4GQU1      ----------EKLRFVAHINGYDVQTELL-----SKRLEI-DLSD-------K-----K-
A0A6A0R272      ----------TDGSYVIKVVDKVKLAQEF-----AKQLTV-TQVE-------E-----K-
A0A1V5W8T5      --------------FYFRILDDKGAFAEH-----ITGLDV-SILN-------F-----D-
A0A2T8HKA9      --------------ITVTKIPRETMVSYF-----LSRMKI-VQIE-------D-----D-
A0A2I0QZ80      --------------LYFVFNDLNTVSSRF-----HDDLSI-RPID-------Q-----K-
A0A3E1F1A3      --------------YYIVLNEDKVLANNL-----HSGLSV-SLVD-------N-----N-
A0A2U2XBJ3      --------------LYFELNDKSTMSRRL-----RPGLTV-TPVD-------A-----N-
A0A4Q4KU94      --------------LYFVLNEKKSIARQL-----RSGLTV-TPVD-------P-----N-
A0A3B8INU3      ----------LGEPMYFVINSNGALLNYI-----GAHLAV-TPLN-------L-----N-
A0A2W1NDY9      --------------LFFKINNYKTLTNVL-----IHSLIV-NIEN-------A-----D-
A0A5C8AQR5      --------------LYFVFNERKALIDRL-----LPGLII-VPIN-------L-----E-
A0A1G0CI31      --------------LYFTFNNKKTLVTRL-----LPNLEI-TPAD-------I-----E-
A0A556N0M0      --------------LYFTFNNQKTLASRL-----ITNLEV-NPID-------I-----N-
F2IKD6          --------------LYFTFNNQKNLAARL-----ISNLEV-NPVD-------A-----N-
A0A1I7BM74      --------------LYFVFNNTQSLMARL-----HGDLTI-APLD-------V-----K-
A0A2G2FJ17      --------------LYFHFNSEDNLASKY-----LSGLAV-SPVD-------I-----Q-
A0A2E3R1D0      -------------------LTVQEVAFRL----QRGSIKS-TMET-------G-----G-
A0A2T2USC0      --------------------TVSEIAGDLVSQGGKATMSA-SAAGGNLAGQYE-----S-
A0A2T2V0F3      --------------------TVGEIAGDLVAQGGKATMSA-AAAGENLGNQYE-----S-
A0A2T2S682      --------------------SRAVLAGLL-----RRRVRA-QSAG-------R-----E-
D5H561          ----------DPSPVDTTQLSPASVAPAL-----AGRVRF-SRAG-------A-----E-
A0A2H3NWA9      --------------------SAQQLAGRL-----MGRVQA-SPGG-------E-----E-
A0A2A8CVB6      --------------------SQNQIAHRV-----RGSIRA-GTYG-------E-----Q-
A0A2P6C1S6      --------------------SISAVAGQV-----QNMISA-QPSG-------E-----E-
A0A2T2UTM4      --------------------STAEVANQV-----KGMISA-QPSG-------E-----K-
A0A414ZBF2      --------------VYVKKGNRKNVSDNY-----NANLQV-EVVD-------K-------
A0A1Q3Q573      ----------FNSLYFVKFNDKQTIINDI-----NSKITI-EPIE-------A-----G-
A0A662BAY3      --------------YKFRFNIRSDLLKQY-----KNDLSV-NMLS-------Q-----E-
A0A4U3L369      --------------FFFQITSYDNATAAY-----QKNLVI-TVPD-------D-----K-
A0A357YNR3      ----------RNMMVEIDIYRPADVANMY-----LGNLTV-ELTS-------K-----T-
A0A5E8AX52      --------------YYFTINSESALISFF-----QSNVTV-QPLN-------F-----S-
F4KK08          ----------NYEVLKVQKDNFNAVVRNY-----MKALQV-SLQQ-------K-----D-
A0A6B5PK86      --------------IYFTFNSTQSLSERF-----IRNLYV-LPID-------E-----R-
A0A2G2F510      --------------LYFTFNSIESVTERL-----RKGLKV-VPVE-------V-----G-
A0A316JZ08      --------------LYFTFNSRQGLVERL-----HGGLDV-IPMD-------P-----N-
A0A496LCF9      --------------VNFQFRTRQSLISEF-----FAKLQI-RLIE-------------N-
A0A5P2G2A9      --------------YTFVINPIKSEVQGI-----LQNLSA-EIPN-------K-----Q-
A0A3C0ZQC7      ------------------LLTASEIAKRL-----MTAVEF-EPI--------R-----D-
A0A419VXB7      ----------TEGDYYFEFNDLEKLTLSY-----LRQLQV-STVN-------K-----D-
A0A0B0BTJ4      --------------LRIYVRPVRNAAEAY-----AKALHV-AQAQ-------K-----F-
A0A3B9CNN6      --------------LRIYVRPVRNAAEAY-----AKALHV-AQAQ-------K-----F-
R5X290          --------------LRIYVRPVRNAAEAY-----AKALHV-AQAQ-------K-----F-
A0A1Q6E6I7      --------------LRIYVRPVRNAAEAY-----AKALHV-AQAQ-------K-----F-
C3J7R8          --------------LEVEKNTRERSIRSF-----SHIFNV-SSAS-------K-----Q-
A0A1G8BVM8      --------------IIISKINKMNLAKSL-----VAKFNI-ESVD-------K-----Q-
A0A1I1FXP9      --------------YFFTINSRNKLLMQM-----FFNTSA-YILN-------Q-----S-
A0A3N4H5N3      --------------FVLNFVNPVLITEQF-----SKSLTL-EQPS-------I-----K-
A0A2P8EAX2      --------------FVVRLENPIVKTERY-----AKALNF-EQSS-------V-----K-
A0A4V2F6N9      --------------FVVILENPIVKTERY-----AKALKF-EQSS-------V-----K-
A0A3B9FXJ0      --------------YELIIRNKLTVAKAM-----EKRIRI-DAEN-------T-----Y-
R5GSU5          ----------RLPVF--------TATEMY-----RSKLSC-GEID-------K-----E-
A0A2A3UE91      ----------DNKGFYFIVHDVDAVTAQL-----QAKVEL-KLLN-------E-----L-
A0A0A2G557      --------------IEIIVNSKEKTVADL-----SKKLTI-SQSG-------K-----Q-
A0A2N2WFW8      ----------NGKQFLIVFNSVKDLANSY-----SQKINI-AVLN-------D-----V-
A0A1F3IU95      ----------RNKQFIVQFNNLTDIAAQY-----SQQVNI-AVIN-------D-----V-
A0A3D0VUF6      ----------RNKQFIVQFNNLTDIAAQY-----SQQVNI-AVIN-------D-----V-
A0A1T4PT95      ----------DKE-IKITISSREEIISDL-----AKRLTI-AQSS-------K-----G-
A0A6I6JYY3      --------------FKFVFNKKSALVKKY-----TKALTV-NLAD-------K-----E-
A0A2A4PYG9      ----------QNP-YFFIVNNTAAEIDKY-----YHLIDV-RILN-------Q-----A-
A0A1F3K695      ----------QNS-FYFIIKNPNNVYLDH-----FSRLEV-AVQN-------Q-----L-
A0A353KZR1      ----------QNS-FYFIIKNPNNVYLDH-----FSRLEV-AVQN-------Q-----L-
A0A2N2WYB5      ----------SNR-YYFIINNPQTLVDLH-----LQTLQV-ALQN-------R-----S-
A0A1F3K4G0      ----------GNR-FYFVISNPKNIVENH-----LQNLDI-FLLN-------R-----S-
A0A356H8Y3      ----------GNR-FYFVISNPKNIVENH-----LQNLDI-FLLN-------R-----S-
A0A351HSA6      ----------GNR-FYFVISNPKNIVENH-----LQNLDI-FLLN-------R-----S-
A0A1F3Q014      ----------KNA-YYFTLNDLDAIVNES-----YPKVEV-KLLN-------D-----Q-
A0A2D5KD44      ----------GIE-YHFVLNNPQSLVKGI-----LSRLEI-VILN-------P-----N-
A0A6N9NIX1      ----------QNQ-LFFKINNKEAIANAF-----AQKLTV-TVLN-------Q-----A-
A0A2A4YXP3      ----------EGN-LYFRINSYEEMTNAW-----DYKLSV-FPLN-------N-----A-
A0A1F3R158      ----------NTL-LFFTINDIESLTNSY-----ISSLNV-FPLN-------P-----L-
A0A2M8ADX2      ----------GTS-IFFTINDIENLTNNY-----ISKLNV-FPLN-------P-----M-
A0A1J5B2H0      ----------SDN-YYFIINNPSTNLSNY-----VRPLNI-SIIN-------E-----A-
A0A1V5N756      ----------KDD-YFFVLKKPSDILSSY-----IPNLSV-FVVN-------E-----N-
A0A651GU15      --------------LYFVINNPNSLVSRF-----RSNMEV-RVMN-------N-----I-
A0A3Q9FR88      ----------DNNKYSFQFNSKSSITNFI-----RKNISV-LIFD-------P-----K-
A0A553GEX3      ----------DNNRYSFQFNSKSSITKFI-----KKNISV-LIFD-------P-----K-
A0A150ADJ9      ----------INNTFSFVVNSRPSLVKFL-----KKNISV-QVFN-------P-----K-
A0A1B1FWQ4      ----------ETNKYSFTFNSKASIIGFL-----KRNLSV-MIYD-------P-----K-
A0A1S1Z228      ----------ETNKYSFTFNSKSRIIGFL-----KANLSV-MIYD-------P-----R-
A1ZKR2          --------------FYFKINSRQALISYL-----NNNLQV-GILN-------K-----S-
A0A1Q3GX01      --------------FYFKLNSRQTLIDYL-----NKNLQV-GILN-------R-----S-
A0A349DQI4      --------------FYFKLNSRESLIRYL-----NTNLQV-GILN-------R-----S-
A0A4P5TMD1      ----------SSN-YYFVINSRDNLSKDI-----RTKIRI-ELYP-------P-------
A0A2N3IIZ0      --------------IYFVLNSKGKSMNYL-----ANNLEA-FILN-------P-----Q-
A0A1F3SJM1      --------------LYFIFNSVQSVAERM-----RNGVTI-TPID-------V-----A-
A0A2G2EB96      --------------LFFIFNGREQLSNRL-----IQDLSV-SSID-------P-----Y-
A0A2G6PRA9      --------------LFFIFNGREQLSNRL-----IKDLSV-AAID-------P-----N-
A0A497D5Z2      --------------YFFRFRTNESLADQY-----KKNLTI-ENVP-------K-----E-
A0A662B170      --------------YFFRFRTNESLADQY-----KKNLTI-ENVP-------K-----E-
A0A2A5FYT6      ----------QND-YFFIINDVNQITEQY-----HHRLRV-ELLN-------A-----A-
A0A2E6SYP1      --------------FLFMINNEKQIVNHF-----SKGLDV-SIFN-------V-----R-
A0A2E5RLE8      --------------FLVKIVDKNQLISKY-----SKGLQV-NIEN-------T-----R-
A0A2E7TQF6      --------------FLVKIVDKNQLISKY-----SKGLQV-NIEN-------T-----R-
A0A2E6GVY9      --------------FLVKIVDKSQLINNY-----SKGLSV-NIEN-------S-----R-
A0A350JJ90      ----------EDR-KYFILNSAPTLVQKL-----SKNYSV-RIQS-------A-----A-
A0A3M1CDV2      ----------NNQRTFIIIQSKDAVASYL-----QKKLEV-KPLN-------D-----L-
A0A6C1QGZ7      ----------RNH-FFFVLNNPETLASVY-----SRDIKI-NVLN-------P-----A-
A0A4P5U6G4      ----------TGQ-FYFVINNRQTVAKRI-----RDVIRI----N-------P-----Y-
A0A2E2TFD1      ----------RND-VFFTLNNNASIVNRY-----SKSLDL-KVLS-------Q-----S-
A0A2E4ELE6      ----------NND-FYFRLNSDAEIISKY-----SKSLKV-KLLN-------Q-----A-
A0A522EYA6      ----------GNS-QYFVVNNIDALANEY-----FSRLSV-KLLS-------D-----A-
A0A2E3XZI5      --------------FYFIIPTIKQIKKEL-----LGGLEV-NIID-------R-----S-
A0A6I7QXV0      ----------P---YFFILENREQLISRV-----SRNIQV-SAIN-------P-----R-
A0A2M7NLQ9      --------------YFFTLNSPEYQIAYI-----ASSLRA-NVLN-------P-----K-
I4AFR0          --------------YFFTLNSHEYQINYI-----ASSIKA-NVVN-------P-----K-
A0A2N2Y3E5      ----------KDG-LFFIVNNPETQLNKI-----IQNLVV-GVLN-------F-----E-
A0A2D9D7T6      --------------LYFVFNKKYDVMRSL-----KKNLTV-SAID-------P-----S-
A0A1F3PPL5      ----------HES-FFFILKNPTTLLNEH-----ISKLEI-KLQN-------P-----E-
A0A357QK06      ----------HES-FFFILKNPTTLLNEH-----ISKLEI-KLQN-------P-----E-
A0A662AEA4      ----------KTA-YSFIINNPDNIYLKH-----IDEIEI-RLLN-------K-----Y-
A0A0S2HYK8      ----------QNS-YYFVIYNDEQIFTEH-----SKKLNI-KLLS-------S-----S-
A0A2N5ZWN6      ----------QNS-YYFIISNMDQIYSEH-----SAKLTI-RLLN-------S-----S-
A0A2E0FJ09      --------------FYFLYSDLEKLASEF-----SAMLEV-SIAN-------S-----N-
A0A1F3FZ62      --------------YYFIINNPDLIVNEH-----INQIDV-SILN-------V-----L-
A0A1F3K211      --------------YYFIINNPDLIVNEH-----INQIDV-SILN-------V-----L-
A0A1V6I2U9      ----------KSQ-YFFTINNPNTTLKNL-----SKRLNV-QILN-------E-----T-
A0A2H0B957      ----------TDS-YYFTLNDSETVYQKY-----SSRLEV-SLLN-------Q-----E-
A0A1F3CFW6      ----------NDS-YYFIINDTESVYKKY-----SSQLEV-SLLN-------Q-----E-
A0A2M7E2T8      ----------NDS-YYFIINDTESVYKKY-----SSQLEV-SLLN-------Q-----E-
A0A2M7NC69      ----------NDS-YYFIINDTESVYKKY-----SSQLEV-SLLN-------Q-----E-
A0A1F3KLL5      ----------QNS-FYFIINNPTYLLQAY-----KANLLV-EVLS-------D-----E-
A0A359D1M1      ----------QNS-FYFIINNPTYLLQAY-----KANLLV-EVLS-------D-----E-
A0A0F2NS19      --------------MFFAINDLEALTNKY-----IQQLGV-FPLN-------P-----S-
A0A2A5H8X6      --------------MFFAINDLEALTNKY-----IQQLGV-FPLN-------P-----S-
A0A2H0GAU8      --------------MLFVINNIDDLTSRY-----ISQLNI-FPLN-------P-----S-
A0A2M8FTK1      --------------MLFVINNIDDLTSRY-----ISQLNI-FPLN-------P-----S-
A0A2A5B3B0      --------------LFFKINDYDKLTFAY-----IGKLAV-FPLN-------N-----A-
A0A5C6RXM7      --------------IYFKLNDNASLANNY-----ISKLSV-FPIN-------I-----S-
A0A1F3C1M2      ----------KNN-YFFIINNPINIIKDN-----LLKLKV-NILN-------P-----S-
A0A1F3DS87      ----------KNN-YFFIIKNPANIIKEN-----LDKLKI-SILN-------P-----S-
A0A6A0R6K9      --------------YFFIINDLQTLVKDV-----LSRLKI-FVVN-------I-----N-
A0A2E7CT70      --------------YFFKIPFFQEKRNEI-----INDLEI-SIID-------P-----A-
A0A2D5V560      ----------TNERLFFRIPSXNELKNSI-----LNGLTI-NIKN-------Q-----S-
A0A2D7K5A8      ----------SNERLFFKIPTKKEVINIL-----KNSLTI-TIQD-------Q-----S-
A0A2E1XQ82      ----------SNERLLFKIPNKKEVINII-----KNSLTI-TIQD-------Q-----S-
A0A5C8A5B4      ----------KNTKYHFEIYSLKDLVRVY-----RAMTMAVPLSD-------E-------
A0A4Y9ITE2      ----------KPLNITIVVNNYNQATENL-----QDDIKC-SIPN-------K-----K-
A0A5M8NYX7      ----------EY-PIVVVVRHPK-----Y-----IPYIQV-NPLN-------K-----M-
A0A3D5KRY6      ----------DE-EYVLIFNDLSRMALAY-----KEKLVV-KALS-------AIDPTIN-
A0A0E3V905      ----------EN-PYSIQVTKRATSVKNY-----LTNLHA-IPTG-------K-----G-
A0A553ETH6      ----------ES-DYFFTINSRAQLISYF-----ERNLVV-EPLN-------L-----N-
A0A640Q161      ----------LT-EEQLLAAKKRKATSLL-----MNALTV-EMV--------D-----N-
A0A640QU49      ----------LT-PEEILAAKKRKATSLL-----MKALNI-EMV--------D-----N-
A0A1Q3PII2      ----------HY-LYSFKISTEESVLDLY-----TRVLNI-YAPN-------K-----T-
A0A351BXT2      --------------EDVTALISVSSLADI-----LSQIVK-IDQK-------R-----G-
A0A2K8Z965      ----------IK-KMIVQVSKQTSAAKSY-----LSNLHV-IPTG-------K-----G-
A0A418M8U8      ----------TN-QVLVQAMKRPAAVNGY-----LRTLQA-EPTS-------K-----A-
I2GTA4          ----------TN-QVLVQAMKRPAAVNGY-----LKTLQA-EPTS-------K-----A-
A0A2K8ZAJ2      ----------LK-PIFATVSLHNDAVEGY-----LGNLKI-GSTT-------M-----L-
A0A368JPA3      ----------NE-PLVVQVMSPAQTIRYY-----QSKLTV-APSG-------K-----E-
A0A5N1JI29      ----------NE-PLVVQVMPQAQTIRYY-----QSKLTV-APSG-------K-----E-
A0A3P1BT12      ----------NE-PLIVQVMEHPQAIRYY-----LSKLNV-EPSS-------K-----T-
A0A3P1CI15      ----------NE-PILVQVMTDPQAIRYY-----LSKLTV-EPSS-------S-----T-
A0A4R8CUK1      ----------NE-PVSVQVMPDLEAIEYY-----LGKLQV-EPSS-------D-----A-
A0A3D0MYJ7      ----------------------------------------------------K-----N-
A0A662AH13      ----------------------------------------------------R-----G-
A0A5C7QA01      ----------SG-LYNIRKQSLPNAIKSL-----SANYAV-AERG-------K-----L-
A0A3D3LS70      ----------------------------------------------------R-----G-
A0A1G1TM36      ----------GG-EVRIRTSSPEAVVQAY-----QKLLDI-ELIN-------K-----V-
A0A1G7ZF38      ----------HY-QYSFKISATETILDHY-----DRVLRI-QAPN-------K-----A-
C6VS52          ----------LY-QYSFRTLAKETVVDHY-----ARTLSI-QAPN-------K-----I-
A0A7C1LGX3      ----------IGQEYEVVISPIKNTVLGL-----INKMEI-QTTT-------K-----D-
A0A2A4G4B1      ----------KGQSYQIYCTPISKTVNQI-----INNLQI-NPLS-------D-----K-
A0A0P7X1V8      ---------------------------RL-----YGNLTF-TRAD-------R-----N-
A0A6P1P355      ----------PSLPLFFAIMHPKKVTDNI-----ISNLSI-QAEN-------K-----L-
A0A5C8KAD6      ----------ATNPLYFTLQDPRKVTDQL-----VAKLTI-VPSG-------K-----L-
A0A5N1J695      ----------PIGPLYFSLIPTRQVTDGL-----LANLKI-EPAN-------K-----L-
A0A3B0C2S4      ----------EGIQFRVVLKSVKDAVFAL-----SEKLQV-QPTD-------K-----R-
A0A3N2M1H3      ----------ESIELKVVKKPMQTTVENY-----GEKLNG-DLVN-------Q-----D-
A0A4S2G8T2      ----------ESIELKVVKKPMQTTVENY-----GEKLNG-DLVN-------Q-----D-
A0A212K7W5      ----------YNQQILFVKSNLRSIVNHY-----TNALNV-GLSN-------E-----D-
F5IU11          ----------YDQKILFTKFNLRGIVNNY-----TNALNV-GLSN-------E-----N-
A0A7C1QWC7      ----------GGLPTFFRLHHVDNITSQY-----LKRLVV-EPVS-------T-----R-
A0A352Z1R7      ----------KGDNFRLKLLPLQNIAVSL-----KGGFKA-TEVG-------N-----R-
A0A3N2N6F7      ----------FDHDIRFSYWPMPTAISKY-----QAKLTE-TLSN-------E-----D-
A0A4P7VVU7      ----------FGNTIKIFRYSISDAIEAY-----KARLSE-NLAD-------D-----N-
A0A2V1ILM4      ----------FGNTIKIFRYSISDAIEAY-----KARLSE-NLAD-------D-----N-
A0A3N2L0E8      ----------FGNTIKIFRYSISDAIEAY-----KARLSE-NLAD-------D-----N-
A0A3N2LFC5      ----------FGNTIKIFRYSISDAIEAY-----KARLSE-NLAD-------D-----N-
A0A0A2F501      ----------RPSQIYVSYQNLYNVQELY-----SSGLKA-SINN-------D-----K-
R5B7P0          ----------MKKPVNVRKSGQRGVTQSY-----LNRLQV-NLAD-------K-----N-
R5B0L5          ----------SGMTIYVTKMPLQTAASIF-----SGRLTV-ALKE-------K-----L-
A0A6I1TEC0      ----------DAPALYVSHTDLYSMTNRI-----LGSLTV-GLNE-------E-----K-
A0A3R5XWG1      ----------DAPALYVSHTDLYSMTNRI-----LGSLTV-GLNE-------E-----K-
A0A5P0Y910      ----------DAPALYVSHTDLYSMTNRI-----LGSLTV-GLNE-------E-----K-
A0A414YFM3      ----------DAPALYVSHTDLYSMTNRI-----LGSLTV-GLNE-------E-----K-
A0A6A7UIA7      ----------DAPALYVSHTDLYSMTNRI-----LGSLTV-GLNE-------E-----K-
A0A6A7VPS3      ----------DAPALYVSHTDLYSMTNRI-----LGSLTV-GLNE-------E-----K-
A0A374THP7      ----------DAPVLYVSRSNIYAMTDRI-----KGSLAA-SLSE-------E-----K-
A0A6G1VND1      ----------DAPVLYVSRSNIYAMTDRI-----KGSLAA-SLSE-------E-----K-
A0A0A2EVS5      ----------TPMTIHVSRSNLSTTMAEC-----QKRLQV-GLIN-------D-----K-
A0A1T4NAJ7      ----------TPMTIHVSRSNLSTTMAEC-----QKRLQV-GLIN-------D-----K-
A0A255T941      ----------IGEKITYSKQNIDDLADAL-----STKLVA-ELDN-------K-----E-
A0A3N2KCL3      ----------EAVELEVVKAPVSATAGGY-----GSRMVI-AMSG-------D-----K-
A0A4P7VSV0      ----------EAVELEVVKAPVSATAGGY-----GSRMVI-AMSG-------D-----K-
A0A2V1IJY1      ----------EAVELNVVKAPVSATAGGY-----ESRMVI-AMSG-------D-----K-
A0A4P7VXK7      ----------EAVELNVVKAPVSATAGGY-----ESRMVI-AMSG-------D-----K-
A0A1Y4CHN5      -----------DSDVYVSRSTIYGAVQSY-----SQRLSV-GLAN-------E-----D-
A0A1M6I2S6      ----------VGTSIRYNKGSVRAVTDYY-----ATALRA-DLGN-------E-----D-
A0A1Y3V692      ----------VGTSIRYNKGSVRAVTDYY-----ATALRA-DLGN-------E-----D-
F3PXM2          ----------MGTSIHYGKQSVQAVTDYY-----TGALRA-ELGN-------E-----D-
A0A174AHH7      ----------TGSTIQYSKEPADAVADSY-----TQKLRA-DLGN-------E-----N-
A0A174JCE8      ----------TGSTIQYSKEPADAVADSY-----TQKLRA-DLGN-------E-----N-
A0A3E4JMC4      ----------TGSTIQYSKEPADAVADSY-----TQKLRA-DLGN-------E-----N-
A0A412SND6      ----------TGSTIQYSKEPADAVADSY-----TQKLRA-DLGN-------E-----N-
A0A414IEQ9      ----------TGSTIQYSKEPADAVADSY-----TQKLRA-DLGN-------E-----N-
A0A6I0U0V8      ----------TGSTIQYSKEPADAVADSY-----TQKLRA-DLGN-------E-----N-
A0A6L5S9H7      ----------TGSTIQYSKEPADAVADSY-----TQKLRA-DLGN-------E-----N-
A0A0M1W8D8      ----------TGSTIQYSKEPADAVADSY-----TQKLRA-DLGN-------E-----N-
A0A3R6GKX5      ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A7V4S1          ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
B0NU19          ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
D4V601          ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A0A4Q0U3M9      ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A0A4R4H1Q2      ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A0A6I0GII7      ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A0A6I0KYU7      ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A0A397WLT5      ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A0A6A2J529      ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A0A6L6P8N9      ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A0A6N8DDD8      ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A0A015XH67      ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A0A078RZN2      ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A0A4R4I3T9      ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A6L0K5          ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A7ACT5          ----------TGSTIQYSKEPADMVADSY-----TQKLWA-ELGN-------E-----D-
A6KY94          ----------TGSTIRYSKESADMMADSY-----TQKLRA-ELGN-------E-----D-
A0A173UQR8      ----------TGSTIRYSKESADMMADSY-----TQKLRA-ELGN-------E-----D-
A0A3R6HK75      ----------TGSTIRYSKESADMMADSY-----TQKLRA-ELGN-------E-----D-
A0A412B7D1      ----------TGSTIRYSKESADMMADSY-----TQKLRA-ELGN-------E-----D-
A0A412VNY9      ----------TGSTIRYSKESADMMADSY-----TQKLRA-ELGN-------E-----D-
A0A414LTU9      ----------TGSTIRYSKESADMMADSY-----TQKLRA-ELGN-------E-----D-
I9Q4U4          ----------TGSTIRYSKESADMMADSY-----TQKLRA-ELGN-------E-----D-
A0A373ISF0      ----------IGTSIRYAIGKADGAADRY-----LNALRV-ELGS-------K-----E-
U6RF62          ----------IGTSIRYAIGKADGAADRY-----LNALRV-ELGS-------K-----E-
A0A662ZZD5      ----------VGTSIRYRKGNVCAVTDYY-----TAALHA-ELGN-------E-----D-
A0A3A5TI83      ----------VGTSIRYRKGNVCAVTDYY-----TAALHA-ELGN-------E-----D-
A0A415NEB6      ----------VGTSIRYRKGNVCAVTDYY-----TAALHA-ELGN-------E-----D-
A0A6I0I238      ----------VGTSIRYRKGNVCAVTDYY-----TAALHA-ELGN-------E-----D-
A7AJ60          ----------VGTSIRYRKGNVCAVTDYY-----TAALHA-ELGN-------E-----D-
A0A6A2JF01      ----------VGTSIRYRKGNVCAVTDYY-----TAALHA-ELGN-------E-----D-
A0A6I0Y2Y2      ----------VGTSIRYRKGNVCAVTDYY-----TAALHA-ELGN-------E-----D-
A0A6I2Q447      ----------VGTSIRYRKGNVCAVTDYY-----TAALHA-ELGN-------E-----D-
A0A395YYT3      ----------VGTSIRYRKGNVCAVTDYY-----TAALHA-ELGN-------E-----D-
A0A015UXN7      ----------VGTSIRYRKGNVCAVTDYY-----TAALHA-ELGN-------E-----D-
A0A5M5W148      ----------VGTSIRYRKGNVCAVTDYY-----TAALHA-ELGN-------E-----D-
A0A6I2NTL0      ----------VGTSIRYRKGNVCAVTDYY-----TAALHA-ELGN-------E-----D-
A0A016E4F9      ----------VGTSIHYNKGSVNAVTDYY-----TQNLRA-ELGN-------E-----D-
A0A4Q5CFJ7      ----------VGTSIRYNKGSVRAVTDYY-----ATGLRA-DLGN-------E-----D-
A0A6N3HG44      ----------VGTSIRYNKGSVRAVTDYY-----ATGLRA-DLGN-------E-----D-
A0A6H9P0U9      ----------IGTSIRYVRGSVRAAVDTY-----SNALVA-ELGN-------E-----D-
A0A108TH71      ----------IGTSIRYVRGSVRAAVDTY-----SNALVA-ELGN-------E-----D-
I8VXH0          ----------IGTSIRYVRGSVRAAVDTY-----SNALVA-ELGN-------E-----D-
A0A412S0N6      ----------IGTSIRYVRGSVRAAVDTY-----SNALVA-ELGN-------E-----D-
A0A412IIJ0      ----------IGTSIRYVRGSMRAAVDTY-----SNALVA-ELGN-------E-----D-
A0A0P0FM97      ----------IGTSIRYVRGSVRAAVDTY-----SNALVA-ELGN-------E-----D-
R6KTP3          ----------IGTSIRYVRGSVRAAVDTY-----SNALVA-ELGN-------E-----D-
A0A139LU87      ----------IGTSIRYVRGSVRAAVDTY-----SNALVA-ELGN-------E-----D-
A0A1C6B3Y5      ----------IGTSIRYVRGSVRAAVDTY-----SNALVA-ELGN-------E-----D-
A0A6L3KCD1      ----------IGTSIRYVRGSVRAAVDTY-----SNALVA-ELGN-------E-----D-
E2NMQ4          ----------IGTSIRYVRGSVRAAVDTY-----SNALVA-ELGN-------E-----D-
A0A412YDB9      ----------IDTPIQYVRGSVSAAADTY-----ANTLVA-ELGS-------D-----D-
R7DY01          ----------IDTPIQYVRGSVSAAADTY-----ANTLVA-ELGS-------D-----D-
A0A414LGK8      ----------INTPIQYVRGSVSATADTY-----ANALVA-ELGS-------D-----D-
A0A415IPQ4      ----------TGTSILYSRGSVRAAADTY-----ANALVA-ELGN-------E-----D-
A0A3E5BRW7      ----------TDTPVRYARRSVRDVADAY-----TRELVA-ELGN-------E-----D-
K9DXS6          ----------TDTPVRYARRSVRDVADAY-----TRELVA-ELGN-------E-----D-
A0A1M6KFV3      ----------MGVPIRYVRRNVRSVSDAY-----AKELVA-ELGN-------E-----D-
A0A1Q6G7L3      ----------MGVPIRYVRRSVRSVSDAY-----AKELVA-ELGN-------E-----D-
A0A413H235      ----------MGVPIRYVRRSVRSVSDAY-----AKELVA-ELGN-------E-----D-
A0A1M5B2J8      ----------QETEIEVIRSTIKGAVGDA-----SSRLSV-VQND-------E-----K-
A0A255RCT5      ----------QEADVEVLRSTLKEAVAGA-----SSRLTV-SQDD-------E-----K-
A0A1Y4GLF5      -----------PCTLYVDRSTLYSAVNAY-----SANLSV-SLNN-------E-----K-
A0A1H3XSC0      ----------EPYTLYVFRSSLHGTVGQY-----SSNLSV-ALSS-------E-----K-
A6LE40          ----------EAYILYISKSSLYNAVNSY-----SSNLSI-SLNN-------E-----K-
A0A4Y1VPX5      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A6N2XMM4      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
B3JI46          ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A358R8U0      ----------RGCQLKVSRTGLYGAVGSY-----SGNLTV-TLSD-------K-----K-
R6WSB6          ----------RGCQLKVSRTGLYGAVGSY-----SGNLTV-TLSD-------K-----K-
A0A401LPX7      ----------TESTIYVTRQSLSAASAGC-----SANLTI-SQND-------E-----K-
A0A6G0GNY9      ----------TEEVIYVSRQSLAATSANC-----SARLNI-SQND-------E-----K-
A0A6I1BFM0      ----------TEEVIYVSRQSLAATSANC-----SARLNI-SQND-------E-----K-
A0A3A5Z900      ----------IESTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
A0A285TGL6      ----------TVSTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
A0A3A5RFX4      ----------TVSTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
A0A1Q6IUW9      ----------TVSTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
A0A413XDP6      ----------TVSTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
A0A6N8CVT6      ----------TVSTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
K6AP24          ----------TVSTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
A0A6I2NHV3      ----------TVSTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
A0A662ZYI7      ----------TVSTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
A0A078RYI7      ----------TVSTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
C7XEQ8          ----------TVSTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
D7INX6          ----------TVSTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
K5ZG55          ----------TVSTIYVTRQSLSAASAGC-----SARLNI-SQND-------E-----K-
A0A3N2N9B8      ----------QPIALKVNRLPLDAARASY-----SSRLSV-TQGS-------D-----N-
A0A3N2NMI0      ----------TAIELEVNKIPVKTAQAIY-----SSHLGV-SQSG-------E-----N-
A0A359I8H7      ----------PVTKIIVERDGMQSTVETY-----GGLVKA-DLAD-------K-----D-
A0A3N2KA63      ----------PVTEIIVERDGMQSTVETY-----SGLVKA-DLAD-------K-----D-
A0A4Q0IMT7      ----------PVTEIIVERDGMQSTVETY-----SGLVKA-DLAD-------K-----D-
A0A3B9FAU3      ----------TKDPILVTRTDLYTKTEGV-----QRNLSV-ELTD-------K-----M-
A0A3C1E5L7      ----------TKDPILVTRTDLYTKTEGV-----QRNLSM-ELAD-------K-----M-
A0A4Q0UAV1      ----------PVTFIHNTPEAL---AASF-----SGNITF-ELKE-------F-----S-
A0A354SN68      ----------ITSTICVRKCNITSATERV-----QRMYLA-TGRE-------D-----G-
A0A6L5XFL0      ----------YNSPIEVSHRSVKAVAGAL-----DHGLKV-ELND-------D-----N-
A0A3N2N595      ----------DLIDLEIDKKPLGWAVATY-----LGNLMV-SLNN-------K-----E-
A0A0A2DUD9      ----------LVNGLIIKRSSLYDAVENL-----GKNLTV-NLAD-------E-----K-
A0A3P1ZBJ5      ----------LKKSIQVVKYPLSDVVD-Y-----FGRINV-ELKE-------K-----E-
R5FHS9          ----------LYANLYVTHVPMMSAMSSY-----QKGLSV-SLAD-------N-----K-
A0A413TW79      ----------ESRKLHVTRTNLYAMTDHI-----KASLSA-SISE-------E-----K-
A0A3E5E9M7      ----------ESRKLHVTRTNLYAMTDHI-----KASLSA-SISE-------E-----K-
A0A3E4SK73      ----------ESRKLHVTRTNLYAMTDHI-----KASLSA-SISE-------E-----K-
A0A415GGC6      ----------ESRKLHVTRTNLYAMTDHI-----KASLSA-SISE-------E-----K-
A0A413DBH9      ----------ESRKLHVTRTNLYAMTNHI-----KASLSA-SISE-------E-----K-
A0A1Y4PQK7      ----------TEYKVRVVRSGLYGAVRTC-----SSRLSV-ALND-------E-----E-
A0A1Y4IH41      ----------TEYKVHVVRSGLYGAVGTC-----SSRLSV-ALND-------E-----E-
A0A3A6AAP4      ----------TEYKVHVVRSGLYGAVGTC-----SSRLSV-ALND-------E-----E-
A0A6I0ZRD2      ----------TEYKVHVVRSGLYGAVGTC-----SSRLSV-ALND-------E-----E-
A0A1Y4DYA7      ----------KET-VYISHSGLQATTSVY-----SGKLTV-ALKD-------E-----K-
A0A1Y3X4I9      ----------KEA-VYVSRSGLQSTAAAY-----SDKLNV-ALND-------E-----K-
A0A1Y4FNK8      ----------QEP-VYVTRISYQAATSAY-----ASNLSV-ALND-------E-----K-
A0A355FD59      ----------TSPLIYVSRTNLYSATNAC-----KEALTI-SLSD-------E-----K-
A0A359CEZ9      ----------TSPLIYVSRTNLYSATNAC-----KEALTI-SLSD-------E-----K-
A0A353Q7B4      ----------TSPLIYVSRTNLYSATNAC-----KEALTI-SLSD-------E-----K-
F8X3A5          ----------EMPLIYISRTNLYSATDLF-----KQNLTA-SLSE-------E-----K-
A0A1M3KVR9      ----------EMPLIYISRTNLYSATDLF-----KQNLTA-SLSE-------E-----K-
A0A4Y9IJS3      ----------EMPLIYISRTNLYSATDLF-----KQNLTA-SLSE-------E-----K-
A0A495WI87      ----------FSQPIYVSCSSLYSAVRRY-----APNLSV-VLND-------E-----K-
A0A354M4S6      ----------FSQPIYVSRSGLYSAVRRY-----APNLSV-VLND-------E-----K-
R7DH52          ----------FSQPIYVSRSGLYSAVRRY-----APNLSV-VLND-------E-----K-
A0A4Q5E7L5      ----------EAYTLYVGKSSLYSAVNNC-----SSNLSV-SLNN-------E-----K-
A0A4P8LP09      ----------EAYTLYVDKSGLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A4R4GZU7      ----------EAYTLYVDKSGLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A016CWA4      ----------EAYTLYVDKSGLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A1C6H117      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A0M1W0V2      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A139KA16      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A174VQ92      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A1Q6HCG0      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A1Y4JYM9      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A3A5QW67      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A3A5RQE6      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A3A6BP07      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A3E5E153      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A3Q9IP20      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A412WV15      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A413ICP6      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A414KYB9      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A5B3FWR2      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A6L4P3V7      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
E5WX00          ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
K0X3P3          ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A415TAH7      ----------ETYTLYVGKSSLYDAVNSC-----SSNLSV-SLNN-------E-----K-
A0A078T2W6      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A6I1AQV4      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A5C6L2P1      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A412MJT7      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A3E4WKT5      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A3A5YY33      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A078TAH2      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A1E9CFZ7      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A373FYU5      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A3A5TZ72      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A3A5XBP2      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A3A6MEG9      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A3E4JP35      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A3E4KP40      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A3E4NX82      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A3E4XFU8      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A412RG70      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A412TD37      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A413GAA4      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A414M7I4      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A496BTA0      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A496D2V6      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A4Q5G1P5      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A5C6KCA6      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A5M5AHM5      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A6I0KZV6      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A6I0Y5K7      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A6I1BFB8      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A6I2P5W5      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A6N8DC51      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
E5UZA2          ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A069SMG6      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A6A2RTB3      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A6I0VY00      ----------EAYTLYVGKSSLYNAVNSC-----SSNLSV-SLNS-------E-----K-
A0A1M4YZ07      ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A0P0FQW1      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A5M5C0W6      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A6I0H151      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A642LZ22      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A6I0HI59      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A642NJ89      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A6I0HI52      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A6L3JTQ2      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A6L4EED9      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A6I0YVB5      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A6L5RHE2      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A6N3AEV2      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A6L3KG29      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A6G0G4T5      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A6I0HFG9      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A4Q5E5M7      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
A0A6L4F5W0      ----------EAYTLYIGKSSLYNAVNSY-----SSNLSV-SLNN-------E-----K-
C3RFN5          ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A3A5Z014      ----------ESYILYIDKSSLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A6I0ING7      ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A6L5S265      ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A078S3Q8      ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A069SJV7      ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A3E5DXI5      ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A3E5EM98      ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A3E5F453      ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A6N2YYD4      ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
I9T3G6          ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A3E4SYU0      ----------ESYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A6LGY1          ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
K5ZSH4          ----------KAYTLYVGKSNLYNAVNSC-----SSNLSV-SLNN-------E-----K-
A0A1H4ADG3      -------------NIKMDVSSINAVADGF-----KENINA-EISD-------K-----Q-
A0A5B8VUR8      -------------SIKMAVASINAVADSY-----KENINA-DISD-------K-----Q-
A0A0D3L8Q3      ----------GM-TVRVHFNNIQRLASNY-----SDRLVV-EKDK-------L-----AW
A0A2N3U785      ----------YS-EVLVEFKDYRRVANYY-----RNALSI-YPIN-------K-----E-
A0A5B6TJH8      ----------LN-QVKVQFQNIQEVASRY-----HNAIEV-MQAG-------K-----TW
A0A519U664      ----------SD-KIIVRFNDIHQVAAHY-----SQAIGI-QPVG-------K-----S-
A0A519MA34      ----------SD-KIIVRFNDIHQIAAHY-----SQAIGI-QPVG-------K-----S-
A0A519UCX0      ----------SD-KIIVQFNDIHQVAVHY-----SQAISV-QSVG-------K-----S-
A0A0E3ZG78      ----------GS-KLTVKFKNVQQLAEHY-----SQAIQI-GPVN-------K-----S-
A0A1I6BRK6      ----------GT-KIIVYFQDIYQVANHY-----SQAINI-KPVG-------K-----T-
A0A243WAB1      ----------DR-KVIVSFQDIHQVADHY-----NKAIAV-QPVG-------K-----S-
A0A6G8C8X6      ----------EN-KIIVHFQDIKQVAAHY-----NKAIVV-QPVS-------D-----G-
A0A416GA42      ----------EL-EIEVLKSTVRNTGNAL-----VARLGV-AKAS-------K-----E-
A0A1T3IYP5      ----------GT-DVFVAKYPREVIMSQF-----VANLKI-KQME-------E-----D-
A0A1T5K9D4      ----------GE-AIYIQKIPVSQAAAAY-----SSALSI-SQNN-------S-----A-
A0A077ENE7      ----------GV-EIQVAKSPREAVMSNF-----VGNLSI-KQME-------E-----E-
A0A6I5UW06      ----------GV-EIQVAKSPREAVMSNF-----VGNLSI-KQME-------E-----E-
T0NN57          ----------GK-DIQVTKYPREAMMENF-----KGKMKI-AQMD-------E-----D-
X5K347          ----------GK-DIQVTKYPREAMMENF-----KGKMKI-AQMD-------E-----D-
A0A060RD97      ----------GK-EVNVAVTSVAKAQLDF-----SSRLTV-ARAD-------K-----V-
A0A3C1ITV0      ----------Q--AVIVGYERPELTAKSC-----QARLTA-ELAD-------K-----L-
R7HN19          ----------Q--AVIVGYERPELTAKSC-----QARLTA-ELAD-------K-----L-
A0A350IHV0      -------------PIVVSWVNAKRLAKAY-----CKKLNV-SLSG-------K-----E-
R5RVP0          ----------KK-PMRVSWVNSAKLAKAY-----CKGVTV-ALSG-------K-----E-
R6A0L2          ----------DE-TIEVDRLSKEKAAARF-----LKMLSA-SEYD-------K-----E-
R7LG80          ----------DE-EITVNRNSVSATADAL-----RKRMDV-AQIE-------K-----E-
A0A2L2WX98      ----------GE-TVTVTRLPKKMAAASY-----CKQFSAGEYDK-------K-----E-
A0A6N8KXI9      ----------GE-EILIKKIPLEAMAAYF-----LSNMTI-QQLQ-------D-----D-
G5GD56          ----------GK-TIQIHHLPIEMAAKIY-----QEKIKA-SAYD-------K-----E-
R5KD55          ----------DNDEIDVRKSDNASATGRF-----LGGLSV-EIGD-------K-----K-
A0A174QNT3      ----------GK-DVLVTRSDLETVTNSM-----MERIQT-SAMD-------Q-----K-
A0A4S2FGS1      ----------GK-EIRVTRSDLESATNAV-----MGRIQT-SAMD-------T-----K-
R9I0H0          ----------GK-EIRVTRSDLESATNAV-----MARIQT-SALA-------S-----Q-
K5BUT9          ----------SQ-PISVSRISPEIATNIY-----QSKIAT-SLAG-------E-----R-
A0A174FPA3      ----------SQ-PISVSRISPEIATNIY-----QSKIAT-SLAG-------E-----R-
R6S9Y6          ----------SQ-PISVSRISPEIATNIY-----QSKIAT-SLAG-------E-----R-
A0A642LIH6      ----------SQ-PISVSRISPEIATNIY-----QSKIAT-SLAG-------E-----R-
C9KX15          ----------SQ-PISVSRISPEIATNIY-----QSKIAT-SLAG-------E-----R-
A0A6H0KRK1      ----------GK-PVSVTRISPETAAAIY-----KGGIST-SLAG-------K-----G-
R6DAG6          ----------GK-PVSVTRISPETAAAIY-----KGGIST-SLAG-------K-----G-
A0A3L8AAP1      ----------GK-PVSVTRISPETAAAIY-----KGGIST-SLAG-------K-----G-
A0A4S2AYX2      ----------GK-PVSVTRISPETAAAIY-----KGGIST-SLAG-------K-----G-
A0A4Y9H477      ----------GK-PVSVTRISPETAAAIY-----KGGIST-SLAG-------K-----G-
A0A0E2M2Y7      ----------GG-ILYVTKENIRKVIQRY-----NKDLQI-SLAD-------K-----N-
A0A0K2J6Z0      ----------GG-ILYVTKENIRKVIQRY-----NKDLQI-SLAD-------K-----N-
B2RKZ8          ----------GG-ILYVTKENIRKVIQRY-----NKDLQI-SLAD-------K-----N-
A0A212GC82      ----------GG-ILYVTKENIRKVIQRY-----NKDLQI-SLAD-------K-----N-
A0A254MU12      ----------GG-ILYVTKENIRKVIQRY-----NKDLQI-SLAD-------K-----N-
R6CQ93          ----------GR-DIHVSKIPLNAAAGRF-----LGSMGI-RQEE-------D-----E-
A0A3D1NQW3      ----------EKAPIRVTKGNLGVVTQFY-----QHEVKS-FVAN-------K-----Q-
B0MT10          ----------EKAPIRVTKGNLGVVTQFY-----QHEVKS-FVAN-------K-----Q-
R7JGW9          ----------EKAPIRVTKGNLGVVTQFY-----QHEVKS-FVAN-------K-----Q-
A0A3D2BF46      ----------GD-PISVSKQIVSSVASGY-----NKRIAI-ELVE-------K-----Q-
A0A358R538      ----------GV-PVRVRKRSLGSATSAY-----RNAVKC-DVAN-------K-----Q-
A0A1Y4AAB8      ----------GT-AIQVAKSSLEAATSAY-----RAAVKC-AVED-------K-----Q-
A0A1Y3WWY9      ----------GV-PIRVGKSSLKALTDTY-----RGAIKC-DVA--------K-----Q-
A0A1Y4U5L4      ----------GV-PIRVGKSSLKALTDAY-----RGAIKC-DVA--------K-----Q-
A0A1Y3VCJ1      ----------ET-PIRVSKGDLKTIANMY-----RGAVKC-EVTN-------Q-----Q-
A0A1Y3QTW7      ----------DR-PITVTKSSPMVTTNAY-----RATVKS-DVAN-------K-----Q-
R6XWY7          ----------DR-PITVTKSSPMVTTNAY-----RATVKS-DVAN-------K-----Q-
A0A4Y1X9Y9      ----------DR-PITVTKSSPMVTTNAY-----RATVKS-DVAN-------K-----Q-
A0A4Y1WM66      ----------DR-PITVTKSSPMVTTNAY-----RATVKS-DVAN-------K-----Q-
A0A6N4GYT3      ----------DR-PITVTKSSPMVTTNAY-----RATVKS-DVAN-------K-----Q-
A0A174AVF1      ----------DR-PITVTKSSPMVTTNAY-----RATVKS-DVAN-------K-----Q-
A0A656Q4F4      ----------DR-PITVTKSSPMVTTNAY-----RATVKS-DVAN-------K-----Q-
A0A1Q6EIY0      ----------KK-PITVIKNSLAATTNAY-----RAAVKS-DVAN-------K-----Q-
A0A5B5VN71      ----------KK-PITVIKNSLAATTNAY-----RAAVKS-DVAN-------K-----Q-
E4M8L3          ----------KK-PITVIKNSLAATTNAY-----RAAVKS-DVAN-------K-----Q-
I3YQ50          ----------KK-PITVIKNSLAATTNAY-----RAAVKS-DVAN-------K-----Q-
R5UEY8          ----------KK-PITVIKNSLAATTNAY-----RAAVKS-DVAN-------K-----Q-
A0A1H4D866      ----------GV-PIRVVKNSLSRTTNAY-----RNAVKS-DVAN-------K-----Q-
A0A5B3G4Y7      ----------GV-PIRVTKSSLGRTTNAY-----RAAVKS-DVAN-------K-----Q-
A0A374A9J5      ----------GV-PIRVTKSSLGRTTNAY-----RAAVKS-DVAN-------K-----Q-
A0A5B3GQN5      ----------GV-PIRVTKSSLGRTTNAY-----RAAVKS-DVAN-------K-----Q-
A0A1Q6E9S3      ----------GV-PIRVTKSSLGRTTNAY-----RAAVKS-DVAN-------K-----Q-
D4IJ36          ----------GV-PIRVTKSSLGRTTNAY-----RAAVKS-DVAN-------K-----Q-
A0A414Q925      ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
A0A415PUS9      ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
A0A108TCU0      ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
A0A413BA42      ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
S3Y344          ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
A0A4Q5G8Y8      ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
A0A412TGL3      ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
A0A413VJ33      ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
A0A414L0W6      ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
A0A412DP39      ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
A0A413ZSE8      ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
B0NP84          ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
R6AK43          ----------GK-TVYVTKGNMKEVAESY-----NKALNV-GVAN-------K-----Q-
A0A412N2D9      ----------GK-SVYVAKGNLKEVAEEY-----NKALNA-GVTN-------K-----Q-
A0A1Y4JYS9      ----------GK-SVYVAKGNLKEVAEEY-----NKALNA-GVTN-------K-----Q-
R6LHA4          ----------GK-SVYVAKGNLKEVAEEY-----NKALNA-GVTN-------K-----Q-
A0A3E5HPT8      ----------DR-PIKVTSKSREGMVAFW-----LSNLTI-RQMS-------G-----D-
C6IJ48          ----------DR-PIKVTSKSREGMVAFW-----LSNLTI-RQMS-------G-----D-
Q8A3U2          ----------DR-PIKVTSKSREGMVAFW-----LSNLTI-RQMS-------G-----D-
A0A3R6S1H6      ----------SV-PVTVTKYNLLQVAKAC-----NAGLRA-YLAD-------K-----K-
A0A3R6SD81      ----------SV-PVTVTKYNLLQVAKAC-----NAGLRA-YLAD-------K-----K-
A0A354WXN6      ----------NK-DISINKRAASAVTNAY-----QAALNA-SLAS-------K-----T-
R5IP14          ----------KK-VITVNKRRLKDATTRY-----RRAVSV-SLES-------K-----N-
A0A316SZX7      ----------KN-EIKISKNPVKAVAASY-----KGRMNV-SLIG-------K-----T-
A0A1Y4AIY1      ----------NK-EVHVRKSNLKGIATGY-----QNALVS-ELVA-------E-----Y-
A0A0J6CIR2      ----------GK-AVTISKRNREEIALTY-----SNSLQV-ALAS-------K-----T-
A0A3D8HG59      ----------GT-PVRVTKSDLDETVLHF-----NRILQV-ALAS-------K-----T-
A0A3R6S408      ----------GT-PVRVTKSDLDETVLHF-----NRILQV-ALAS-------K-----T-
F3ZRU7          ----------GE-TIQIHHRGLKNVTLGY-----GNAIQI-ALAD-------K-----K-
A0A1C5Q1F3      ----------QV-PVTVNKMNLEKVGMAY-----NAALQS-MVAS-------K-----T-
R7A239          ----------QV-PVTVNKMNLEKVGMAY-----NAALQS-MVAS-------K-----T-
A0A3R6HIK7      ----------NI-PIQVTKSRLKSVAKRY-----QSALQS-TLAD-------K-----M-
K5ZVW7          ----------NV-PIQVTKSRLKSVAKRY-----QSALQS-TLAD-------K-----M-
A0A1Y4D5Z0      ----------GK-SITVRKSNLSNVARAY-----LNKLQS-TVAS-------K-----T-
A0A413VXJ7      ----------EK-PISVTKSNMERVVDAY-----QSSMEV-SLAS-------K-----T-
I9RSN9          ----------EK-PISVTKSNMERVVDAY-----QSSMEV-SLAS-------K-----T-
U6RJK5          ----------EK-PISVTKSNMERVVDAY-----QSSMEV-SLAS-------K-----T-
A0A1Q6GA32      ----------EK-PISVTKSNMERVVDAY-----QSSMEV-SLAS-------K-----T-
I9RPU6          ----------GK-PVNVVKSNLESVIEGY-----RGRLKV-SLAS-------K-----T-
I8YFS5          ----------GN-PVFVTKANMEKVVEGY-----QSKMKI-SLAS-------K-----T-
A0A6L3FCC6      ----------GK-PVYITKSNMEKVVEGY-----LRRINI-SLAS-------K-----T-
I8Y597          ----------GK-PVYITKSNMEKVVEGY-----LRRINI-SLAS-------K-----T-
A0A1Q6GBF5      ----------DK-PVHVTKSNMESVVENY-----RNRLKV-SLAS-------K-----T-
I8YFZ3          ----------GR-SVNVVKFNMESVVESY-----RNKLKV-SLAS-------K-----T-
A0A1Q6GDH2      ----------GK-PVNVVKSNLESVIEGY-----RGRLKV-SLAS-------K-----T-
U6RSB0          ----------GK-PVNVIKSNLESVIEGY-----RARLKV-SLAS-------K-----T-
I9SIK1          ----------GK-PVNVVKSNLEGVIEGY-----RGRLKV-SLAG-------K-----T-
I9GXM2          ----------GK-PVNVVKSNLESVIEGY-----RGRLKV-SLAG-------K-----T-
I9TP59          ----------GK-PVNVVKSNLEGVIEGY-----RGKLKV-SLAG-------K-----T-
R5S343          ----------NR-TVMIEKNIVSDVVDAY-----RERMRI-ELAD-------K-----S-
A0A1M6K7I9      ----------GD-KILVQKFVTERVVDDC-----MATLSV-SLAS-------K-----M-
A0A5M6A8C8      ----------GD-KIQVQKSVTERVVDDC-----MTTLSV-SLAS-------K-----M-
A0A6L3FBE6      ----------AK-PIYVVKSNMEKVVEGY-----QNRIKI-SLAS-------K-----T-
A0A6L3FNG1      ----------DN-PIYVTKSNMEKVVEKY-----LNEINI-SLAS-------K-----T-
A0A3R5ZMK1      ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAS-------K-----T-
A0A6L6NFJ9      ----------NT-TVQVTKSPLQNVAIGF-----QANLQA-TLAS-------K-----T-
A0A1Y3ZIA4      ----------NT-TVQVTKSPLQNVALRF-----QSGLQA-TLAS-------K-----T-
K5Y1A4          ----------NT-TVQVTKSPLQNVALRF-----QSGLQA-TLAS-------K-----T-
A0A4Q5CIT0      ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAS-------K-----T-
A0A6L6NWL9      ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAN-------K-----A-
A0A3R6K8X4      ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAN-------K-----A-
A0A6N8D6C8      ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAN-------K-----A-
A0A3R6BKI7      ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAN-------K-----A-
A0A6N8CW60      ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAN-------K-----A-
A0A412M2W1      ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAS-------K-----T-
K5ZX55          ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAS-------K-----T-
A0A415BDM7      ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAN-------K-----A-
A0A6L6MX19      ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAN-------K-----A-
A0A1Q6I3T6      ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAN-------K-----A-
A0A414XX40      ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAN-------K-----A-
A7AEU7          ----------NT-VVQVTKSPLQDVALRF-----QGGLQA-TLAN-------K-----A-
A0A5F0U645      ----------GS-EITVSKSNQDRVALDY-----NESLQV-VLAS-------K-----T-
K5ZBN2          ----------GS-EITVSKSNQDRVALDY-----NESLQV-VLAS-------K-----T-
A0A0J6CKW3      ----------GS-EITVSKSNQDRVALDY-----NESLQV-VLAS-------K-----T-
A0A0F5IQM7      ----------GS-EITVSKSNQDRVALDY-----NESLQV-VLAS-------K-----T-
A0A496CDT3      ----------GS-EITVSKSNQDRVALDY-----NESLQV-VLAS-------K-----T-
A0A6G1ZKM3      ----------GS-EITVSKSNQDRVALDY-----NESLQV-VLAS-------K-----T-
S0GLB0          ----------GS-EITVSKSNQDRVALDY-----NESLQV-VLAS-------K-----T-
A0A3R6NLC1      ----------GS-EITVTKSSRDWVALNY-----NEALQV-ALAS-------K-----T-
A0A416WYC9      ----------GS-EITVTKSSRDRVALNY-----NEALQV-ALAS-------K-----T-
A0A0F5IT40      ----------GK-AVTISKRNREEIALTY-----SNSLQV-ALAS-------K-----T-
A0A496CX20      ----------GK-AVTISKRNREEIALTY-----SNSLQV-ALAS-------K-----T-
A0A5F0UBI0      ----------GK-AVTISKRNREEIALTY-----SNSLQV-ALAS-------K-----T-
A0A6G1ZHG0      ----------GK-AVTISKRNREEIALTY-----SNSLQV-ALAS-------K-----T-
S0GSI7          ----------GK-AVTISKRNREEIALTY-----SNSLQV-ALAS-------K-----T-
K5YB65          ----------GK-AVTISKRNREEIALTY-----SNSLQV-ALAS-------K-----T-
A0A0F5IWP9      ----------GK-PVAVVKKNRVDVALGY-----SNTLQV-ALAS-------K-----T-
A0A0F5IZT8      ----------GK-PVAVVKKNRVDVALGY-----SNTLQV-ALAS-------K-----T-
A0A417LKQ2      ----------GK-PVAVGKKNREDVTLSY-----SNALQV-ALAS-------K-----T-
A0A416TME1      ----------GK-SVVVGKKNREDVALNY-----SNALQV-VLAS-------K-----T-
A0A416XPE8      ----------GK-SVVVGKKNREDVALNY-----SNALQV-VLAS-------K-----T-
L8JI02          ----------NT-RYYFVIHDLSEVIETY-----QTELEV-YPIS-------R-----E-
A0A4Q5WS95      ----------QG-PFYFRLIDPKSVAAGL-----QKKLDV-APAG-------K-----L-
A0A501VZX6      ----------KH-PLYFSLIRPKKIVESL-----EKNIKI-EAEN-------K-----L-
A0A399SH26      ----------KE-QLYFQLLPLKAVTASL-----LNNLQV-NAAN-------K-----L-
A0A501W1A9      ----------TG-RLFFSIKDPRKAARQL-----ASSIQI-ETPG-------K-----L-
A0A0E3ZGV6      ----------TN-PLYFSIISPTRAANQL-----SGSIFI-ESAG-------K-----L-
A0A1I2N4S1      ----------QH-PLFFSINNPKAVAKQL-----ISRIYV-ESPG-------K-----A-
A0A2T5YE44      ----------QN-PLFFSINNPKAVAKQL-----ISRIYV-ESPG-------K-----A-
A0A1M5BA90      ----------TN-PLYFSLNNPKMVLNSL-----VTNLRV-IAAS-------K-----L-
A0A512B879      ----------TN-NLYFSLVPPKQALNSL-----ILNLNV-SPIN-------K-----L-
A0A559PPI3      ----------KK-PLYFILINPRSVTQSL-----LKSLEV-APPE-------K-----L-
A0A1T5CS78      ----------SN-PLFFYLLNPKIISTSL-----LDELDI-STSN-------K-----L-
A0A0Q9Z8F1      ----------SN-PLFFYLLNPKMISSEL-----IDELDI-STSN-------K-----L-
A0A2N0U0M7      ----------SD-PLFFYLLNPKMISSEL-----IDELDI-STSN-------K-----L-
A0A1V9FHD0      ----------TG-QLYFDLYKTKNLAPTI-----SLNLVV-TSEN-------K-----L-
A0A4V4H170      ----------EG-PLFFRLYKPKNIAPGF-----ISNLGV-KSAS-------K-----L-
A0A1V9F098      ----------GG-PLFFRLSKPKNVAPGY-----IASLEV-KSSS-------K-----L-
A0A4R2VU64      ----------GG-QLYFQLIKPKNVAPGI-----IASLDA-KPAS-------K-----L-
A0A4S8HY23      ----------VA-PLFFRLYKPKNRAPAI-----ISNLQV-KSSS-------K-----L-
A0A1V9F383      ----------VG-PLFFELNKPKDVAPGI-----LLNLQV-NSPN-------K-----L-
G8TRZ6          ----------VG-PLFFNLNKTKDVVPGL-----LLNLLV-VSPN-------K-----L-
A0A4R5DL69      LRKTIYKPDPEN-TYSIKISGFESTVSEY-----SRRLSI-SATN-------K-----Q-
A0A1M4YED3      ----------QG-ALKLFLYNPESLASSY-----ANRVSI-PPNP-------K-----S-
A0A2H3NSN0      ----------DD--EQPTDSE---AMIRL-----FDMVDF--AAE-------A-----D-
A0A2P6C324      ----------SE-EEPYTQYA---AILRL-----QEMVSF--VPD-------Q-----Q-
A0A7C2DZI7      ----------RD-GHEPSIRE---IALRL-----QMQVRF--QPL-------S-----D-
A0A1M6XHU0      ----------ED-GREPSIRE---IAFRL-----RERVRF--RPL-------S-----D-
G2SF81          ----------ED-GREPSIRE---IAFRL-----RERVRF--SPL-------S-----D-
A0A5S9EYW1      ----------ED-GREPTIRE---IALRL-----RERVHF--QPL-------S-----D-
D0MHQ9          ----------ED-GREPSIRE---IAFRL-----RERVRF--SPL-------S-----D-
A0A126PFG0      ----------GS-RLRIVARDPDLVVTAY-----QKALEV-DLIN-------K-----I-
A0A3M1N7Z3      ----------EG-QYEVVVFAPQATTFAW-----QRRVSV--IPK-------R-----G-
                                                                            

A0A1T5MMH4      AQTIRIAFQDNNPLKAHAIVDAINKTYLHYSYEQKKLTTKQKIDWLNNELQQIELKMEGF
A0A2W4R1L8      ANTIRISFKDHNPLKAQTVVNKIDSLYLIFSNEQKTLANRQKITWLTNELKQIEEKMSQY
A0A2E5CV79      TGVLEITFQSVFADEARRISDGIAQVYKNLEKTIGNEDATLRVEFMDDLVNQQEGKLLLA
A0A2D4ZVH1      ADIVSISFESPLPTEASSIINMTMDTYSALSTEQNRTMAVSALEFLRTERTKLESELVST
A0A0K8QSK7      TSILTLTVQDHNSAKGNDFLNKLVEVYQRDNLNQKNEVANRTINFIHSQLGEISDSLSIS
A0A1V6CN82      TSIVDIDLKDYHPQKAVDFLNKLVEVYRIDNVEKKNQYADQTINFIEYLLEGVSDSLAVA
A0A1M4XZ45      TSILNLTLRDYNVSKGVAFLNKLTEVYQLDNLEKKNENANRTIHFISSQLQSISDSLSVS
A0A399D319      TSILNLTLRDFNVKKGVDFLNKLTEVYQLDNLEKKNENANRTIQFISSQLQSISDSLSIS
A0A1V5IPN7      TDILNLSFESTNRGEAMAAVNAIADAVQQQNTQMARLEFTTIREFLGEQLDLISRRLQIS
A0A1M6GR99      GTFIEISMKTNSVQLGEDIINELIQVYSESNLEKKNHLANMTLEYIDEQLDEVSASLNLT
A6EBM4          SNILSLQQTDVNPRFAADILNAILQEYLDYDKLQKTQSATQMIGFINEQLKHLSSAVSGA
A0A7C5M4P4      ANIFRISFRDHNQGKAQALVSAIDTLYYKYSLEEKNRANRNKIEYLESQLIETEKKLDEY
A0A1M6TTV4      ANTIKIALSDPNKYKAKSLLQAIDTIYLNFTKAAKNLAVEQKISFLDRQMKKTQVELEQY
A0A4Q8RX32      GTVVNVLLKSNNARMGIDFLEQYVVTIIEDNLDRKNYIAHTTIDFIDNQLSQVFDSLNLA
K0X1U5          ANGISLKIRESNKQRGKDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVEEELHEA
R5EXK3          ANCISLKIRESNKQRGKDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVKEELHEA
A0A401UAP7      ANTIRISFKEFSAEKAMDIVNKIVNIYLGFSNEQKNFANKHKIDWVNNELEQIEEKMSQY
A0A1W2GF52      ANTIKISLSDFNQTKARNLLQAIDTIYLAFTKNAKNQAVEQKIRFLETQMAKTSKELVEY
A0A2G5L7B8      ANTIKIALADPNKYKARSLVQAIDTIYLNYTKAAKNQAVEQKISFLETQMYKSQIELEQF
A0A523GAC0      ANTIRISFRDHNRYKARDLVSAIDTIYLTYTKEEKNKANQQKIDFLDDQLLLTQSKLQDY
L8JW09          ANTIRIAFKDYNPLKARDLVNAIDTLYLKYSEEEKNLENKQKIEWLNSELRQIETQLEGY
A0A364XUP5      AKTIRVAFKDNNPSKARAILQVIDDVYLKYSHEQKNLANKQKIDWLNNELQQIEEKMEGY
A0A1M5RLA9      AHTLRISFKDNNPTKATAILNKIDSIYLHYSYEQKNLANKQKIDWVSNELVNIEHKMEDF
A0A385SFR9      ANTLRISFKDNNPSKATAILNKIDSIYLHYSYEQKNLANKQKIDWVSNELVNIEHKMEDF
A0A5M4A9J4      ATLLNLKMESATPSKSISFLNKLMEVYQQQNLDKKNEMATRTIQFISSQLGSVSDSLTAS
A0A5M4B1C7      ATLLKLSMLSPTPQKDIDFINQLMEVYQDQNLEKKNAMATRTIQFISSQLSSVSDSLVKS
A0A0D3LFR6      AKTIKISLTDYNPYKARVVVDAVSNMYLTYKEEEQIKANNQKIAFLNTLVEDAESKLEGY
M7N6D4          AKTIKISLSDHNPFKAKVLVDVLSNMYLGYTEEEKIKSNSKRIAFLDEQVEETEAKLEDF
A0A4D7K1D4      ANTIKITFTDNDKYKAYDVVNTIDSLYLEYSREQKMQANKQKIAFLEEQMGNTAQTLENY
A0A5C7MX19      TKSFKISYKDKSAVKTRDITNMMVRVFVEYDMEKKREGFENVISFLNVQIGQFEEGNTAF
A0A1Q3ZMZ7      AQTIEIKFESHNANLSRDVVNVIIDEFFAFDEMLKKQSSENVLNFLNNQLDSLAIELNKS
A0A2D8JJW3      TSHLVITVESLDSKEAANIVSCLIDSYVEEEKKHANQKTSDQIIFLKNQILSNSDSLLKM
A0A2W2AFF7      VTLINLSLQSNIPHQGEDALNKLINVYLQANVDDKNKIADSTMRFIDDRVALVGEELTGI
R7PCR1          SSLIQLVCQDVNKKRAEVLLSTLLDVYREDIIESKNRVAENTSKFIEERIGLIEQDLIKV
A0A1G9E2A9      ASTIRIAFKDYTPEKARDIVNKIDSIYLVQTIENKNLATEQTLKFLDDQLDSTAQKLAQQ
A0A098LL25      ANTILLSYKNHNYSKATDIVNTIDSVYLEQTLENKSKSHEQTIKFLEASLLKTEENLAKA
A0A6J4H627      ANIIGIFFKDKNIRKAHDIVNKIDSVYLSKTKELKNKANKQKIAFLEEQLQSTEDKLQEY
A0A6C0GJI1      ANSLGISFKDHSIAKARDIVNTIDSVYLTKTLEIKNTSNKKKIEFLEGQLLATEKNLEKY
A0A2T2YJE8      ASTVEISFTDHNPFKAHEIVNSIDSVYLEQKIALKDLATRQTLSFLDEQLKETNENLGNS
A0A127B287      AKTISISFKEFNREKARDVVNKIDTVYLQQKLARSNQASQQTIDFLSNQLQETQDNLQKA
A0A6P1P2P6      AKTISISFKEFNREKARDVVNKIDTVYLQQKLSRTNQASQQTIEFLTNQLQETQDNLQKA
A0A3M9N829      SKTIQISFKDFNRYKARDIVNNIDTVYLQHKLERSNQASRQTLNFLTEQLKETENSLKKV
A0A0P0CSF9      SKTIQIAFKDFNRFKARDIVNNIDTVYLQYKLERSNQASKQTLNFLNEQLKETEDSLRKA
A0A5M8QQB8      SKTIQISFKDFNRFKARDIVNNIDAVYLQHKLERSNQASKQTLSFLNEQLKETEDSLRKA
A0A3M9MNC3      SKTIQISFKDFNRYKAHDIVTNIDAVYLQHKIERSNQASRQTLTFLNDQLKETEDSLRKA
A0A5B6TAX2      SKTIQISFKDFNRYKAHDIVNNIDAVYLQHKIERSNQASRQTLSFLNDQLKETEDSLRKA
A0A5N1IQ33      ANTIGISFKDNNALKAHDIVDKIDTLYLQEKLAKNSLASQQTLAFLEGQLDENSRKLQQA
A0A512AYT3      AHTIGIFFTDFNPAKARDIVTEIDTAYLEQKIHQKNLASSQRQKFLDQLLKETETNLQNS
A0A5M6CYN7      AHTVGIFFTDFNPAKARDIVNKIDSAYLEQKIRQKNLATSQIEQFLNEQLKETQDNLANS
A0A369QP10      ASTVDISFTDHNPFKAHEIVNSIDSVYLEQKIALKDMATRQTLSFLDEQLKETNENLGNS
A0A126PDF2      ANTIQISFTDFNPKKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERA
A0A2Z3GKA1      ANTIQISFTDFNPKKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERA
A0A502GZP7      ANTIQISFTDFNAKKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLDVNYDNLQRA
A0A519SBU8      ANTIQISFTDNNPSKAAHIINNIDTVYLKEKLDRKRQSSALTLSYINQVIADNDKLLRQA
A0A4Q3JNZ3      ANTIQISFTDNNPEKAAHIINNIDTVYLQEKLERKTKNSELSLGFIDRVIAENDKKWQAA
A0A519Q9V3      ANTIQISFTDNNPEKAAHIINNIDTVYLQEKLDRKKQSSALSLKFIDQVIADNDKRWRAA
A0A0M3RW20      ANTIGISFADHNPLKAKDIVNRIDTVYLVEKLAKNSQGQQQTLQYLDEQLDITRDSLQRA
A0A495VFX4      ANTIGISFSDHNPLKAQDIVNRIDTVYLVEKLAKNSQGQQQTLEYLDEQLDVTRDSLQRA
A0A1S9B3W0      ASTIGISFTDNNPAKARDIVNKIDSVYLQVKLARTNQATQQTLTFLDGQLVENRDKLQNA
A0A1W1VRL3      ANTVQISFKDFNPAKAQDIVNKIDTVYLQEKLAQKKKASDQSLQFLSEQADAFNNKLQLA
A0A1M6R305      ANTIQISFQDFTPAKARAIVNKIDTVYLQEKIAQKQAATAQTLQFLQQQLAENRQNLAVA
A0A4Z0PHK3      ANTIQIGFTDFNPAKARAIVNKIDTVYLQEKLAKKQEATAQTLQFLDKTLTENQQQLQGA
A0A2M9B9H9      ANTIQIAFTDFNPAKARDIVNKIDTVYLQEKLAKKQEATAQTLQFLDKTLTENQQKLQSA
A0A4Z0QCY9      ANTIQISFTDFNPAKAREIVNKIDTVYLQEKLAKKQEATAQTLKFLDRTLAENQDKLQDA
A0A418R9X5      ASTISISFTDYNPSKASDIVNYVDSVYLVEKILRKQETMARATNYIDRQLGVNSDKLSQA
A0A428JSJ3      ASTISISFADHNPVKASDIVNKIDTVYLVEKLLRKQETMARATSYIDQQLGINDNKLGQA
A0A428KI59      ASTISIAFTDHNSVKARDIVNKIDSVYLVEKLLRKQETMARATNYIDKQIDINDNKLGQA
W8F1I6          ASTISIAFTDHNPVKARDIVNKIDSVYLVEKLLRKQETMARATNYIDKQIDINDNKLGQA
A0A246FQC0      ANTISISFTDHNPAKAQAIVNGIDSVYLVEKLVRKQEQATRAMGYINDQLGDNNQKLNQA
A0A372E5P8      ANTISISFTDHNPAKARDIVNAVDAVYLEEKLTRKREQAARALRYINEQLGSNNQSLSQA
A0A1H3EMW1      ANTISISFTDHNPAKARDIVDAVDAVYLEEKLVRKREQSARALRYINEQLSNNNESLGQA
A0A1H9ZSN3      ANTISISFTDHNPAKARDIVNAVDAVYLEEKLARKREQSARALRYINEQLGSNNQSLSQA
A0A5N1J2M4      AQTIKISFTDHNPKKAQDIVNRVDSVYLEHKRETKNQSNEQTISFLREQLDATKVSLQEA
A0A519S476      ANTIQISFTDNNPVKAAHIVNNIDTVYLQEKMARKKQGNDSTLSYLDKLIDETDKRFKAA
A0A4Q3JRW8      ANTIQISFTDNNPEKAAHIINNIDTVYLQEKLDRKKQSSALSLQFIDQVIADNDKRWRAA
A0A519M923      ANTIQISFTDNNPEKAAHIINNIDTVYLQEKLARKKQQSELSLKFIDLVIADNDQRWRAA
A0A4Z0ENW1      ASTLQISFLDNNRVKAQRIVNALDTVYRDVKLAHKQETTEKSLDYLDKQLQENGKNLANA
A0A519UDB4      ANTIQISFQDNNRLKAQRIVNALDSVYREAKVARKQEATEKTLAYLDQQLAANGINLAKA
A0A3S0QKV1      ASTIGISFSDNTPQKAQAIVNKIDSVYLNVKLDRSSQATQQTLAFLQGQLLDNRAKLQDA
A0A328BL48      ANTIGISFTDYNPAKARDIVNKIDSVYQQVKLARNYQSTQQSMAFLDSQLNGNRDSLQKA
A0A5R8WLY4      ANTIGISFTDYTPTKARDIVNKIDSVYQQVKLARNSQSTQQSMAFLDSQLNGNRDSLQKA
A0A1I5WSL8      ANTIQISFNDFNPTKAQDIVNKIDSLYLVEKVTRKNEATRNQLKFLDQILDENGQNLERA
A0A0U3JVM7      ASTIQISFNDFNPSKAQDIVNKIDSVYLAEKLAQKSETTTRKLRFLDQILDQNGQNLERA
A0A1G1SSV2      ANTIQIAFNDFNASKAQDIVNKIDSVYLEEKLAQKSESTISKLRFLDQILDQNGQNLEDA
A0A1G1SXV7      ASTIQIAFNDFNPSKAQDIVNNIDAVYLEERLAQKQESTISKLRFLDQILDQNGQNLEDA
A0A6G8CBJ6      AHTVEISFADFNPLKAQDIVNKIDTVYLQEKLAQKKEASEKSLRFLGEQTDVTNNKLQQA
A0A0W8EDI5      ANTIAISFKDHNPKKARDIVNKIDTLYLQEKLAKNTQATQQALAFLEGQLDQNSQRLQGA
A0A3B7RBP8      ANTIGISFKDHNPGKARDIVNKIDTLYLQEKLAKNSLATQQTLAFLEGQLDENRNKLQGA
A0A3R9P8H7      ANTISISFTDHNPTKARAIVNKIDSVYLVEKLLRKQEQAARAMSYINEQLGENNQKLGQA
A0A238WIA7      ANTISIGFTDYNPLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEENRRLLRQA
A0A212UCJ7      ANTISISFTDNNSLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLADQSNDNRQLLRQA
A0A4Z0MQE1      ANTISIAFTDHNPLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEDNRQLLRQA
A0A4Z0PCF4      ANTISISFTDHNPLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSDENRQLLRQA
A0A6M6BED0      ANTISISFTDHNPLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEENRRLLRQA
A0A5D6VDG1      ASTISISFKDHNPRKARDIVNRIDTVYLVAKLTKNTQSQQQIMQYLDKQLELTRDSLQRA
A0A6H1CVS0      ANTIGISFTDHNPRKARDIVNRIDTVYLVAKLTKNTQSQQQIMQYLDKQLELTRDSLQRA
A0A243WHR7      ANTIQISFTDFNPSKAQAIVNKIDTVYLQEKLAQKQEVTQRQLKFLETQIVENKDSLQGA
A0A5B8A0P6      ANTIQISFQDFNPLKARDVVNKIDSVYLEEKLAQKQQATAQTLEFLDKTLTENKNKLEAA
A0A076HRT9      ANTIQISFQDFSPSKARAIVNKIDTVYLQEKIAQKQTATAQTLQFLDQQLTENRQSLAQA
A0A4Z0PVM7      ANTIQISFTDFNPAKARDIVNKIDTVYLQEKLAKKQEATAQTLQFLEKTLAENQQKLQGA
A0A1M6DHW8      ANTIQIAFTDFNPAKAQDIVNKIDTVYLQEKLTQKQQATAQTLQFLEKTLSENRKQLQLA
A0A4Q5LC61      ANTIQIAFTDFNPAKAQDIVNKIDTVYLQEKLAKKQQATAQTLQFLEQTLAENRTQLQNA
A0A2N5YXE2      AGTILITYNDYNARKSAEITNTIAEKFIEFDENKKKESANNIITYIDQQMENVFLQLTNT
K0XJ09          TTLVQINCVDSNISRAEAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDV
R5EUZ0          TTLVQINCVDSNISRAEAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDV
W0EQS0          TTLVQINCVDSNISRADAILSTLIDVYRETIIEDKNRIATSTAKFINERVEIISRELGDV
A0A1Y3WE15      TTLVQINCIDSNTSRAEAILNTLIDVYRETIIEDKNRIATSTAQFINERVEIISRELGDV
A0A1Y4GUK3      TTLVQINCVDSNISRAEAILMALIDVYRETIIEDKNRIATSTAKFINERVEIISRELGDV
A0A2U1FKU2      STIVRLSLNNTDLDRAKDFINTLISSYNDDVMNDKKSVAVSTATFIDERLAMIGGELGSV
A0A0A2F954      ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAISTASFIDERLAMIGGELGSV
A0A0A2FW91      ATIVNLSLKNEDLDRAKNFVNTLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGSV
A0A2D2N2N1      ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTV
Q7MWZ2          ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTV
T2NDT6          ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTV
W1R7P9          ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTV
A0A1R4AFZ0      ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTV
A0A1R4DVZ7      ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTV
A0A7C0WKI7      TDIIKIKMKAPSGWEAAFLTNKIAHGYQVLDRNQSRGEISEVVNFLDKQLSQKSKDLKNS
A0A2A8CVM9      QSMIQFTVESGVPEEASTVANLYSSQYEIFSREKARASVTAARDFLETQAEKRREEIREL
A0A5M4B212      GTMIKLSTTCENPEKGIDFLNKMMQVYQTRNLDKKNVIATKTIFFITSQLASVSDSLSAS
A0A3D1KEX9      ASLISLTCKDNNKDRAEAILTVLMDLYKRDIVESKNSVAANTAKFVDQRIDLIGSELNDV
A0A358Y7S2      AKTIEITYENSNAKLSYDITKTLIEQYLFFQEEMNIKNAKKTIDFIDYQLDSLSRVLEIS
A0A1X7J248      ANTIKITFEDYNPYKVQEIVETVSELYTEYSKEQKNKANQLKIQFLNKQLKQTESELANY
E4TQD2          ANTIKITFEDYNPYKVQAIVEQVSELYTKYSKEQKNKANQLKIEFLNKQLKQTENELSNY
A0A2J6HHN3      AKTIRISLRDINASKATDIVNAITTEFELFEIEEQKQSSESILEFIDGQLGIVEENLTES
A0A1Y3WMT8      ANGISLKIKDSNRKRGQDILDTLIECYNEDAVLNKNLKAQNMLSFIDDRLATVENELHEA
A0A1Y4GQU1      ANGISLKIEDSNRRRGQDILDTLIECYNEDAVLNKNLKAENMLAFIDDRLITVENELHEA
A0A6A0R272      VALLSIVYQSSNPLLCKDFVDALVSSYSNVEFELKALAASNTIRFIDERLDQLSSTMNEV
A0A1V5W8T5      AKTIRIYYTSNNAQKTSDLVNTISEDFLTYNIEKKQERAEKVLAFIEEQMSVVYNKLDES
A0A2T8HKA9      AGLLQLTLEDHSPKRATDLIKTLIEVYNEQTVEEKNRVAVSTADFIRERIAIIERDLGTV
A0A2I0QZ80      AKTVEISYRSHSPTFAKDIITALTKSFFKYDEGLKKESAENVLGFIASQLDSLTRELSIS
A0A3E1F1A3      AKTVEVAYRSSSPQLATDMVKSLVSNFFNYDEDLNKESADNILDFINQQLDSLTQELSVS
A0A2U2XBJ3      ARTVQISFRSHSPLLAKEMIQSLTANFFKYDENIKKESADNVLEFIAVQLDSLTRELKMA
A0A4Q4KU94      ARTVELSFRSHSPTLAMEIVQSLTANFFKYDENIKKESADNILDFIAVQLDSLTQELKVA
A0A3B8INU3      ANTIRVSFQEYNRQKAQDMVGAITSIYQTYTKDQKKQANQQKIEFLDDQLMQTEERLDRY
A0A2W1NDY9      ANTIKVSFRSNNNVLAQDMVREVVETFFTYDLEKKSKSSESILSFIDEQLDTVYNSLKFS
A0A5C8AQR5      AKTIEISYQAYNPVLCNDIVSAITSAFFEYDESLKKQSSDNILQFIESQLDSLALELKLS
A0A1G0CI31      AKTILIRYQGYNAELCHDITNAVAEAFFTYDEEVKRKSAENILQFINKQLDSISGELQIS
A0A556N0M0      AKTIELRYSGNNPDLCKDIIQSVATTFFNYDEEMKRKSADNILSFIQLQLDSISGELKDS
F2IKD6          AKTIELRYTGNNPELCRDIIKSVSLTFFNYDEEMKRKGADNILAFIQIQLDSISGELKDS
A0A1I7BM74      AKSILISYRSNNAHLSQDICNAVGESFFDYDDHLQQESSEKILKFINAQLDSLNKELILS
A0A2G2FJ17      AKTIEISYRNTNANLAQDITKAIGDAFFEYDERYTKESAENILSFISLQLDSLRKELSAS
A0A2E3R1D0      ADAIRVNAVSTDPQEAALISNTYAEAFAQLTQDQSRSGASASREFLEDQVETQNDRLQET
A0A2T2USC0      ADAINISVKGVSASEAALIANLYAQEYINYNERKSKESARSTRKFLEQQSKKFRNRVNRA
A0A2T2V0F3      ADAIRISVRGVSASEAALIANLYSQAYIDYNQRKSQESARSTRKFLEQQASKFKNRVDRA
A0A2T2S682      VDAIRITAQGPVPAEAALIADQYAAAYLQRTREKSRESLRAKRDFLDQQSDKFATQVQQA
D5H561          TNVIQIVAQDETPAVARRLANLFTEAYIELTQKSSRERVKASRTFLEQRSQELERELETI
A0A2H3NWA9      IDAIRLSATSTDPQEAALLVNLFSEEYVEFSRDRSRQSVQATYDFLKEQSESLRVDMEEA
A0A2A8CVB6      FDAIRIVATGRDAADVALVANIYADEYIRRTKEKARESLQASRDFLERQAEKLKAEVQAA
A0A2P6C1S6      TDALYISASSHHPNEASLVANLYAEEYIQRTQERSREDLRASRQFLEEQADTLRQDVQAA
A0A2T2UTM4      TDALYISAKSHHPYEVSLIVNLYAEEYIQRTKEKSREDLKASREFLEEQADTLRQEVQAA
A0A414ZBF2      SSLINLTIEDENIGRAEDVLNTLIEAYKNDAIEDKNKVVINTANFIKDRLTIIEADLGVI
A0A1Q3Q573      NNTLAITYADQNPEKAKDIANALATEFIDYDLNKKREGMGNILRFIDGQIDSFSREQQAI
A0A662BAY3      TSIIELSLKTLNVAKGIDFLNTLVAVYQAYTLERKNENASRTINFISTQLQTVSDSLGIS
A0A4U3L369      ANVIDLSMTSKVPSKGEFILNYFIQRYLRSSLEQRNQIADSTLSFINERLGIVTGELGNV
A0A357YNR3      SSVADVSLICSNVALGRDFLVKYIQTYNEKGIADQIELADKTSRLIDDQLSKLSGELSDV
A0A5E8AX52      AKTIKISLRDFNKYKARDFVTAIDTLYLKYTTEEKNQAIEQKLSFLDEQLGITERKIEEY
F4KK08          ASVIKLTIQAGNPLLAEDFLSTLILVYTELERSDKVKIAESTQRFVDDRLAIISSELGQV
A0A6B5PK86      ARTVSIAFKGDNSKLCHDVTLAVANTFIDYSVKLKKKSSESILQFIEVQLDSLSTELKRS
A0A2G2F510      AKTISISYRGYTPQLCKDITLAISNSYISFDEDMQRKGSENILGFIDSQLDSLSNELKSS
A0A316JZ08      ARTIQVSFKGHNARMCRDLSLAIAEAYQEYDEEINRKSSENVLSFINNQLDSLYFELQSS
A0A496LCF9      TSVLDVSVNSDNPARDVDFLTQHAKSFLGDNLDKKNYEADKTIQFINSQLSIISDSLTQS
A0A5P2G2A9      VSAINLTLPVEIPSKGEDVLDTLIKEYIKSNKDQKNAYADSTISFINDRLGLVSGELTNA
A0A3C0ZQC7      SDVIKVTARSVQPKEAALIANTFAEAYYDRNLFSSRSRSRAAREFLDTQLKVRKSSLDES
A0A419VXB7      ADVISLQLTGQNPDQKISYLNELSRVYIQYGLQQKNQISDNTIHFINQQLKDIVDTLKST
A0A0B0BTJ4      SNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDV
A0A3B9CNN6      SNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDV
R5X290          SNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDV
A0A1Q6E6I7      SNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDV
C3J7R8          GSIITLTMQHQNPEVAEDFLNTLVQIYNENSRMEKVRVAQKTEHFIDGRLAIIGGELGSV
A0A1G8BVM8      SSLVQLSIIDTHPQRAEDIINTLVTVYEKNAIDNKNQVLSKTVDFITDKTTILENELRSI
A0A1I1FXP9      ANTIRIIIKDHHPQKAHDIMVTIDSVYLEQTLEQKNKVNEQTLAFLNSQLDTTAQKLAMS
A0A3N4H5N3      SSTIYLTMLNTSPARGKDIMSSVINGYNFLNLNQKNEVALKTINFIDERLALAREELNQV
A0A2P8EAX2      SSTLFIRLLDSSPTRGKQILNSLIEGYNTSNQNQKNEVALKTIKFLDEKLFLAKKELDSL
A0A4V2F6N9      SSTLFIRLLDSSPTRGKQILNALIDGYNSSNQNQKNEVALKTIKFLDEKLLVAKKELDSL
A0A3B9FXJ0      GGKIVIEYTDVNDQRAKDVVNTIADAIVTNGLERKSVSANSIISFIQSQIDSLENELYIQ
R5GSU5          SSLIVLTFQDTNKKRAEDFLNVLLDVYKEDIIDGKNRIAESTAIFIDSRIKIIGDELNDV
A0A2A3UE91      AKTILIRVKDVNAAKSSDIVNAITEEYLAFDVERKSESSRNIISFIDSQLGNVYDALKDT
A0A0A2G557      SSVIDLRFKDENTDFAEDFLNTLISQHDATSRSEKLKIAHNTEAFINDRITIISKELGDV
A0A2N2WFW8      AKTIRISIRDMNPRKAADLVNKVAEEFAAFEVEYQKESSNSILDFIDTQLGLVEDNLDQT
A0A1F3IU95      AKTIRISLKDYNPRKAADVVNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQT
A0A3D0VUF6      AKTIRISLKDYNPRKAADVVNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQT
A0A1T4PT95      SSIIDLRFRDENPHLAEDFLNTLINEHDTTSRLEKLKIARSTEAFINDRITIISKELGDV
A0A6I6JYY3      TSIVGLTLRDLNQEKGIHFLNKLTEIYQLDNLGKKNDNANRTIQFINSQLQNISDSLNVS
A0A2A4PYG9      AKTIQVTVRENNPQKAADIVNSMASEFVEYDVEKKAQSATKILEFIDSQLLQVYDKLRSS
A0A1F3K695      AQTIEIAFSDNNPLKTAEIANVIAEEFLTYDVEKKKESANQILSFIEEQESTFVKNIDET
A0A353KZR1      AQTIEIAFSDNNPLKTAEIANVIAEEFLTYDVEKKKESANQILSFIEEQESTFVKNIDET
A0A2N2WYB5      AQTIQITYSGYNPEKAADIVNTIAEEYLKYDVESKKESAESILAFIEERLKLVYQNLDET
A0A1F3K4G0      AQTIQISYSGYNAEKASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDET
A0A356H8Y3      AQTIQISYSGYNAEKASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDET
A0A351HSA6      AQTIQISYSGYNAEKASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDET
A0A1F3Q014      AKTILVSYKGFNPQKAADIVSKMTEEYSNFDIERKGESSLKVIEFIDHQIDIVYEQLKSS
A0A2D5KD44      AKTLQVGISDNNRLKAFDIVNGLIDEFKLYNVEKKKQSSKQILDFLNAQIESVYEKQKVY
A0A6N9NIX1      AKTIQISFIDENPFKIRDFVSGLIKEFQVYDINRRKKSSSRILDFINEQLGAVYQRQQKS
A0A2A4YXP3      AKTINISFEDHNPKKAVDIVTAVANEYIIYDIEERSRSSKNALQFIDEQLDRYYNKLRLS
A0A1F3R158      AKTISLSFQDNNAVKTADILTSLANEYIIYDIEERSKSSKNVIEFLDDQLDKYYNKVKLS
A0A2M8ADX2      AKTISISFQDNNATKTADIITALANEYIVYDIEERSKSSKKVIEFLDDQLDKYYNKVKLS
A0A1J5B2H0      AKTVSITFRDENAQKTSDIVNTIAEEFVIYDIEKKAESTNKIIEFIDNQINRMYDTLAKS
A0A1V5N756      SQSIMVMYSDRNPVKAADIVDTIISEFNLYDVEKQAMSTDKILKFIDEQLEIFNQKLFET
A0A651GU15      AQTIQISCKNHNATLARDFVMAHAHQYLQYDQESRELSASNIIRFIDNQIEEVYNELRET
A0A3Q9FR88      ANTIQISFKAANREKAVAVLKAINTAYSQLSRESKALVYERALTYLFKQIDTTKDSLALQ
A0A553GEX3      ANTIQISFKAANREKAVAVLKAINTAYSQLSRESKALVYERALTYLFKQIDTTKDSLALQ
A0A150ADJ9      ANTIQISFTAGNREKAIAILQSINLAYSQLSREGKALVYERALDYLYNQADLTRDSLSLQ
A0A1B1FWQ4      AKTIQISFTARNRKKAERVLEAINKAYSQLSREGKALVYERALEFLYSQIDITKDSLNNL
A0A1S1Z228      AKTIQISFTARNRKKAEAVLEAINKSYGQLSREGKALVYERALGFLYSQIDITKDSLNNL
A1ZKR2          ARIIGINFRDHHPQKARDIVHVIDTIYLHKTLENKKRANTQQKAYLNRRLGEIEDSMRTY
A0A1Q3GX01      ARIIGVNFRDYNPLKASNIVHVIDTIYLQKTLENKKRANIQQKEYLNRRLNEIEDSMRNY
A0A349DQI4      ARIIGVNFRDFNPLKAKHIVHVIDTTYLQKTLENKKRANIQQKKYLNRRLNEIEDSMRNY
A0A4P5TMD1      --TIQFSLQDPVPLKAVDIINTLQEEFIKYNKERKTESSSLIIDFIDTQIGLLNTELQAY
A0A2N3IIZ0      AKIIAISFKDHNATKARDVLKSISEVYRVKSVEIKNRANRQKKEYLDAQIEKTEKELNAY
A0A1F3SJM1      AKTISISFRGHNAQLCHDVTLAISKAFQEFDEESKRQGADNIIRFIDNQLDSLRKELKSS
A0A2G2EB96      AKTISISFRGYNAVLCRDVVNAVSKSFIEYDEEQKRKSSDNIISFIDDQLDSLSSEVRIA
A0A2G6PRA9      AKTISISFRGHNATLCRDVVQAVSESFIEYDEEQKRQSSENIISFIDAQLDSLSSEVRIA
A0A497D5Z2      SSILEISLLEENEQKGVAFLNKLAEVYEQYNLGKKNENASRTIKFITSQLASISDSLSIS
A0A662B170      SSILEISLLEENEQKGVAFLNKLAEVYEQYNLGKKNENASRTIKFITSQLASISDSLSIS
A0A2A5FYT6      AKTIKISFTDHSGKKAKDISEAIAEGFINIDVERKSQSAEKVLNFIDTQIESVYGRLRTS
A0A2E6SYP1      AKTIKIGYSGDHPEKCADIVNSLASAFLISNISKKKESANQMIKFTDDQVVKINKRLEYY
A0A2E5RLE8      ANTIKISYTGNHPKKCADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYY
A0A2E7TQF6      ANTIKISYTGNHPKKCADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYY
A0A2E6GVY9      ANTIKISYTGNHPKKCADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYY
A0A350JJ90      AKTVQIVVTDNNPAKASAICEQIAQTYLVFDHERKSESANQVLEFINQQIEEVYSKLKIS
A0A3M1CDV2      AQTISISIKDVNPQKTTDIVNTIAEEYLIYDVERKSESSKNILNFINAQLSVVYEELKNS
A0A6C1QGZ7      AKTIQINYQGTNAAKASDIVNIIAEEFGMYDLEKKTESANNILAFIDQQLSLLGSTLTTA
A0A4P5U6G4      TPSILISFQDKNPYRAADIVNAMNDEFISYDKEKKTESATLILNFIESQINLINAELQAY
A0A2E2TFD1      AKSISISFTDPNPRKAADLANAISTGFIDYDLTRKIYSSTQVIEFIDSQISEVYGRLKES
A0A2E4ELE6      ANSVEISFSDYNPRKAADLSNAISGGFIDYDLQRQITSSNQILEFIDHQSSEVFTRLKSS
A0A522EYA6      AKTIQISFQDNNAAKTTDIVNSMAEQFKEYDREKKGESEQKILSFLEDQLAIAFERLRTA
A0A2E3XZI5      AHTINIIHKHSNTFFSKDICNSLAEIYIDYDLERKQLSSEKIVKFINNRKDSVQKKLILN
A0A6I7QXV0      TKTLQIKYSDNHPQKAKEIVETLTKEYINYDLERKQESASQILNFLNNQIDVFSDDLAQF
A0A2M7NLQ9      AYTIQVSFTDNNPYKAAIVTNTVVDIYFEKTLENKNKVYRQTINYLEDQVRIVQDSLERI
I4AFR0          AYTIQISFTDNNPYKAAIITNTIVDIYFEKTLENKNKVYKQTIDYLDAQTTIVQDSLEQV
A0A2N2Y3E5      AQTIQITYTDFNPQKTSEIVNTISEQFLKYDVEKKKESADKILDFIENQSDLIYDELDKI
A0A2D9D7T6      AKTIQITFDHYNPELTRDMTQAIMDVFFLYEEEISKKNTDKILAFVDTQLDSLSTLLQKS
A0A1F3PPL5      ANTIEISYVDNNALKTSEVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSET
A0A357QK06      ANTIEISYVDNNALKTSEVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSET
A0A662AEA4      ANTIEISCTSNNANKTSEMVNTIAEEYMKYDIEKKKESAQNILSFIDLQLKSVYKNLDHT
A0A0S2HYK8      SNSIEISYQSHNSQQAADLVNAVAREFQRFEVEKKKESIQNILAFIERQLKNVYKTLDTT
A0A2N5ZWN6      SNSIEITYESNNSQQAADVVNKIAQEFQLFDVEKKKESVKNILDFIERQLKNVYQTLDNT
A0A2E0FJ09      ANTIGLSFTHPNQVLTKDVLGALIENFDQFDSIKRSESSNRIVEFIAMQKDSVSKKLKES
A0A1F3FZ62      AQTVLINVTNQNATKSADIANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKT
A0A1F3K211      AQTVLINVTNQNATKSADIANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKT
A0A1V6I2U9      AGTIKITYQDFNARKSTEITNTIAEKFIEFDEAKKKESATNIIKYIDQQMENVFTQLNAT
A0A2H0B957      ANTISISITDNNARKTSEIVNAIAEQFIKYDVEKKKESSQKILDFIEVQNNLIYQQLDSI
A0A1F3CFW6      ANTIQISFKDNNAQKTSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSI
A0A2M7E2T8      ANTIQISFKDNNAQKTSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSI
A0A2M7NC69      ANTIQISFKDNNAQKTSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSI
A0A1F3KLL5      AKTISIKYSDYNAQKTTDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDEN
A0A359D1M1      AKTISIKYSDYNAQKTTDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDEN
A0A0F2NS19      AKTISISFNDNNALKTSDVITSLANEYILYDIEERSKSSKKIIQFLDDQLDKYYNKVKLS
A0A2A5H8X6      AKTISISFNDNNALKTSDIITSLANEYILYDIEERSKSSKKIIQFLDNQLDKYYNKVKLS
A0A2H0GAU8      AKTINISFQDNNSTKAKDIVTSLANEYILYDLEERSKSSKKVIEFLDDQLDKYYNRVKLS
A0A2M8FTK1      AKTINISFQDNNSTKAKDIVTSLANEYILYDLEERSKSSKKVIEFLDDQLDKYYNRVKLS
A0A2A5B3B0      AKTINISFQDNNGEKAKEIITAVANEYIDYDIEERSKSSKKALQFIDQQLDKYYNRVKGA
A0A5C6RXM7      AKTINISFKDYNAAKARDMVTAIAEEYIDFDIEERSKSSKKILEFVDIQLDKYYNKLKLS
A0A1F3C1M2      AQTVDISFTDNNATKTSDVVNTISEEFLKYDVEKKKESDQQILAFIEDQESLLLKNIDQT
A0A1F3DS87      AQTVDISFIDNNATKTSDVVNTIAEEFLKYDVEKKKESDQQILAFIEDQESLLLKNIDQT
A0A6A0R6K9      AKTVSIAYDDINRIKTKDIVSSVIREFKVYNVEKKKQSSKQILEFLNDQIYNVYEKQRVS
A0A2E7CT70      ANTIGITYSHTNPKFAQDVCNTISKVYIDYDLKKKALSSINIVQYINAQKDSVDKRLKLS
A0A2D5V560      AHSXQISHQHTNPHFSKDICNSIVKNYMDYEIDKKQKSTDNIVSFITRQKDSVRKRLIRN
A0A2D7K5A8      AHSIKISHLHTNPHFSKDVCNSFVKIYMNYEINKKQKSTDKIVAFIKIQKDSVKNRLIKS
A0A2E1XQ82      AHSIKISHQHTNPHFSKDICNSIVEIYMNYEINKKQKSTDKIVAFIETQKDSVKNRLIKS
A0A5C8A5B4      SNVVNLSIQVEVVEKGQAFLNKLMETYIDYELDKQQQKGRKTIDFIDKQIGTVSDSLQKV
A0A4Y9ITE2      ARVITISLNSTNVPFAEKVVNALVEGYNERGIEENRVKNQITADFIETRLGSIAEELNAA
A0A5M8NYX7      TTVVDVTTKTEVPQKGIDVINTLIGIYNQRSIAEKNYVANHTIDFINDRITTITEELSSS
A0A3D5KRY6      SNMITLELKTNQLERDVDFLDQLSKMYIQYGLEKKNRKASNTITFIDNQIAGVNYSLQSA
A0A0E3V905      STVILLSLEDAVPAKGEAILNQLIREYNEAAIMDKNKVAASTLKFIEDRLNIVSGELASA
A0A553ETH6      ANTIKIALQDFNRYKARDLVNAIDSLYLNYSKQEKTKENKQKIEWLDNELREIESQLEDY
A0A640Q161      TQLMRITVTTESPSLSAELANAVADVYIENYLQAKLDMTAKATSFLTDSLEGLKKKLDVA
A0A640QU49      TQVMRITVTTESPNLSAELANAVADVYIENYLQAKLDMTAKATSFLTDSIEGLKDKLDIA
A0A1Q3PII2      ASLVNLSWQDVLPRKGEAILSQLIARYMKASIAEKNKVADNTIAFINQNLQRISSELAEV
A0A351BXT2      LDVVDIIVESPAKYEAMLIANLYSKVYQSFSLDLSREELTSLTGYLREEKENKFKDLAVA
A0A2K8Z965      STVILISLEDGVPSKGEAVINQLITEYDQAAIMDKNKVAANTLKFIEDRLNIVSGELSSV
A0A418M8U8      STVVVLTLEDAVPEKGEAVLNQLIDEYNQAAIIDKNKVAANTLRFIEDRLAILSGELTTV
I2GTA4          STVVVLTLEDAVPEKGEAVLNQLIEEYNQAAIIDKNKVAANTLRFIEDRLAILSGELTAV
A0A2K8ZAJ2      STVLVMNLQEAVPSRGEAILNQLISEYNKEAVVDKNNQASSTLNFIEDRLALISGELSNV
A0A368JPA3      STVLVLTIEDAVATKGEAILNQMIANYSSASTTEKNRAVANTLSFIQTRLKLVSAELATL
A0A5N1JI29      STVLVLTIEDAVPTKGEAILNQMIANYSSASTNEKNRAVANALSFIQTRLKLVSAELATL
A0A3P1BT12      STVLVLTIEDAVPAKGEAILNQMIANYSSAATDDKNRVVASTLSFIQTRLKLVSGELAGL
A0A3P1CI15      SSVLVLTIEDAVPAKGEAILNQMIVNYNSAATVDKNRVVASTLSFIQARLKLVSGELAAL
A0A4R8CUK1      STVLLLTFEDAVPAKGEAILNQIIANYHSAAIGDKSRMIANSLVSIQARLKQLSGEQKAL
A0A3D0MYJ7      LNIIDISVKSTSFPEASLISIIYANSYLSYSLELSKSELTLKRKFLENEKEKKFNELSIA
A0A662AH13      LDIVTISYESHSPFEARLIANTYADAYEGLSLRYTRQQLTTVVEFLKNQRQVQYNALLDV
A0A5C7QA01      TGVLGLNYQGADKIHITQVLNAILKAYSVQNIERRTAESAQTLKFLDEQLPELKKQLDNA
A0A3D3LS70      LDIISIDVDSPSRTEARLIANVYAAAYLNYNLEFSRKGVKNVGDYLFEIKNKKLNDLNNS
A0A1G1TM36      APAIRLQIKDQVPQRGIDVLNQLIAAYNNASATEKNKLTANALQFIDSRLGSLRGELNQA
A0A1G7ZF38      ASLVNLSIQDVLPRKGEAILNQLIERYQKASIQEKNKVADNTIAFINSNLTHISSELTQV
C6VS52          ASMVNLSIQDVLARKGEAILKQLIVRYQKASIDEKNKVADNTIAFINHNLERVSAELASV
A0A7C1LGX3      SDVLAISLSGNYPTKSELILNTLIKKFNQDGINDRQQVSKRTLDFIDERFVYLSTELDSI
A0A2A4G4B1      THGLTLTMEVEQAERGQLILEELVATYNKLEQDDKNLISENTAAFIDSRLKGITKELVMV
A0A0P7X1V8      SNLLRVSYRSPSPYEASRVVDLAIETYTDVSTRINRSQARNAIDFLDSELDKVSMQLNYS
A0A6P1P355      STAVNLNFTDASPQRGEDILNKLIQEYNQVAIDKRNDLAAKTLEYVNNRIQLVGKELKAL
A0A5C8KAD6      STVVDIRLRDEVPERSEDILNYLINSYNDMAVLDRNELAANTLDFVESRIQLVEKELKDL
A0A5N1J695      STVINITLEDPVPQRGEAILNNLIYAYDQAALNERNTLAANTMAFIEDRIKLIEKDLENV
A0A3B0C2S4      SEVLSLSIKGQSPERSETVINELINKFNQDGIIDRQLISKRTLEFIDERFAYLSGELDSI
A0A3N2M1H3      AEIIGLTIRDVSVQRAEDILNTVLLVYNENWIEDKNKMAVATSAFIDERLRLIQQELGDV
A0A4S2G8T2      AEIIGLTIRDVSVQRAEDILNTVLLVYNENWIEDKNKMAVATSAFIDERLRLIQQELGDV
A0A212K7W5      ATIIDISLNDVSAQRAEDILDTLITVYNKNWIQERTQIAVNTSSFIEERLNVIEKELGGV
F5IU11          ATIINISLNDVSAQRAEDVLDTLITVYNKNWIQDRTQIAVNTSSFIEERLNVIEKELGGV
A0A7C1QWC7      STLINVFFQGENRELTVDFLNAYIQTYLDNDLAKKNSIALNTMNFIDAQLSEISDSLYLS
A0A352Z1R7      TNIVRISYSSTDPVQARDLVNTLVQVYLGQNIELKTEEASRTVSFIENQLKGLRGELEGA
A0A3N2N6F7      ASVIDFAIKDDNVQRGDDFLSALIDIYNEKWVEQKAQMAVATSEFINERLNVIEKELGHV
A0A4P7VVU7      STVIDFTIKDVSIQRADDFLNTLIDIYNEKWVDDKAK-AKSTSRFIAERLRVIEQELGNV
A0A2V1ILM4      STVIDFTFKDVSIQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNV
A0A3N2L0E8      STVIDFTIKDVSIQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNV
A0A3N2LFC5      STVIDFTIKDVSIQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNV
A0A0A2F501      ASIIDIAYQDRSIQRAEDFLNMLINVYNESWVKDKNQVAISTSLFINERLSVIEQELGHV
R5B7P0          ADVISLSIKDVSTQRAQDILNTLIAVYNENWVRDKNQIANSTSVFINDRLRVIEGELAGV
R5B0L5          GNTINLSVMDYSPERAVDLLNGVIAVYNEKWLADKNQVSVSTASFINERLAVIENELGHV
A0A6I1TEC0      TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDV
A0A3R5XWG1      TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDV
A0A5P0Y910      TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDV
A0A414YFM3      TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDV
A0A6A7UIA7      TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDV
A0A6A7VPS3      TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDV
A0A374THP7      STVIDLTYKDVLPKRAEDVISTIISVYRKNWLEDKNQMTISTSHFITERLGVIERELGDV
A0A6G1VND1      STVIDLTYKDVLPKRAEDVISTIISVYRKNWLEDKNQMTISTSHFITERLGVIERELGDV
A0A0A2EVS5      TSILELSYTDVSIERAEDFLDTLISVYNENWVKDKNKIAVSTSQFINERLSVIEQELGAV
A0A1T4NAJ7      TSILELSYTDVSIERAEDFLDTLISVYNENWVKDKNKIAVSTSQFINERLSVIEQELGAV
A0A255T941      GTVITLTTEATSPKKAEDILNTLIEVYNENWILDKNQIAISTSQFIGERLGVIEGELGHV
A0A3N2KCL3      SSVINLTVTDQSTQRSQALLNTLIGVYNEYWVRDKNQIAVSTSNFINERLGVIESELGNV
A0A4P7VSV0      SSVINLTVTDQSTQRSQALLNTLIGVYNEYWVRDKNQIAVSTSNFINERLGVIESELGNV
A0A2V1IJY1      SSVINLTVTDQSTQRAQALLSTLIGVYNEYWIRDKNQIAVSTSNFINERLGVIESELGNV
A0A4P7VXK7      SSVINLTVTDQSTQRAQALLSTLIGVYNEYWIRDKNQIAVSTSNFINERLGVIESELGNV
A0A1Y4CHN5      ATIINLSITDVCIQRAEDVLNTLIAVYNENWLKDKNQIAVSTSMFINDRLKVIENELGTV
A0A1M6I2S6      ATIINLSIDDVSIPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNV
A0A1Y3V692      ATIINLSIDDVSIPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNV
F3PXM2          ATIINLSIDDSSVWKAEDILNTLIEVYNEYWIRDKNQIAVSTSQFIGDRLGVIENELGHV
A0A174AHH7      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A174JCE8      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A3E4JMC4      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A412SND6      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A414IEQ9      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A6I0U0V8      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A6L5S9H7      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A0M1W8D8      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A3R6GKX5      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A7V4S1          ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
B0NU19          ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
D4V601          ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A4Q0U3M9      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A4R4H1Q2      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A6I0GII7      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A6I0KYU7      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A397WLT5      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A6A2J529      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A6L6P8N9      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A6N8DDD8      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A015XH67      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A078RZN2      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A4R4I3T9      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A6L0K5          ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A7ACT5          ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A6KY94          ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A173UQR8      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A3R6HK75      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A412B7D1      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A412VNY9      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A414LTU9      ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
I9Q4U4          ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHV
A0A373ISF0      ATIINLSINDTSIARAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGHV
U6RF62          ATIINLSINDTSIARAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGHV
A0A662ZZD5      ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNV
A0A3A5TI83      ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNV
A0A415NEB6      ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNV
A0A6I0I238      ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNV
A7AJ60          ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNV
A0A6A2JF01      ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNV
A0A6I0Y2Y2      ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNV
A0A6I2Q447      ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNV
A0A395YYT3      ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNV
A0A015UXN7      ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNV
A0A5M5W148      ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNV
A0A6I2NTL0      ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNV
A0A016E4F9      ATIINLSIDDASIPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNV
A0A4Q5CFJ7      ATIINLSIDDASIQKAEDILNTLIEIYNEKWIQDKNQIAVSTSQFIGDRLSIIESELGNV
A0A6N3HG44      ATIINLSIDDASIQKAEDILNTLIEIYNEKWIQDKNQIAVSTSQFIGDRLSIIESELGNV
A0A6H9P0U9      ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHV
A0A108TH71      ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHV
I8VXH0          ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHV
A0A412S0N6      ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHV
A0A412IIJ0      ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHV
A0A0P0FM97      ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHV
R6KTP3          ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHV
A0A139LU87      ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHV
A0A1C6B3Y5      ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHV
A0A6L3KCD1      ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHV
E2NMQ4          ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHV
A0A412YDB9      ATIINLSISDASIRKAEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHV
R7DY01          ATIINLSISDASIRKAEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHV
A0A414LGK8      ATIINLSISDASIRKAEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHV
A0A415IPQ4      ATIINLSINDASIQKAEDILNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIESELGHV
A0A3E5BRW7      ATIINLSISDASIRKAEDLLNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIENELGHV
K9DXS6          ATIINLSISDASIRKAEDLLNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIENELGHV
A0A1M6KFV3      ATIINLSINDASTRKAEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLDVIENELGHV
A0A1Q6G7L3      ATIINLSINDASTRKAEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLGVIENELGHV
A0A413H235      ATIINLSINDASTRKAEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLGVIENELGHV
A0A1M5B2J8      SNIISLSFQDVSIQRAEEVLNTLISVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNV
A0A255RCT5      SNIISLSFQDVSIQRAEEVLNTLISVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNV
A0A1Y4GLF5      ASVIDLSFKDLSTQRAEDVLNTLISVYNENWVKDKNQVAVSTSMFINERLGVIEQELGNV
A0A1H3XSC0      TSIVNLTFRDHSIQRAEDILNTLISVYNENWVKDKNQIAVSTSMFINERLRVIERELGNV
A6LE40          ASVIDLSLKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A4Y1VPX5      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6N2XMM4      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
B3JI46          ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A358R8U0      ASAIDLTFRDVSTQRAEDVLNTMISVYNENWVRDKNQIAVSTSMFINERLGVIERELGNV
R6WSB6          ASAIDLTFRDVSTQRAEDVLNTMISVYNENWVRDKNQIAVSTSMFINERLGVIERELGNV
A0A401LPX7      SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
A0A6G0GNY9      SNIITLSFQDVSTQRAEDVLNTLIAVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
A0A6I1BFM0      SNIITLSFQDVSTQRAEDVLNTLIAVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
A0A3A5Z900      SNIITLSFQDVCTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
A0A285TGL6      SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
A0A3A5RFX4      SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
A0A1Q6IUW9      SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
A0A413XDP6      SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
A0A6N8CVT6      SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
K6AP24          SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
A0A6I2NHV3      SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
A0A662ZYI7      SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
A0A078RYI7      SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
C7XEQ8          SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
D7INX6          SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
K5ZG55          SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNV
A0A3N2N9B8      SSLIRLTLSDRSIERADDVLSTLIDVYKDAWIRDKNEIAVSTSQFINDRLGVIESELGNV
A0A3N2NMI0      SSVIRLTLSDRSIQRADDVLATLIDVYKDSWIRDRNEIAVSTSQFINERLNVIEGELGNV
A0A359I8H7      ADVIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNV
A0A3N2KA63      ADVIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNV
A0A4Q0IMT7      ADVIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNV
A0A3B9FAU3      STLVRISYKDKEPYRADDIINTLITVYKESWVREKNMLTIATTKFINERLAIIERELSGI
A0A3C1E5L7      STLVRISYKDKEPYRADDIINTLITVYKESWVRDKNMLTIATTKFINERLAIIERELSGI
A0A4Q0UAV1      TSIINLIMTDESPQRAEDVLNTLLDVYNQRYVIERNQAAQAASQFITDRLNVIENELGDV
A0A354SN68      SSVVNITCNGEHIGMLNDILNAVIKAYNKKWVEDRNQVALNTSKFINERLKVIEKDLGLV
A0A6L5XFL0      SSVVDLTLNDENPFRAEDVLNRLYVVYNQKWVEDINQQAISTSQFIDQELRAIEAELSNV
A0A3N2N595      GTVIDLTLNDRSTQRAQDLLNTLIGVYNEYWISDKNQVAVSTSNFINERLGVIEGELGHV
A0A0A2DUD9      STILSLSLLDRSQERADAILNTLVATYNESWLADRNLSAVSASLFIDERLGLIEKDLGEV
A0A3P1ZBJ5      STMVDISINDVSVERAEDVLKTLIDVYNQNWVEDKNQVAVNTSKFINERLRVIESDLGNV
R5FHS9          AAVINLEMQDVNIQRAEDILNTIIAVYKDRWVRDKNQVAVATSAFIDDRLKKIELELGNV
A0A413TW79      ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDV
A0A3E5E9M7      ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDV
A0A3E4SK73      ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDV
A0A415GGC6      ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDV
A0A413DBH9      ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDV
A0A1Y4PQK7      STVLSLSYRDVSPARAEDILNTVISVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNV
A0A1Y4IH41      STVLSLSYRDVSPARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNV
A0A3A6AAP4      STVLSLSYRDVSPARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNV
A0A6I0ZRD2      STVLSLSYRDVSPARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNV
A0A1Y4DYA7      STVINLSIEDVCIQRAEDVLNTLIAVYNENWVKDKNQIAVSTSMFINERLEVIEQELGHV
A0A1Y3X4I9      STVINLSLEDVCIQRAEDVLNTLIAVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A1Y4FNK8      STVVNLTFTDVCTQRAEDVLNTVIAVYNENWIKDKNQIAVSTSAFISDRLGVIEQELGNV
A0A355FD59      VTVIDLSYNDVSTQRAEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDV
A0A359CEZ9      VTVIDLSYNDVSTQRAEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDV
A0A353Q7B4      VTVIDLSYNDVSTQRAEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDV
F8X3A5          ATVIDLSYKDVSTQRAEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDV
A0A1M3KVR9      ATVIDLSYKDVSTQRAEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDV
A0A4Y9IJS3      ATVIDLSYKDVSTQRAEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDV
A0A495WI87      STVVDLSFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSV
A0A354M4S6      STVVDLSFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSV
R7DH52          STVVDLSFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSV
A0A4Q5E7L5      ASVIDLSYKDNSIQRAEDMLNMLISVYNENWVKDKNQVAVSTSMFINERLGVIERELGNV
A0A4P8LP09      ASVVDLSFRDNSIQRAEDVLDMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A4R4GZU7      ASVVDLSFRDNSIQRAEDVLDMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A016CWA4      ASVVDLSFRDNSIQRAEDVLDMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A1C6H117      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A0M1W0V2      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A139KA16      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A174VQ92      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A1Q6HCG0      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A1Y4JYM9      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A3A5QW67      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A3A5RQE6      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A3A6BP07      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A3E5E153      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A3Q9IP20      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A412WV15      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A413ICP6      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A414KYB9      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A5B3FWR2      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A6L4P3V7      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
E5WX00          ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
K0X3P3          ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A415TAH7      ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNV
A0A078T2W6      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6I1AQV4      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A5C6L2P1      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSSSMFINERLGVIERELGNV
A0A412MJT7      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A3E4WKT5      ASVINLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A3A5YY33      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A078TAH2      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A1E9CFZ7      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A373FYU5      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A3A5TZ72      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A3A5XBP2      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A3A6MEG9      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A3E4JP35      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A3E4KP40      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A3E4NX82      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A3E4XFU8      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A412RG70      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A412TD37      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A413GAA4      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A414M7I4      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A496BTA0      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A496D2V6      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A4Q5G1P5      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A5C6KCA6      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A5M5AHM5      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6I0KZV6      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGIIERELGNV
A0A6I0Y5K7      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6I1BFB8      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6I2P5W5      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6N8DC51      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
E5UZA2          ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A069SMG6      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6A2RTB3      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6I0VY00      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A1M4YZ07      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A0P0FQW1      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A5M5C0W6      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6I0H151      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A642LZ22      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6I0HI59      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A642NJ89      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6I0HI52      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6L3JTQ2      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6L4EED9      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6I0YVB5      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6L5RHE2      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6N3AEV2      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6L3KG29      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6G0G4T5      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6I0HFG9      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A4Q5E5M7      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
A0A6L4F5W0      ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNV
C3RFN5          ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A3A5Z014      SSVIDLAFKDNSIQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A6I0ING7      ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A6L5S265      ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A078S3Q8      ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A069SJV7      ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A3E5DXI5      ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A3E5EM98      ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A3E5F453      ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A6N2YYD4      ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
I9T3G6          ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A3E4SYU0      ASVIDLAFKDNSTQRAEDVLSMLISLYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A6LGY1          ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
K5ZSH4          ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNV
A0A1H4ADG3      TSIINLSLNTTIPEQGIDIMNGLIHVYQLSNIEDNNRITDSTIEFLNNRLFTVGAELDSI
A0A5B8VUR8      TGIINLSLNTTIPQQGIDIINGLIHRYQLSNIVDNNRIADSSIEFINNRLVTVGAELDSI
A0A0D3L8Q3      SSALILSLVDPVPEKGKDILNKLIEVYNKEAVEDKNVIAANTIEFINERLQFLTEELTDV
A0A2N3U785      TKVIAIELTEPVPEKGIDLVYHLISLYNKDKANDKKASAVNSLSFLDERIKFLSSELTDV
A0A5B6TJH8      TNVIKLELTDSKPERAKDILNKLVEVYNKESIEDKNVLATNTLAFIDERLKYLTTELTGV
A0A519U664      SNVLTLSLVDPIPEKAKNIINKLMYVYNRESIEDKNLMAVSTLKFLDERLRLITAELSGV
A0A519MA34      SNVLALSLVDPIPEKAKNIINTLMHVYNSEAIEDKNLMAVGTLKFLDERLRLITAELSGV
A0A519UCX0      SNVLNLTLIDPIPEKAKNIINKLMHVYNNEAIEDKNLMAVSTLKFLDERLRLITAELSGV
A0A0E3ZG78      ASVLWVGLTDPIPEKAKDIVNKLIEVYNKEAIEDKNLIASYTIDFIDERLRYLTSELSGV
A0A1I6BRK6      TNVLNISLIDPMPERAKNIVDKLMQVYNDEAIDDKKQLGTSALKFLDERLKFVTTELSTV
A0A243WAB1      ASVLSLSLVDPIPEKAKDILDKLMEVYNDEAVVDKNLMATSTLKFLDERLKYITAELSGV
A0A6G8C8X6      ASVLSLSIVDPIPEKARNIINKLIEVYNKEAIEDKNLMATNTLKFLDDRLKYITAELSGV
A0A416GA42      SSMIQLNITDPVPQRAEDILNTLVDAYKEDIVNDKNTVARNTERFVVDRLAILEKELGNV
A0A1T3IYP5      ASLLQVSMEDQSPERAADVLTALINVYNEVYLQDKNKIAENTANFIKDRLEIIEGELGSV
A0A1T5K9D4      ETVLNLSIQDFSLQRANDILTAIVYRYNEEAVKEKNKVAVNTAEFIDSRIKIIRKELSDV
A0A077ENE7      ASLMQVTMTDDSSERAADILTSLITVYNDVYLQDKSKIAENTADFIKDRLAIIEGELGAV
A0A6I5UW06      ASLMQVTMTDDSSERAADILTSLITVYNDVYLQDKSKIAENTADFIKDRLAIIEGELGAV
T0NN57          ASLLQITMEDQSPERAADIITMLITVYNEVSLEDKNKIAVNTASFIKERLAIIESELGAV
X5K347          ASLLQITMEDQSPERAADIITMLITVYNEVSLEDKNKIAVNTASFIKERLAIIESELGAV
A0A060RD97      SSVVNLSFIDQSPQRATAVLNTLIAEYNTESIMDKNRIARNTDIFIMERLAKLSKDLEGV
A0A3C1ITV0      ATVINFSYTDASEKRAEDVLNTLLDAYNEEWIRYTNKSTDNTAKFIDERLMSIERELGNV
R7HN19          ATVINFSYTDASEKRAEDVLNTLLDAYNEEWIRYTNKSTDNTAKFIDERLMSIERELGNV
A0A350IHV0      STVLVLSLEDTFPRRAEDILNTLIDVYNEQWVANKNRSARNTTAFINDRLVVIENELGGV
R5RVP0          STVIVLTMKDRFPSRADAVLRTLIDVYNEHWVENKNRSARNTTAFINDRLIVIEKELGGV
R6A0L2          TSLIVLNCNDTNIERADQVLATLYDTYKEDVVENKNRVALNTAKFIDDRIQIIGRELSSV
R7LG80          ASLIGLTFQDINPKRAVDVLNTLYNTYKEDVVENKNRVALNTARFIDERLKLIGTELSDV
A0A2L2WX98      SSLIILGCEDINETRAEDIINVVFDAYKRDIVANKNRVANNTAIFIDERIRIIDGERIAS
A0A6N8KXI9      ANLLEISIQDGSPKRADDIITKMIEVYNELTVIDKNQIANNTSNFIKERLQIIESELGSV
G5GD56          TSLVVLSAQDINTARAEDLLNTVYEAYKHDVVDNKNRVASSTANFIDRRVALIGQELTQV
R5KD55          STILDLSYNDVSGKRAEDILSAVIDIYNKVWMKNRNEVSAGATKFLDERLAIIERELDNV
A0A174QNT3      STLVNIVYQDVNIARADAILATILQVYNETIVEDKNRIASNTARFIDDRIVIISHELGEV
A0A4S2FGS1      STLVNIVCQDVNIARADAILTSILQVYNETIVEDKNRIASNTARFIDERIVIISRELGDV
R9I0H0          STLVNIICQDVNIARADAILTSILQVYNETIVEDKNRIASNTARFIDERIVIISRELGDV
K5BUT9          TTLVQITCSDTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDV
A0A174FPA3      TTLVQITCSDTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDV
R6S9Y6          TTLVQITCSDTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDV
A0A642LIH6      TTLVQITCSDTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDV
C9KX15          TTLVQITCSDTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDV
A0A6H0KRK1      TTMVQITCTGDNISRADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDV
R6DAG6          TTMVQITCTGDNVSRADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDV
A0A3L8AAP1      TTMVQITCTGDNVSRADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDV
A0A4S2AYX2      TTMVQITCTGDNVSRADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDV
A0A4Y9H477      TTMVQITCTGDNVSRADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDV
A0A0E2M2Y7      ATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTV
A0A0K2J6Z0      ATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTV
B2RKZ8          ATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTV
A0A212GC82      ATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTV
A0A254MU12      ATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTV
R6CQ93          SSILVLSLKDDSPLRAEDVLNTLVNVYNEEAVNDKNLVAVNTSKFINERLIIIQRELGGV
A0A3D1NQW3      ASIITISMKSSVPKKAEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEV
B0MT10          ASIITISMKSSVPKKAEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEV
R7JGW9          ASIITISMKSSVPKKAEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEV
A0A3D2BF46      ANAISISLDDNIPRRAEDVINTLIARYNDESINDKNRIADYTADFIDKRLRIIGSELDAV
A0A358R538      ASVVTVTMSNTVPRRAEEVIDALVAVYNEDAVEDKRRISVVTSDFIRARLDVIGRELGDV
A0A1Y4AAB8      TSVVGIAMNDAVPKRAEDVINTLITVYNNDAIADKRRISEETADFIHSRLEIIGSELNDV
A0A1Y3WWY9      GSVVTISMSNSVAKRAEDVINTLIDVYEKDAIDDKRRVSVTTAEFIKSRLEVIGRELGDV
A0A1Y4U5L4      GSVVTISMSNSVAKRAEDVINTLIDVYEKDAIDDKRRVSVTTAEFIKSRLEVIGRELGDV
A0A1Y3VCJ1      ASVVTLSMNNAIPKRAEDVLNTLIEVYEQDAINDKRRVSVSTAEFIKSRLEVIGRELGEV
A0A1Y3QTW7      ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVV
R6XWY7          ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVV
A0A4Y1X9Y9      ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVV
A0A4Y1WM66      ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVV
A0A6N4GYT3      ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVV
A0A174AVF1      ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVV
A0A656Q4F4      ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVV
A0A1Q6EIY0      ASIVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDV
A0A5B5VN71      ASIVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDV
E4M8L3          ASIVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDV
I3YQ50          ASIVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDV
R5UEY8          ASIVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDV
A0A1H4D866      ASVVTISMNNSVPRRAEDILNTLISVYNEDAIDDKRRVSVTTAEFIKARLAVIGRELGDV
A0A5B3G4Y7      ASVVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDV
A0A374A9J5      ASVVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDV
A0A5B3GQN5      ASVVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDV
A0A1Q6E9S3      ASVVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDV
D4IJ36          ASVVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDV
A0A414Q925      SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
A0A415PUS9      SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
A0A108TCU0      SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
A0A413BA42      SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
S3Y344          SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
A0A4Q5G8Y8      SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
A0A412TGL3      SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
A0A413VJ33      SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
A0A414L0W6      SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
A0A412DP39      SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
A0A413ZSE8      SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
B0NP84          SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
R6AK43          SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAV
A0A412N2D9      SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATV
A0A1Y4JYS9      SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATV
R6LHA4          SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIETDLATV
A0A3E5HPT8      AALLSMTMNDLSPTRAADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSV
C6IJ48          AALLSMTMNDLSPTRAADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSV
Q8A3U2          AALLSMTMNDLSPTRAADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSV
A0A3R6S1H6      ASIINLAIEDVSKARAEDIINTLIVVYNEDAINDKNQVAINTSNFINERLIIIEQELGGV
A0A3R6SD81      ASIINLAIEDVSKARAEDIINTLIVVYNEDAINDKNQVAINTSNFINERLIIIEQELGGV
A0A354WXN6      STIINLTLQDRSIPRADDVLNTLIAVYKEDVINDKNQVAVNTSNFIAERLLIIEKELGSV
R5IP14          GGALNITMNDTDIKRAEDVINTLIAKYNEDAIADKNRLAVNTARFIDDRLEIISQELGDV
A0A316SZX7      TSSVSITLQDPNPKRAEDVINTLIDVYNLDGTNDKKKVAESTANFIDERLLIIGKELGEV
A0A1Y4AIY1      ATIIKLSLSDVSASRAEDVLNTLIAVYNEDAIEDKNRITVSTSEFIAERLVIIEQELGSV
A0A0J6CIR2      ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSV
A0A3D8HG59      ATIINLTLQDESIQRAEDIVNTLIAIYNEDVINDKNQITVNTSDFINDRLIIIEKELGNV
A0A3R6S408      ATIINLTLQDESIQRAEDIVNTLIAIYNEDVINDKNQITVNTSDFINDRLIIIEKELGNV
F3ZRU7          ATIINLSLRDEVPQRAEDILNTLIDVYNEEAINDKNQMAMNTSEFINERLIIIEKELGGV
A0A1C5Q1F3      SSIIHLSISDVSPRRAEDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGV
R7A239          SSIIHLSISDVSPRRAEDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGV
A0A3R6HIK7      STIINLSLSDVSIARAEDVLNTLIAVYNEDAIEDKNRVTVSTSEFIADRLVIIEQELGSV
K5ZVW7          STIINLSLSDVSIARAEDVLNTLIAVYNEDAIEDKNRVTVSTSEFIADRLVIIEQELGSV
A0A1Y4D5Z0      ATIINLSLSDVSISRAEDVLNTLIAVYNEAAIDDKNKVTISTSDFIADRLVIIEQELGDV
A0A413VXJ7      ATIINLTLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGV
I9RSN9          ATIINLTLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGV
U6RJK5          ATIINLTLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGV
A0A1Q6GA32      ATIINLTLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGV
I9RPU6          ATIINLVLDDVSTARAEDVLNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSV
I8YFS5          ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSV
A0A6L3FCC6      ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSV
I8Y597          ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSV
A0A1Q6GBF5      ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSV
I8YFZ3          ATIINLVLDDVSIARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSV
A0A1Q6GDH2      ATIINLVLDDVSTARAEDILNMLISVYNEDVINDKNQIAVNTSKFINERLIIIERELGSV
U6RSB0          ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSV
I9SIK1          TTIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSV
I9GXM2          TTIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSV
I9TP59          TTIINLVLEDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSV
R5S343          TTIIYLTLQDVSVARAEDVINTLIEAYNEDAVNDKNQIAINTASFINERLKIIDRDLGLV
A0A1M6K7I9      ATIIDLEYKDESIARAEDILNTLISVYNEDAINDKNQIAVNTSNFINERLIIIEKELGTV
A0A5M6A8C8      ATIIDLEYKDESIARAEDILNTLISVYNEDAINDKNQIAVNTSNFINERLIIIEKELGTV
A0A6L3FBE6      ATIINLVLDDVSTARSEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSV
A0A6L3FNG1      ATIINLVLKDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSV
A0A3R5ZMK1      ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A6L6NFJ9      ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGSV
A0A1Y3ZIA4      ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
K5Y1A4          ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A4Q5CIT0      ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A6L6NWL9      STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A3R6K8X4      STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A6N8D6C8      STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A3R6BKI7      STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A6N8CW60      STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A412M2W1      ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
K5ZX55          ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A415BDM7      STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A6L6MX19      STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A1Q6I3T6      STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A414XX40      STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A7AEU7          STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDV
A0A5F0U645      ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNV
K5ZBN2          ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNV
A0A0J6CKW3      ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNV
A0A0F5IQM7      ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNV
A0A496CDT3      ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNV
A0A6G1ZKM3      ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNV
S0GLB0          ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNV
A0A3R6NLC1      ATILNLSLQDASVSRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSV
A0A416WYC9      ATILNLSLQDASVSRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSV
A0A0F5IT40      ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSV
A0A496CX20      ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSV
A0A5F0UBI0      ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSV
A0A6G1ZHG0      ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSV
S0GSI7          ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSV
K5YB65          ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSV
A0A0F5IWP9      ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSDFINDRLIIIEKELGSV
A0A0F5IZT8      AAIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSDFINDRLIIIEKELGSV
A0A417LKQ2      ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEKELGSV
A0A416TME1      ATIINLTLQDVSIPRAEDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSV
A0A416XPE8      ATIINLTLQDVSIPRAEDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSV
L8JI02          SNIVELSMRGSVPHKTARFLDQLLHIYLQNELHKKNQLGVKTIQFIDSQLSGVSDSLKRV
A0A4Q5WS95      SSIVRLKYNDEVPQRGEDILNNLIHDYNAASIDYKNSVARNTISFVDERMRIVQRELNAV
A0A501VZX6      STVVNFTLYDQIPARGEDILNTLIYTYNSIAINERNKLAANTLEFVEDRIKLVEEELKDL
A0A399SH26      STVVNLQLKDAVPERGEAILNLLVHNYNQASVVERNILAENTLAFIEDRMQKVEKELDKL
A0A501W1A9      SSVVNLYIEDQTPERGEDILNSLIKAYQQAALNERNQAVAQTLAFVESRIQLLEKELQGL
A0A0E3ZGV6      SSVVNLYLEDKVPERGEDILNALIHAYQKAAVTEKNSLVSQTLAFVEERIQLIEKELQNL
A0A1I2N4S1      SSVVNLYIEDNVPERGEDILNALIDAYLQAAQVDRNALVSQTLAFVEDRIQLIEKELKVL
A0A2T5YE44      SSVVNLYIEDNVPERGEDILNALIDAYLQAAQVDRNALVSQTLAFVEDRIQLIEKELKVL
A0A1M5BA90      STVIDLAIMDEVPERGENILNTLIQAYYRSAAKEKNVLAANTLSFIEGRISNVAKELDSI
A0A512B879      SSVIHLTIKDEVTQRGKEILNLLISEYNQAAINDKNLLTSNTLSFVETRIKYVVRELDSI
A0A559PPI3      STVINLYLQDAVPNRGEDILNGIIAAYNQNGIEDKNILAANTMKFIEARIRNIGNELDTL
A0A1T5CS78      SSVVNLSIKDEVPERAENILNRLIYQYNQKIIKDQNELALSTMTFIDERIENVEEELDEL
A0A0Q9Z8F1      SSVVNLTIRDAVPERAENILNRLILEYNRKIIKDQNELAASTMTFIDERIENVEAELDEL
A0A2N0U0M7      SSVVNLTIRDAVPERAENILNRLILEYNRKIIKDQNELAASTMTFIDERIENVEADLDEL
A0A1V9FHD0      SSTMDLTYSDAVPQRGEDIMNHLLLAYNQLSIDEQRGTAANTLAFIETRLKSVRHELDSI
A0A4V4H170      STTINLTFRDEVPERGEDILNKLLVAYNRLSIEEKKGTAANTLEFIETRLGRVEKELDSI
A0A1V9F098      SSTINLTFRDEVRDRGEDVVNKLLVAYNRLSIEEKKGTAANTLEFIETRLAKVEKELDSI
A0A4R2VU64      SSTINLTFRDEVPQRGEDILNKLLVVYNRLSIEEKKGTATNTLEFIENRLFKVERELDSI
A0A4S8HY23      STTINLTLRDEVPERGEDILNKLLIAYNLLSIEEKEGAAANTLTFIETRLSKVEKELDSI
A0A1V9F383      STTIDLTLRDPIPRRAEDILNKLLIAYHLQSIEEKKGMAANTLEFIEARLLKVERELDSI
G8TRZ6          SSTIDLTLRDEIPKRGEDILNRLLTDYTQQSIDEKQDQATNTLNFIEVRLGKVERELDSI
A0A4R5DL69      VSIISLRLTDILPRKGEALLKKLTENYLSTSITDKNRIADSTIAFIDQNLHLVSLELKDI
A0A1M4YED3      STVLTLYFQDESAYRAKDVLNELMNVYTINGLSEKDALAANTLATIEKRLTFVAKDLDSI
A0A2H3NSN0      QGLIRIVARSQYPEEAAAVANTYADAYRAYSRESARAGVAAAREFLETQLDRREEDIEEV
A0A2P6C324      QGLINIRVESQDPAEAALIANSFAQQYRLFSREMARAGVVAAREFLETQLEKRKDDIRAI
A0A7C2DZI7      QDMIVITAESTTPEEAAVIANRYAEEYEKYSRERSRESLAAARAFVENQVEQRRQELEGL
A0A1M6XHU0      QDMIVITAESTTPEEAAVIANRYAEEYEKYSRERSRESLAAAREFVEKQVEQRRQELEAL
G2SF81          QDMIVITAESTTPEEAAVIANRYAEEYERYSRERSRESLAAAREFVEKQVEQRRQELEEL
A0A5S9EYW1      QDMIVITAESTTPEEAAVIANRYAEEYERFSRERSRESLAAAREFVEKQVEQRRQELEEL
D0MHQ9          QDMIVITAESTTPEEAAVIANRYAEEYERFSRERSRESLAAAREFVEKQVEQRRQELEEL
A0A126PFG0      SPAISLQIKDEVPQRGMDVLNQLMAVYNGAATAAKNKLTANTLHFIDSRLASLRGELSQA
A0A3M1N7Z3      TTILQVSVTDISPVRATRFLNALIEQAREHERSIRQLQYTKALGYIDTLVNFFQNQLLVA
                     .                                                      

A0A1T5MMH4      EDYFERFTL-KNKTNDLQ-----EDLRKTIESINKIDS---QRYELSRRL----DEINKL
A0A2W4R1L8      ENYFEDFIL-ANKTSNLD-----EELANTIRLIHEIDS---QRYQLTTRI----TGINEL
A0A2E5CV79      EDSLKQFKI-ENSFFSSD-----GEASSVARQISALEN---DIYNTRSEL----NMRRER
A0A2D4ZVH1      EDSLQNFMN-RTLLIAVD-----PQTEEIISTIANLEV---EKQKLEVGL----VAVMSG
A0A0K8QSK7      ETEMLQFQS-DNRVIDLS-----AQSQQLLQQMSELDN---QRVVLESQL----KYYRYL
A0A1V6CN82      EGELLSFQS-RNRIFDIG-----SQSGQLLSEMSELDS---KKQELETQN----KYYNYL
A0A1M4XZ45      ENRMETFQS-ENQVLDIS-----MQSQQLLEQMRDLDQ---QRVALETQN----KYYHYL
A0A399D319      ESRMETFQS-EHQVLDIS-----MQSQQLLEQMRELDE---ELVTLETQN----KYYHYL
A0A1V5IPN7      EDDLRAFKN-ENKLIEIS-----ETTRKWIEQTTQVES---QYEAALTEQ----AVKAKT
A0A1M6GR99      ENNLQKFMS-QNKLMNID-----EQSTRLAQQRLDLQN---QLAELMTQK----RYYDYI
A6EBM4          EKSLETYKQ-QSKVMDIS-----VTSEHTLDKVSDLES---QQSILRIQL----IAIDQL
A0A7C5M4P4      EKYFEDVTI-TNKTVSLD-----EDIRRTVTQINRLDS---QRFKLQERL----DDLNDL
A0A1M6TTV4      EDYFEKFTI-QNRTTDLS-----RDLNNTIQLLNQLDS---QRFKIRNQI----TAIELA
A0A4Q8RX32      EKSLQEFRT-QKQVIDVG-----MKASQIYDNLNALMA---EKEEKESHL----QYLEFL
K0X1U5          ERIVERYKR-ENDLSDID-----AEAKIILEANSQYRK---LLLEAETQY----SIISMV
R5EXK3          ERIVERYKR-ENDLSDID-----AEAKIILEANSQYRK---LLLEAETQY----SIISMV
A0A401UAP7      EDYFKDFTL-KNKTQDLT-----ADMSRTVEQINALDT---SSFTINSRL----RLIRKL
A0A1W2GF52      EDYFEKFTI-KNRTTDLS-----SDLTKTIALLNELDS---QRYNLREHL----AEVDLV
A0A2G5L7B8      EDYFEKFTI-KNRTTDLS-----QDLNYTIRLLNQLDS---QRFNIRTQI----AAVELA
A0A523GAC0      ESYFESFTI-RNKTTDIQ-----TDLSNTIKAITVLDS---QNVILEKKL----TGIHQL
L8JW09          EHYFENFTI-KNRTSDLN-----EDLKRTIETINALDS---QRFQLTKRI----QAFDQL
A0A364XUP5      ENYFKHFTL-QNKTNNLD-----EDLKRTVTAISRLDS---QRYEFASRM----QELNQL
A0A1M5RLA9      ENYFENFTL-QNKTNNLD-----EDLKKTVSAINRLDS---QRYELTNRI----VEVNTL
A0A385SFR9      ENYFENFTL-QNKTNNLD-----EDLKKTVSAINRLDS---QRYELTNKI----VEVNTL
A0A5M4A9J4      ERHREQFQS-RNNLLDLS-----YQSQQLLDQMVSLQE---QKEQLSTQK----SYYTYL
A0A5M4B1C7      EQRRESFQS-KNKLLDIS-----YQSQQLLDQMVTLEE---QKEQLTTQQ----AYYRYL
A0A0D3LFR6      ETYFEDFTI-SQRTTNLN-----KDISNTILLLESVDS---QRVATRRQL----NNLTNL
M7N6D4          ESYFENFTI-DYKTTNLA-----GDINRTIIMMEAIDS---QRVQLRKQL----SSITSL
A0A4D7K1D4      ENYFESFTI-ENQTVDLQ-----KDMAETIQFLNQLDS---QKRALKIYQ----IKIDKV
A0A5C7MX19      EDSISALRV-QFGYMDK------NELQTMSSEVSSTNI---IIRMLTQDI----LSIKSF
A0A1Q3ZMZ7      RDSIVFFQQ-KNKLNNPD-----NVADQLIQKIDEANE---ESYLANNNL----STLKDL
A0A2D8JJW3      KDEIQKFQQ-AEDILSSD-----GNANEHVEQFLKLKS---ERVAQQLKL----DDLINA
A0A2W2AFF7      EKKIEAFKK-ENELTDIG-----EESKILLGSTSDYMK---QLTQSEVQL----SIVESL
R7PCR1          EGSLARFKE-KYNIVDFQ-----KSAEAFLQQQGTARN---LALDYETQL----SVARYL
A0A1G9E2A9      EESIEDFVR-ENRTLSIS-----STIGQTLEQIKNLRF---ERITYEQQL----PALDEL
A0A098LL25      EKDLETFVR-NNRTVDVK-----QDFGKSGIKIEELEK---EKQVLKSRI----SMLGEL
A0A6J4H627      ESQLEHFVV-QNKSSDVG-----AEVGKYALKIDDLLK---SRSDLAIQL----SLLNRL
A0A6C0GJI1      ELEQEDFIV-KNRTTDVK-----SDVSKFVTNIEELNK---QRTELNSQL----SLLRNL
A0A2T2YJE8      EIQMENFVK-ENKTYDVR-----ADVSKSITKLEELNK---ERINLHLQI----SLLNEV
A0A127B287      EIDMEYFVK-QNKSYDVK-----AGLEGAMTQIQELEK---EKYDLRFRN----SLLSD-
A0A6P1P2P6      EIDMEYFVK-QNKSYDVK-----AGLEGAMSQIQELEK---EKYALRFRN----SLLGD-
A0A3M9N829      EDEIESFVR-QNKSYDIR-----SSFQEAITEYRELEQ---KKLEQRFLL----TLYNT-
A0A0P0CSF9      ENDIERFVR-QNMSYDLK-----ANFQEALAQVQELEK---EKLELRFQL----SLLNT-
A0A5M8QQB8      ENDIEQFVR-QNKSYDIK-----ANLQEALSMVQELEK---EKLELRFQL----SLLNT-
A0A3M9MNC3      ENDIERFVR-QNKSYDIK-----SNLQEALAQVQELEK---EKLELRFQL----SLLNT-
A0A5B6TAX2      ENDIERFVR-QTKSYDIK-----SNLQEALGQVQELEK---EKLELRFQL----SLLNT-
A0A5N1IQ33      EVALQDFVR-RNKTFDVK-----NDMGTIVEQTAEMQK---EREELRLKI----NALADL
A0A512AYT3      EENMESFVR-QNRTYDIK-----AEVGTQLAKLETLNN---ERRELDIQI----GLLKDV
A0A5M6CYN7      EGKMENFVR-ENRTYDVK-----ADVSTQISKLEELGK---ARLDLSMRI----SLLRDV
A0A369QP10      EIQMENFVK-QNKTYDVR-----ADVNKQMTKLEDLNK---QRVDLRMEL----SLLNEI
A0A126PDF2      ENRYQGFVE-KTKTYDVK-----SEVAALASRGEDLEE---QRLKLNQNL----VLLSEI
A0A2Z3GKA1      ENRYQGFVE-KTKTYDVR-----SEVAALAAKGESLEE---QRLKLNQNL----VLLSEI
A0A502GZP7      ENRYQGFVE-KTKTYDVK-----SEVADLAAKSEDLEE---QRLKLNQNM----VLLNDI
A0A519SBU8      EDTQQEFVR-QNKTYDIK-----SEVSAIKGQMESLLK---ERLELEQKQ----RLLAEV
A0A4Q3JNZ3      EEAQKEFVR-RNKTYDVK-----GDMATIRGNLEKQQD---ERLKLQDKL----RLLAEV
A0A519Q9V3      EEAQKEFVR-RNKTYDVK-----GDMATIKGNLEKQQD---ARQKLQDKL----RLLSDI
A0A0M3RW20      ELALQRFVK-ANKTYDVK-----ADVGTLTEKLAEQEK---ERIELQKRL----DLLNGV
A0A495VFX4      ELALQRFVK-ANKTYDVK-----ADVGTLTEKLAEQEK---EKIELQKRL----DLLIGV
A0A1S9B3W0      EEALQNFVK-QNKTYDAK-----SDLGAITQELSELQK---EREKLLRKA----TVLTEI
A0A1W1VRL3      EDNLQSFAR-ENRTYDVR-----ADAATVNGKILAQEE---KRQNLLQKQ----GLLADL
A0A1M6R305      EENLQSFAR-QNKTYDVK-----ATIGDLTGRLEKQEE---ERLRLVEKI----RLLNEV
A0A4Z0PHK3      EENLQAFVR-ENKTYDVK-----SELALITGKLAKQEE---ERLKMVEKA----RLLGEI
A0A2M9B9H9      EENLQAFVR-QNKTYDVK-----TEVAGITEKLAEQEE---VRLKLVEKA----RLLGEI
A0A4Z0QCY9      EANLQAFVQ-QNKTYDVK-----GEVSAITEKLAKQEE---ERLKIVEKA----RLLGEI
A0A418R9X5      EAKMQDFVR-KNKVFDVK-----SEAGLVTNQLNMLES---QQEELQEQA----DMLAEL
A0A428JSJ3      ESNMQDFVK-RNRVFDVK-----SEASLINNQLTTQEA---EQEKLQEEA----DMLADL
A0A428KI59      ESNMQDFVK-RSRVFDVK-----SEANLVTNQLTAQEL---EQEQLQEQA----DMLAEL
W8F1I6          ESNMQDFVR-RSRVFDVK-----SEASLVTNQLTAQEL---EQEQLQEQA----DMLAEL
A0A246FQC0      EEAMQSFVK-RTGSYDVK-----GDVGQITGLLMELEE---ERTKLQQQA----DMMNDV
A0A372E5P8      EENMEAFVK-RTGSYDVK-----GEVSQLTGLLQTLEE---ERAKLQEQS----EMMSDV
A0A1H3EMW1      EENMQSFVK-RTGSYDVK-----GEVGTITGLLQELEV---ERAKLQEQG----EMMGDV
A0A1H9ZSN3      EEAMEAFVK-RTGSYDVK-----GEVGQITGLMQELEE---ERAKLQEQG----EMMNDV
A0A5N1J2M4      EANLEAFAK-KNKSYDIK-----SDVSASRLKIEELMK---ERQALRLKI----ALLDDV
A0A519S476      QELQQQFVL-RNKTYDIT-----TEVEGLKTRLEKQQD---TRFELEGKL----RLLAEV
A0A4Q3JRW8      EEAQKEFVR-RNKTYDVK-----GDMASIKGNLEKQQE---ARQKLQDKL----RSLSDI
A0A519M923      EEAQKEFVR-RNKTYDVK-----GDMTAIKADLEKQQE---DRQKLQDKL----RLLADV
A0A4Z0ENW1      EDNLKEFVQ-QNRTYDAK-----GELGIITDKLEKIEE---DRLKLEQKL----TLLSEV
A0A519UDB4      EDNLKTFVE-QNGTYDAK-----GQLGDISEKLLEIQK---GRSELEQRL----GLLTEV
A0A3S0QKV1      EKALEEFVR-QSKTYDAK-----ADVGTLTTQLSDLRK---ERETLQRKA----SLLTQV
A0A328BL48      ENALQAAVK-RNRTYDAK-----GDLATITTQMQELAK---QREQILRRQ----GVLQEL
A0A5R8WLY4      ENAFQAAVK-RNRTYDAK-----GDLTAITTQLQELAK---QREEIQRRQ----GVLQEL
A0A1I5WSL8      EDRLQSFVQ-KTGTYDTR-----AELEAISGKMEKLEA---ERLKLTDKM----ILLTEI
A0A0U3JVM7      EDRLQNFVQ-QTGTYDSK-----GEFSAITEKLEKLEA---DRLKLTDKI----NMLGEI
A0A1G1SSV2      EDRLQKFVQ-KTGTYDSK-----GEFEAISGKLEKFET---ERLKLTDNI----AMLAEI
A0A1G1SXV7      EDRLQNFVQ-KTGTYDSK-----GEFEAISAKLEKFET---ERLKLTDNI----ALLAAI
A0A6G8CBJ6      EDNLQSFAR-ENKTYDVR-----RDAATVIDKIAIQEE---KRQELLQRQ----SLLADL
A0A0W8EDI5      EEALQEFVK-RNKTYDVK-----SDLATITEKMEALEE---EKEQLLRKA----GAIGEI
A0A3B7RBP8      EVALQEFVR-RNKTYDVK-----SDVANIAEKMAALQE---ERVELQRKA----GALAEV
A0A3R9P8H7      EENMQAFVK-RNGTYDVK-----GDVGQIMTALKEQET---EREKLQEQV----DMLNDV
A0A238WIA7      EEQLQDFMK-RNNLFDAE-----SELGTVTSAITTQQE---ERQELQEQI----NLLRNL
A0A212UCJ7      EEQLQEFMK-QNRLFDAE-----TELGSLTTILTTQQE---ERQKLQEQL----TLLRSL
A0A4Z0MQE1      EEQLQDYMK-QNKLFDAE-----SELGSLTTLLNSQEE---ERQKLQEQL----SLLRSL
A0A4Z0PCF4      EEQLQNYMK-QNKLFDAE-----SELGSLTGTLKEQEK---ERQELQEQL----TLLRNL
A0A6M6BED0      EEQLQDYMK-QNKLFDAE-----SELGSLTTLLSTQEE---ERQKLQEQL----SLLRNL
A0A5D6VDG1      EIALQSFAK-RAKMYDVR-----SGVQTITDQLDEQEK---EQQALQRRL----ELLTSV
A0A6H1CVS0      EIALQSFAK-RAKMYDVR-----SGVQTITDQLDEQEK---ERQALQRRL----ELLTSV
A0A243WHR7      EKNLEKFTD-RTKTYDVR-----GDLASISDKLLEQEK---ERLQLQQQI----DLLDEI
A0A5B8A0P6      ENNLQGFVR-RNKTYDVR-----SDVSTVIAKLAQLEE---DRRKLDEKS----RLLEEV
A0A076HRT9      EENLQDFAR-QNKTYDVR-----ASIGEITARLEKQEE---ERLKLSEKI----RLLNEV
A0A4Z0PVM7      EANLQAFVQ-QNKTYDVK-----GEVSVITDKLAKQEE---ERLELEEKA----RLLGEI
A0A1M6DHW8      EENLQSFVR-DNKTYDVK-----ADVAAITEKLAAQAE---EQQKLAEKA----RLLSNV
A0A4Q5LC61      EENLQSFVR-NNKTYDVK-----ADVAAISEKLAEQEE---ERLKLTEKA----RLLGEV
A0A2N5YXE2      EQNLHDFKQ-QNNIRSNTETLLFNKTNLYTTKMSELES---KLLNVDFEI----MTLEKV
K0XJ09          ENELTDFKQ-KNRIVSID-----AAATQFMSESSKMRD---ELVQLETEY----AIARAV
R5EUZ0          ENELTDFKQ-KNRIVSID-----AAATQFMSESSKMRD---ELVQLETEY----AIARAV
W0EQS0          ENELTDFKQ-KNRIVSID-----AAASQFMSENSQMRS---ELVQLEMEY----AIAQAV
A0A1Y3WE15      ENELTNFKQ-QNRIVSID-----AAASQFMSENSKMRD---ELVQLETEY----AIAQAV
A0A1Y4GUK3      ENELTDFKQ-KNRIVSID-----ASANQFMSENSQMRT---ELVQLETEY----AIAQAV
A0A2U1FKU2      DTEIETFKK-QNNITDIT-----TDVGTYLKNSSDLQK---DQLIVERNL----SLAKYI
A0A0A2F954      DTEIETFKK-RNNITDIS-----TDVGAYLKSSADLQK---DQLIVERNL----SLAKYI
A0A0A2FW91      DTEIETFKK-SNNITDIS-----TDVGAFLKSNADLQK---DQLVVERNL----SLAKYI
A0A2D2N2N1      DTEIETFKK-RNNITDIS-----TDVGTYLKSSADLQK---DQLIVERNL----SLAKYI
Q7MWZ2          DTEIETFKK-RNNITDIS-----TDVGTYLKSSADLQK---DQLIVERNL----SLAKYI
T2NDT6          DTEIETFKK-RNNITDIS-----TDVGTYLKSSADLQK---DQLIVERNL----SLAKYI
W1R7P9          DTEIETFKK-RNNITDIS-----TDVGTYLKSSADLQK---DQLIVERNL----SLAKYI
A0A1R4AFZ0      DTEIETFKK-RNNITDIS-----TDVGTYLKSSADLQK---DQLIVERNL----SLAKYI
A0A1R4DVZ7      DTEIETFKK-RNNITDIS-----TDVGTYLKSSADLQK---DQLIVERNL----SLAKYI
A0A7C0WKI7      EEALRQFQQ-NTGIVALP-----EETQRMVDQVVEFQT---AYNTADIEL----KTYQTR
A0A2A8CVM9      EQQWETFAQ-NNQVVTQGIGGE-RLVAEYTELTARRDA---LRFELEQEE----EALRLL
A0A5M4B212      QKVRERFQS-HNNLLDVS-----YQSQQLLDQLVKLED---QKSLLETQH----QYYQYL
A0A3D1KEX9      ENKLAKFKQ-NNKIVDFT-----ENARTYLQQSALSQQ---ELNKTQAEL----SVAKYL
A0A358Y7S2      KEDLANFQK-RERLPNIE-----KIGDNLSENLTNYSK---VILELEEEL----STLYLV
A0A1X7J248      ETYIEDFTI-ENKTINPS-----DDVSRLIAEMVKMDS---ILYGINYQL----GEIENI
E4TQD2          ETYIEEFTI-KNKTVNPS-----QDVSRLISEMVSMDS---ILYGINYQL----AEINNI
A0A2J6HHN3      EDSLYKVSV-ASPDSL-------EDKTGLKSRMRELDR---LISKTKYEK----EVLSAF
A0A1Y3WMT8      ERVIEQYKR-ENDLSDID-----TEAKIILEANSEYRK---LLLEAETQY----SIISMV
A0A1Y4GQU1      ERVIEQYKR-ENDLSDIN-----SEAKIILEANSQYRK---LLLEAETQY----SIISMV
A0A6A0R272      EDQITQFKQ-DKRIIDFE-----SVERIESERLIDLES---SKRIAELRI----LNFNIV
A0A1V5W8T5      EKQLDQFKK-SNNITGSIF----DDKAAIQNALMDNSQ---QIKQYDTQL----QSLQKV
A0A2T8HKA9      ETDLERIKM-DNKGMDVN-----EAAGMYITESREYLN---ASRELETQL----SLAEMM
A0A2I0QZ80      KDSVMRFQR-NENITNPE-----HLSGSISSKIEFLRT---EERNIIEEI----RVLKVV
A0A3E1F1A3      KDSIMYYQR-RENITNPE-----YLTSSVASKMEKLKA---EENNALEEM----RVLETV
A0A2U2XBJ3      KDSIMVYQR-MENITNPE-----QIAANTSQKIEKLRT---EIRQGMEEL----RVLNSV
A0A4Q4KU94      KDSIMAYQR-QENITNPE-----FIASTTSQKIEILKL---EERNGLEEL----RILNSV
A0A3B8INU3      DKYFENFTI-SNQTTDLS-----SDLQKTIQQIWTLDT---LLGTARSKQ----KSVNRM
A0A2W1NDY9      ENSIQSFTN-ISKNNNPA-----LYKENLLDQIDQLRT---EVLQADLEY----DLILGL
A0A5C8AQR5      KDSLTDYQR-SSNLPDPE-----GITSELNGNISKLKD---QLYTIEDEL----STLRMV
A0A1G0CI31      KDSLTLFQR-SAQLNDPE-----TDGLSLTQNMDQFQD---QLFMLEEER----SALKLV
A0A556N0M0      KDSLTDFQR-KTRLTDPE-----NTNGSLTENMDKFQD---MLFELENEL----ATLKTV
F2IKD6          KDSLTDFQR-KSHLTDPE-----GTGGSLSENMDKFQD---ILFDLENEL----TTLKVV
A0A1I7BM74      RNALTEFQR-RENLSDLE-----NIESNLSAKVNTLEN---ELEKLKIEH----QDLKRI
A0A2G2FJ17      KDSIMYFQR-KENLPDPE-----NLGESIATKLEKYRF---DKFELQDEL----NTLEMI
A0A2E3R1D0      DAAVEQYML-REGAVALQ-----EETSRLVDQIATLDA---RRDQAQVNL----VTKRAE
A0A2T2USC0      EQRLEKFMR-EENAVALD-----QETQQIVQQISEMQA---RRDELQIEL----DMESSA
A0A2T2V0F3      EQELESFMQ-EEKAVALD-----QETSRIVDQIANLQT---RQDELRIEL----DMKQSA
A0A2T2S682      DRALAKYMQ-KEEAVSLD-----QEASRLVQQLSELEA---RRDELRIEL----DMAESA
D5H561          EQRIQRFQR-SEDAVSLD-----QRQGSLTSRIAETES---SLEQARIEL----RMEQSS
A0A2H3NWA9      EQNLVDFMQ-REEAVALD-----EETSSTVSRITSLES---ERAQLRIEL----EMTRAR
A0A2A8CVB6      EGEIENYMQ-REGAIALD-----QESGRIVSDIAQMEA---EQRQLQIEL----QLARTS
A0A2P6C1S6      EQKIEEYMQ-RENAVSLD-----QETGRVVQQISELEA---QRAELRIEL----DMQQAA
A0A2T2UTM4      EQKIENYMQ-EEKAISLD-----QETGRVVQQISELES---KRARLRIEL----DMKQAT
A0A414ZBF2      DTEIEDYKR-ENKLTDVT-----SESALLLQNSSRLGG---ESLSIENEV----VMAEYI
A0A1Q3Q573      QDSVAQFKI-NNEIFSDD-----NSSQGILTSANALQQ---ALIASENQL----YLLQNF
A0A662BAY3      ENAMQAFQS-KHKLLNIS-----IQSEQLLDQVNELEK---EKVVLETKN----KYYKYL
A0A4U3L369      EKQIALYKG-NNKIISPD-----VQAQLMASTYDENFK---LGNQLELQL----AIIKNL
A0A357YNR3      ENQVQIYKQ-SQGITDIA-----AQANLYNNQMANVGQ---RRMDIESQL----SIVSNL
A0A5E8AX52      EDYFENFTI-ENRTTNIQ-----TDLGRTIVLLQSLDS---QRYDLQNKL----TNIQMA
F4KK08          DAEIEDFKQ-SQQIADIQ-----AEAQEYIKGSSEVKT---RLVELNNSI----SIAQFV
A0A6B5PK86      KDSLMDYQR-EVNLSDPE-----KEGDLMQTDANKFQE---ELFNLEDEL----STLQFI
A0A2G2F510      KDSLMIFQR-KSNLPNPE-----EAASNITDNISKLQD---QLFLIEDEL----NSLITV
A0A316JZ08      QDSLADFHS-KSSVVDPE-----LSGGELNEKLNDLEL---QLSDIDKEV----ASLIAI
A0A496LCF9      ESNLNSFKI-ANNMYGE------NNTTILTSKMDELQQ---VGKQIRLRD----EYFKYL
A0A5P2G2A9      ESGLADYKK-KNNIADLE-----AQAQAVISSSSEYEK---QLNQAQVQL----AIVNTM
A0A3C0ZQC7      EGTLQKYME-QKGIVSLD-----DEAKKVIDQLATLEA---QRDAADIEL----QALSKT
A0A419VXB7      SNEFTKYRS-SNKVFDLS-----QEATLVTGKLSNLDT---KRSMAEMQL----EYYKNL
A0A0B0BTJ4      DTAIEKFKS-DNSAVDII-----SETKLSLETSRQYED---DLLKTEIQL----EMLSAI
A0A3B9CNN6      DTAIEKFKS-DNSAVDII-----SETKLSLETSRQYED---DLLKTEIQL----EMLSAI
R5X290          DTAIEKFKS-DNSAVDII-----SETKLSLETSRQYED---DLLKTEIQL----EMLSAI
A0A1Q6E6I7      DTAIEKFKS-DNSAVDII-----SETKLSLETSRQYED---DLLKTEIQL----EMLSAI
C3J7R8          DTEIEQFKQ-NNRIADIQ-----QEARSYITGTAEFAR---QMTEVNNKL----AVANYL
A0A1G8BVM8      DSDIEQYKK-EKNLTDIP-----SVSSMYLDASSRINA---EALGLENQL----SIANYM
A0A1I1FXP9      EKEVERFIQ-VNRVIDVR-----DQVAEMITHVEKLKK---DKIELEIQN----SLLMDL
A0A3N4H5N3      ERDAEQYKQ-RNRITDIG-----LDSRIFLESTQEMRK---EISDISSKI----EILESL
A0A2P8EAX2      EMYVERFKQ-RNRVTDIG-----LDSRIYLESTASTSK---EISELSNKI----EILESI
A0A4V2F6N9      EMYVERFKQ-RNRVTDIG-----LDSRIFLESTASTSK---EISELSNKI----EILESL
A0A3B9FXJ0      ENILKDFKK-DAQLINPS-----IAEQNLMTKFNELDQ---NKLDVQLEE----RSLKWL
R5GSU5          EGSLARFKE-RNQIVDFE-----KSAQSALEEQRTLRL---SMLQAEVQL----SVAEYL
A0A2A3UE91      EGDLQKFKK-DKNISEKD-----KIITTELMRYSTIED---QMLQAQMEE----TLITEI
A0A0A2G557      DQEIERFKQ-NNQIANIA-----SEAEVYIESSKEITK---QTIEVNNAL----AVAGFI
A0A2N2WFW8      EDSMRQGKN-MSFDST-------LDRSSLQARLFELDN---LLAANISEL----ESLDRF
A0A1F3IU95      KDSLQQSSA-PSVDSS-------LDRTALQSRLFELDN---LISENSSEV----ESLEIF
A0A3D0VUF6      KDSLQQSSA-PSVDSS-------LDRTALQSRLFELDN---LISENSSEV----ESLEIF
A0A1T4PT95      DHEIERFKQ-NNQIANIE-----SEAEIYIESSKEITK---QTIEINNSL----AIARFI
A0A6I6JYY3      ENRMASFQS-ENQVIDIS-----LQSQQLLEQMKELDN---ERVALETQN----KYYHYL
A0A2A4PYG9      ENKMQGFKR-ENKLSQQ-----GDFITVYVXKLDNIEN---ELMDLELET----SMLDEV
A0A1F3K695      EKALHDFKK-ENNINISESELNTLSLNLYASKIEEIET---EILNLDFEL----ITLKRI
A0A353KZR1      EKALHDFKK-ENNINISESELNTLSLNLYASKIEEIET---EILNLDFEL----ITLKRI
A0A2N2WYB5      EKQLHEFKK-ENKLNLDKYPINGSPFPIFTAKISEFED---ELINIEFEL----VTLQRI
A0A1F3K4G0      EKELVAFKR-ENKINTDQFKAEGSPFPLFTTKISELED---ELINIDFEL----VALQRI
A0A356H8Y3      EKELVAFKR-ENKINTDQFKAEGSPFPLFTTKISELED---ELINIDFEL----VALQRI
A0A351HSA6      EKELVAFKR-ENKINTDQFKAEGSPFPLFTTKISELED---ELINIDFEL----VALQRI
A0A1F3Q014      ETSIQEFTK-NNNVTNT--DIENT---AKTTRLNALDD---QIISLELEE----NVLNKI
A0A2D5KD44      ERQIQRFKR-ENGITEI--DQFSK---VYIERMNQIDQ---AQVELEIEI----ATLEEI
A0A6N9NIX1      ERTIQEFKR-DNKVSGA--KEFSS---IFIERLNQLDN---AIVESTIQK----NILEEI
A0A2A4YXP3      EDKIKDFHQ-GTNYTSM--DRSSS---YF-DRSNRLEN---ELIDVDLQQ----SVLKEV
A0A1F3R158      ENSIEEFQK-TNKLTDI--DKFSS---LYVDRVNKLEN---QLVDIDLQK----NVLEEI
A0A2M8ADX2      ENSIEEFQK-TNKLSDI--DKFSS---LYIERVNKLEN---QLVDIDLQK----SVLEEI
A0A1J5B2H0      ENQLERFKK-TNKIDTIKLDVVPT---LF-SRQNELEN---QFSKLELEE----NMLNEV
A0A1V5N756      KNDIQEFKK-ENKIDLI-FQPLPE---VY-SIIKEFNS---EILKLEIEI----AKLKRV
A0A651GU15      EFELSMFMK-DNKISDLN-----RISEFYLSYFQQYDD---RQMELEYEE----KLLGEL
A0A3Q9FR88      EKKMRAISY-GKDLSSY------MEAGPIVGNIQELEK---SLSSLKNEK----KKYQKL
A0A553GEX3      EKKMRAISY-GKDLSSY------MEAGPIVGNIQELEK---SLSSLKNEK----KKYQKL
A0A150ADJ9      EKKLREISY-NKDLSSY------MDAGPIVNNIQELEK---SLNELKGER----KKYQKL
A0A1B1FWQ4      ETKMREMSF-NKDLSSY------MEAGPIVGNIQELEK---SLNSLKSEK----KKYQKL
A0A1S1Z228      EKTMRELSF-NKDLSSY------MEAGPIVGNIQELEK---SLNQLKSEK----KKYQKL
A1ZKR2          EAKIQSFML-KFKTNDVN-----KKLEESVKEIEKLIK---EKIVFNEQL----AAIKEL
A0A1Q3GX01      EGKIQAFKL-KLKTNDVN-----EKLEKSVQEIEELLK---QKLALSDEL----AGIKEL
A0A349DQI4      EAKIQGFKL-KLKTNNIN-----EKLDKSVQEIEQLIK---KKLKFTDEL----AGIKEI
A0A4P5TMD1      ENQLKAFKI-EHSLISTD-----SKQQEILTALKEINA---NEEGLNLDE----KNLNYY
A0A2N3IIZ0      EAEMERFII-QNKTNNIE-----GKISELVNKIQQLTE---ERYKINAKL----QTIIEL
A0A1F3SJM1      KDSLMFFQR-SANLPDPE-----SISGTITENISKLND---ELYRLEEEQ----LSLDIL
A0A2G2EB96      KDSLIRYQR-KSQLSDPE-----NAGISISDNVNKMQD---QLFELEEEY----NGLLNV
A0A2G6PRA9      KDSLIEYQR-RSQLSDPE-----NVGVSINENANKLQD---QLFELEEEY----NGLLNV
A0A497D5Z2      EDLMQDFQS-KNKIINIS-----LQTEQLLDQINDLDK---HRVMLETKD----KYYNYL
A0A662B170      EDLMQDFQS-KNKIINIS-----LQTEQLLDQINDLDK---HRVMLETKD----KYYNYL
A0A2A5FYT6      ETSMQSFQK-DNRITGND-----GFTGIYLERLNLLEN---EVINLELEE----SVLKEI
A0A2E6SYP1      RKLLKPYKE-LGSSETKDDF---DYNQLTRDLKGKDEN---EKIELQASL----SDFTQF
A0A2E5RLE8      QKLLQPYKE-IQENNSEYGT---DYGKLALDLAAKDQI---EKTKTESTL----NDFRNF
A0A2E7TQF6      QKLLQPYKE-IQENNSEYGT---DYGKLALDLAAKDQI---EKTKTESTL----NDFRNF
A0A2E6GVY9      QKLLQPYKD-LQKDNQEIKT---DYGKLALDLASKDQI---EKTKLETTL----IDFKNF
A0A350JJ90      EDLMSEFSQ-RTKLTKKK-----GIAATYITRVNVLEQ---KKVELELKI----SLLSEL
A0A3M1CDV2      ETKLNEFKK-QNNIVSTDNNS--ALSTSQSQIYSSVQE---QLLQIELNE----KLLDEI
A0A6C1QGZ7      EIELENFRK-EHGI----DDVTITPLPMLQTRIADFEN---QIVMLQLEK----SIFSEI
A0A4P5U6G4      ENQIKAFKI-QNGLISTE-----SKISEILTALNNIKQ---KQIMLNIKD----NMLYSY
A0A2E2TFD1      EVSIQEFKL-SNKVTGSS-----ELTGIYLDRLGNLEE---ELIKQELEQ----EILIQV
A0A2E4ELE6      EVSIQEFKI-DNKVSKTE-----NFTEMYIDRLALLEE---ELIKLELEK----DILDEL
A0A522EYA6      ETSIYSFKK-ENKVTEVK-----NMPDAGSARLNSLED---ELISLELRA----NVLVEL
A0A2E3XZI5      EKKIRDFKK-LNDFENKT-----TLIENQTKRIEEIEK---ELTVINSNI----NLLNQF
A0A6I7QXV0      QDTIKKFRI-ENRYLNPT-----DEVQMVMGRLNRVEN---MMLELSFNL----QAIEWL
A0A2M7NLQ9      EKRIDNYKQ-ENGITSQKPEEYQALVQNILNDIRELQE---KRVEMDNEL----KLYREI
I4AFR0          EKRMDDYKL-ENGITSQNPQEYQSLVQNILNDIRDLQA---KRLDIDNEL----KLYKEI
A0A2N2Y3E5      EEQLILFRK-QNNIKTDDEKDL-ATYRSVIERITRVES---DLEGIKVEV----DTYNNL
A0A2D9D7T6      KDSITSFQK-KSKL----SNPD-NTTVELSSRINSFKT---RQLENEEEL----VTLYLI
A0A1F3PPL5      ERQIHSFKK-ENKISPNSDLNL-SAFPIYTSKIHEFDE---EIMNIEFEL----VTLNRI
A0A357QK06      ERQIHSFKK-ENKISPNSDLNL-SAFPIYTSKIHEFDE---EIMNIEFEL----VTLNRI
A0A662AEA4      EKQLHEFKK-ENKLNYNILSNQ-NSAPIFTTKITEFQN---EILNIDFQL----VTLNRI
A0A0S2HYK8      ESKLQEFKK-ENNIPSEALER--TPFPIFTAKIEEFEE---QITTLDFEL----ITLKNV
A0A2N5ZWN6      ENKLQQFKK-DNNIPSDAFER--SPFPIFTSKIEEFSE---QITQLDFEI----FTLENV
A0A2E0FJ09      ERMLKDFKD-TNKI----RQVE-GMTDSYLSRIEEMES---ELVKLDVDE----EILNEI
A0A1F3FZ62      ESDLDMFKR-MNKIPDRLTDM--KSPPTYFSRVNDLQS---QLLNIEVEE----KMLEEL
A0A1F3K211      ESDLDMFKR-MNKIPDRLTDM--KSPPTYFSRVNDLQS---QLLNIEVEE----KMLEEL
A0A1V6I2U9      EKDLHNFRE-QNNILNIKDEYLFNKSNIYSSQISDIES---KILNVDFEI----MTLEKM
A0A2H0B957      EQLLIKFSI-THQIQGDKESST-SNVNRYANLLTKIEE---DIDITDIEI----SSLKQI
A0A1F3CFW6      EGLLMQFGI-THQIRNDNDSKE-TGTERYSILLSKIEE---ELDNVEIDI----SNLKQI
A0A2M7E2T8      EGLLMQFGI-THQIRNDKDSKE-TGPERYSILLSKIEE---ELDNVEIDI----SNLKQI
A0A2M7NC69      EGLLMQFGI-THQIRNDKDSKE-TGPERYSILLSKIEE---ELDNVEIDI----SNLKQI
A0A1F3KLL5      EKKIHDFKK-SN-IDSALQNKL-SPLPLFTAKINELQS---EILKTDFEL----ATLKRI
A0A359D1M1      EKKIHDFKK-SN-IDSALQNKL-SPLPLFTAKINELQS---EILKTDFEL----ATLKRI
A0A0F2NS19      ENRIQDFQT-SKKI----GNPN-EVSSIYLDKINRFEN---QLIDIDFQT----SVLKEI
A0A2A5H8X6      ENRIQDFQT-SKKI----GNPN-EVSSIYLDKINRFEN---QLIDIDFQT----SVLKEI
A0A2H0GAU8      ENKIQDFQS-NNKI----GNPQ-EFSSIYLDRLNRFEN---QLIDIDFQR----NVLTEI
A0A2M8FTK1      ENKIQDFQS-NNKI----GNPQ-EFSSIYLDRLNRFEN---QLIDIDFQR----NVLTEI
A0A2A5B3B0      ENRIQEFQE-GTNF----STLD-R-SSIYFDRSSKLEN---DLFNIDLQK----KILEEI
A0A5C6RXM7      ENKIQKFQK-DNNF----KGAD-A-TQKYFDRSTKLED---QLIDIELQK----NVLVEI
A0A1F3C1M2      EREIHDFKQ-LNNIELTNQDNV-KPISIYLTKFTEIET---EILNIEFEY----STLKRI
A0A1F3DS87      ERELHDFKQ-VNKIELTNQDNV-KPISIYLTKFTEIET---EVLNIEFEY----STLKRI
A0A6A0R6K9      EKEIQDFKR-ENFL----PDVD-DYSRIMIDRISQLNE---AQVDLEVQI----SLLEEV
A0A2E7CT70      EQEIQIFKK-ANNV----NSSL-MANKTQLSKISEVEN---KLVQNQVDI----TLLNQF
A0A2D5V560      EKDLRIFKK-NNKX----NXXL-LNISGIKENXEKIEI---EIAKXQIDI----DLXNQF
A0A2D7K5A8      EKDLRIFKK-NNKF----KNEL-IGITGLKDKAEKIEK---EIVKIQLDI----DLMDQF
A0A2E1XQ82      EKDLRIFKK-NNKF----KNEL-ININGFQDKAEEIEK---EIVKIQLDI----DLMDQF
A0A5C8A5B4      ENSMEQFRGVSGGMINTA-----STQDALFQERSRLED---ERSNILKRR----NYCSSV
A0A4Y9ITE2      EREVEAYKV-DNNFVDLV-----ADAQYIFTKKGTIDE---ALVTAETEY----EILEMT
A0A5M8NYX7      EQKVEEYKQ-VQGMTDLT-----AEAQLFLTSQSEYSK---KIIELQNQM----SVISSV
A0A3D5KRY6      GNMFTNFRA-ENRTVDLG-----REASLVVENLKKVEA---DRANLDLRL----ESFNNL
A0A0E3V905      ERNVEQYKS-HQGITDLS-----VQAQTFLQTVQQNDA---LMNQVQIQL----ATLNDL
A0A553ETH6      ENYFETFTV-ENRTSDLN-----EDLKNLILIINDIDS---QRLSIK-------NKSKDI
A0A640Q161      ERNLARFYE-ENQVVNID-----GVVGLAAEELEQLSK---QLLDAQTALKLNAVIYKQT
A0A640QU49      ERNLAKFYE-QNQVVNID-----GVVGLASDELEQLNK---QLLDAQTALKLNAVIYRQT
A0A1Q3PII2      ETSIEHFRK-HHRVIDAT-----EDGRQILERFHANAS---EEKELAVRM----KIVELL
A0A351BXT2      EGELEDYQK-NGGLILLD-----AQVKNVVENISVLEA---QQNAARIELNSKQEEYNSL
A0A2K8Z965      EKNVQSYKS-HQGITDLS-----VQAQSFLETVQQNDA---SLIQVNVQL----AALNDL
A0A418M8U8      EKEVERYKA-TQGITDLS-----TQAASFLQAIQQNDG---LLNQVNIQL----SALSDL
I2GTA4          EKEVERYKA-TQGITDLS-----TQSASFLQAIQQNDG---LLNQVNIQL----TTLSDL
A0A2K8ZAJ2      EKEVESYKS-THGITDLS-----VQAEKFLTTVKDNDL---QLNDVNMRL----GALADV
A0A368JPA3      EKSIETYKA-VNGISGIG-----SGAQSLLSSLQSNDA---QLNRVAIQL----STLGDV
A0A5N1JI29      EKSIETYKA-VNGISGIG-----SGPQSLLSSLQSNDA---QLNRVAIQL----STLGDV
A0A3P1BT12      EKSIETYKS-ANRISGIG-----SDAQALLSTLQNNDA---QLNQVAIQL----STLGDV
A0A3P1CI15      EKSIENYKS-VNRITGMG-----SSAQALLSNLQSNDA---QLNQVAIQL----SSLGDV
A0A4R8CUK1      EKSIEHYKS-VYRIAGMG-----PGAQWLLDTLQKNDA---QLSQLAVQL----SALGDV
A0A3D0MYJ7      ESNLENFQK-QNGIVDVQ-----QNVSELLGKSSEVEN---IKNLGKIELNAVEIQINNL
A0A662AH13      EEKLKDFQV-EGGIIALD-----DQAKALIDILSTFEA---QRDATFIEMVATERTINVY
A0A5C7QA01      EREFNKFRQ-QYNTVDVS-----KESELYLSQSITLET---KK-----------------
A0A3D3LS70      EAALQDFQQ-RGGIVFLD-----DQAKSIVEQIATLEA---QKNASEVELITSRRTYDAL
A0A1G1TM36      ESAVTGYRS-QQGLADVA-----SQSQIVLENTQANDT---RLNTAQVQL----AVVESI
A0A1G7ZF38      ETNIEQFRK-RHRVIDMA-----EDGRQALQQYHSNAS---DEKQLAMHL----KIVGLL
C6VS52          ETNIEGLRK-QHKLIDIA-----EDTRQALQKLAANTS---EEREWATHL----KIVQLL
A0A7C1LGX3      EGGKQAFKT-RNNLSYIE-----ADAGVSLERKSETEN---DVIKLETQI----SLSALL
A0A2A4G4B1      EGHLESFKT-QRVLTDLD-----MESGLYLRDNAQSRQ---EINTLSTQL----ELALLM
A0A0P7X1V8      EEQLRDFMN-QNQLVQLD-----AQAQQLIETLSTLEA---ESQGIQVKL----VAANSA
A0A6P1P355      ENELVHYKS-SQGVVNLS-----EQGKMYLSSVGESDR---NLSDINLQL----AILSEV
A0A5C8KAD6      ENEVVHYKA-TNGAVDLN-----EQGKLYLRNIGDNDR---RISEISNHL----SVLDQI
A0A5N1J695      EEKVQQYKS-SQGVVNLG-----EQSKLYLQSVGENDR---KIADINIQL----AVLQKV
A0A3B0C2S4      EVGKEDFKR-LNNLSYIE-----SDVDFSLQRKAVAQD---EVTNLETQI----SLAALL
A0A3N2M1H3      DSNIAKYQT-TTGSPDLI-----ASAQASMEKESNLEQ---SILNIENQL----SITTYM
A0A4S2G8T2      DSNIAKYQT-TTGSPDLI-----ASAQASMEKESNLEQ---SILNIENQL----SITTYM
A0A212K7W5      EDSISRFKS-QNLIPDIQ-----AASNMYMARSNENDT---KIQALSTQH----TIAKYI
F5IU11          EDSISRFKS-QNLIPDIQ-----AASNLYMVKSNENDT---KIQALNTQY----TIAKYI
A0A7C1QWC7      ESKLRDYRS-THQVTDLS-----YQGQQALNQMTQIEN---EKSTLKVQE----RYYNYI
A0A352Z1R7      EQDLETYKS-SSGMFKLD-----SEAQEVVKNLSETEK---LRAEVIFQK----KQVEFA
A0A3N2N6F7      DDNIATFKG-EHLVPDVA-----AASEMYMANANENTK---QQLGVMTQM----EITRFL
A0A4P7VVU7      DSDIADFKG-EHLVPDVA-----AASAMYMEDANENTK---QQMQVSTQI----AISKFI
A0A2V1ILM4      DSDIADFKG-EHLVPDVA-----AASAMYMEDANENTK---QQMQVSTQI----AISKFI
A0A3N2L0E8      DSDIADFKG-EHLVPDVA-----AASAMYMEDANENTK---QQMQVSTQI----AISKFI
A0A3N2LFC5      DSDIADFKG-EHLVPDVA-----AASAMYMEDANENTK---QQMQVSTQI----AISKFI
A0A0A2F501      DKDISSFKS-ANLIPDLK-----ETTRIYLDQTSEAEA---QLLDLSNQL----YMARYI
R5B7P0          DSDISAYKS-ENMIPDVG-----AAATMYMQQSTVLNQ---QLQDVSNQL----YMARYI
R5B0L5          DSDIASYQS-EHLIPNVQ-----QAASMYMTESQVVST---QMLELNNQL----QMTRYL
A0A6I1TEC0      DKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QIMDFNSRL----SIAQYI
A0A3R5XWG1      DKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QIMDLNSRL----SIAQYI
A0A5P0Y910      DKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QIMDLNSRL----SIAQYI
A0A414YFM3      DKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QIMDLNSRL----SIAQYI
A0A6A7UIA7      DKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QIMDLNSRL----SIAQYI
A0A6A7VPS3      DKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QIMDFNSRL----SIAQYI
A0A374THP7      DKNISAFKS-SNLLPDVE-----AAAQQYMQKSTEVDK---QIMDLNSRL----AIAQYI
A0A6G1VND1      DKNISAFKS-SNLLPDVE-----AAAQQYMQKSTEVDK---QIMDLNSRL----AIAQYI
A0A0A2EVS5      DSDISSFKS-KNLIPDVR-----TASEMYMTQAGEAGT---QILALNNQL----YMARYI
A0A1T4NAJ7      DSDISSFKS-KNLIPDVR-----TASEMYMTQAGEAGT---QILALNNQL----YMARYI
A0A255T941      DANISSFKS-ANLLPDVQ-----AASALYMNQSAESKK---AILELNSQL----TTAQYI
A0A3N2KCL3      DSDISSYKS-ANLIPDVS-----AASSMYMSQNQQISQ---QIMDLKNQL----KQTLYI
A0A4P7VSV0      DSDISSYKS-ANLIPDVS-----AASSMYMSQNQQISQ---QIMDLKNQL----KQTLYI
A0A2V1IJY1      DSDISSYKS-QHLIPDVS-----AASSMYMSQNQQISQ---QIMDLRNQL----KQTLYI
A0A4P7VXK7      DSDISSYKS-QHLIPDVS-----AASSMYMSQNQQISQ---QIMDLRNQL----KQTLYI
A0A1Y4CHN5      DADIASYKG-ENLLPDIQ-----AASSMYMSQSQETNA---QILELSMQL----SMAKYI
A0A1M6I2S6      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A0A1Y3V692      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
F3PXM2          DANIAGYKS-EHLLPDVQ-----AASSLYLMQSAENKK---ELLALNNQL----STARYI
A0A174AHH7      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYI
A0A174JCE8      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYI
A0A3E4JMC4      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYI
A0A412SND6      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYI
A0A414IEQ9      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYI
A0A6I0U0V8      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYI
A0A6L5S9H7      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYI
A0A0M1W8D8      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYI
A0A3R6GKX5      DENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYI
A7V4S1          DENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYI
B0NU19          DENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYI
D4V601          DENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYI
A0A4Q0U3M9      DENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYI
A0A4R4H1Q2      DENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYI
A0A6I0GII7      DENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYI
A0A6I0KYU7      DENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYI
A0A397WLT5      DENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYI
A0A6A2J529      DENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYI
A0A6L6P8N9      DENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYI
A0A6N8DDD8      DENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYI
A0A015XH67      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFI
A0A078RZN2      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFI
A0A4R4I3T9      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFI
A6L0K5          DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFI
A7ACT5          DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFI
A6KY94          DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFI
A0A173UQR8      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFI
A0A3R6HK75      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFI
A0A412B7D1      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFI
A0A412VNY9      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFI
A0A414LTU9      DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFI
I9Q4U4          DENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFI
A0A373ISF0      DENISSFKS-EHLLPDVQ-----AASSLYMAQSAENKK---ELLTLNTQL----STARYI
U6RF62          DENISSFKS-EHLLPDVQ-----AASSLYMAQSAENKK---ELLTLNTQL----STARYI
A0A662ZZD5      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A0A3A5TI83      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A0A415NEB6      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A0A6I0I238      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A7AJ60          DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A0A6A2JF01      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A0A6I0Y2Y2      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A0A6I2Q447      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A0A395YYT3      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A0A015UXN7      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A0A5M5W148      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A0A6I2NTL0      DENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYI
A0A016E4F9      DENIAGFKS-EHLLPDVQ-----AASSLYMAQSAENKK---ELLALNSQL----STARYI
A0A4Q5CFJ7      DENIAGFKS-EHLLPDVQ-----AASSLYMAQSAENKK---ELLALNSQL----STARYI
A0A6N3HG44      DENIAGFKS-EHLLPDVQ-----AASSLYMAQSAENKK---ELLALNSQL----STARYI
A0A6H9P0U9      DENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYI
A0A108TH71      DENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYI
I8VXH0          DENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYI
A0A412S0N6      DENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYI
A0A412IIJ0      DENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYI
A0A0P0FM97      DENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYI
R6KTP3          DENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYI
A0A139LU87      DENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYI
A0A1C6B3Y5      DENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYI
A0A6L3KCD1      DENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYI
E2NMQ4          DENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYI
A0A412YDB9      DENIAGYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSALNNQL----STAQYI
R7DY01          DENIAGYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSALNNQL----STAQYI
A0A414LGK8      DENIAGYKS-EHLLPDVQ-----AASSLYMAQSAENNK---ELSALNNQL----STAQYI
A0A415IPQ4      DENISSYKS-EHLLPDVQ-----AASSLYMAQSAENKK---ELSALNNQL----STAQYI
A0A3E5BRW7      DENISSYKS-EHLLPDVQ-----AASSLYMTQSAENNK---ELSALNNQL----STAQYI
K9DXS6          DENISSYKS-EHLLPDVQ-----AASSLYMTQSAENNK---ELSALNNQL----STAQYI
A0A1M6KFV3      DENISNYKS-EHLLPDVQ-----AASSLYMAQSAENKK---ELSALNNQL----STAQYI
A0A1Q6G7L3      DENISNYKS-EHLLPDVQ-----AASSLYMAQSAENKK---ELSALNNQL----STAQYI
A0A413H235      DENISNYKS-EHLLPDVQ-----AASSLYMAQSAENKK---ELSALNNQL----STAQYI
A0A1M5B2J8      DNDISSYKS-QHLLPDVQ-----AAANMYMAQASEANA---AIKSLNNQT----YMARYI
A0A255RCT5      DNDISSYKS-QHLLPDVQ-----AAANMYMAQASEANA---AIKSLNNQT----YMARYI
A0A1Y4GLF5      DEDISSYKS-EHLLPDVQ-----AASNMYMMQSSETNS---QILALNNQL----YMARYI
A0A1H3XSC0      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSNQTNA---LILTLNNQL----YMTRYI
A6LE40          DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A4Y1VPX5      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A6N2XMM4      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
B3JI46          DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A358R8U0      DENISTYKS-ENLLPDVQ-----AASSLYMAQSSETNA---QIMALSNQL----YMTRYV
R6WSB6          DENISTYKS-ENLLPDVQ-----AASSLYMAQSSETNA---QIMALSNQL----YMTRYV
A0A401LPX7      DDDISSFKS-EHLLPDVQ-----AAASMYMTQANEANT---AIRELNNQA----YMARYI
A0A6G0GNY9      DDDISSFKS-EHLLPDVQ-----VAANMYMTQANEANA---EIRELNNQV----YMARYI
A0A6I1BFM0      DDDISSFKS-EHLLPDVQ-----VAANMYMTQANEANA---EIRELNNQV----YMARYI
A0A3A5Z900      DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNNQT----YMARYI
A0A285TGL6      DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYI
A0A3A5RFX4      DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYI
A0A1Q6IUW9      DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYI
A0A413XDP6      DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYI
A0A6N8CVT6      DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYI
K6AP24          DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYI
A0A6I2NHV3      DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYI
A0A662ZYI7      DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYI
A0A078RYI7      DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYI
C7XEQ8          DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNDQA----YMARYI
D7INX6          DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYI
K5ZG55          DDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYI
A0A3N2N9B8      DQDISSYKS-AHLIPDVQ-----AASSMYMSENRQIAS---GIMDINNQL----QMTRFV
A0A3N2NMI0      DNDISSFKS-EHLIPDIA-----AASSMYMSQNQQIAS---EILAINNQI----QMARFV
A0A359I8H7      DNEIFDFKR-DHRVPNLE-----EAAKTQMKQSVEMSN---KMLEVTNQM----SMSIYL
A0A3N2KA63      DNEIFDFKR-DHRVPNLE-----EAAKTQMKQSVEMSN---KMLEVTNQM----SMSIYL
A0A4Q0IMT7      DNEIFDFKR-DHRVPNLE-----EAAKTQMKQSVEMSN---KMLEVTNQM----SMSIYL
A0A3B9FAU3      DSDISSYKS-SNLLPSVQ-----AASQMSMQQSQESQK---QVLALNTQR----SMAQYV
A0A3C1E5L7      DSDISSYKS-SNLLPSVQ-----AASQMSMQQSQESQK---QVLALNTQR----SMAQYV
A0A4Q0UAV1      ESNISNYRS-SNLIGDGS-----STANGAMQQRQQSQN---AILELNNRL----SLVKYL
A0A354SN68      DEDISSYKS-MNYVPNIG-----IATGMVMSQENSLDN---TIVSTNNKI----HMAYFI
A0A6L5XFL0      DEDISSYKS-KNMVPDVA-----ANAALNLNKADQTSQ---QLLEFENQL----YMAKYI
A0A3N2N595      DSDISSYKS-ENLIPDVD-----AASTLYMGESQRISQ---EIMGLRNQL----QMTRYI
A0A0A2DUD9      DKNITKYKS-QHLLPDVQ-----TASNLFLNQAAQVDN---QIVELRSRE----YMARQV
A0A3P1ZBJ5      DKNISSYKS-SNLLPDVE-----SASKLYMQKTSANDD---KLMELNNQL----YMTRYV
R5FHS9          DNSISSFKS-KNLITDVD-----AVATSYLDQSTAANA---KLLDLNTQR----AMAQYV
A0A413TW79      DKDISSFKS-RNLLPDVE-----TAAQQYMQKSGDVDK---QILELNSRL----SMARYL
A0A3E5E9M7      DKDISSFKS-RNLLPDVE-----TAAQQYMQKSGDVDK---QILELNSRL----SMARYL
A0A3E4SK73      DKDISSFKS-RNLLPDVE-----TAAQQYMQKSGDVDK---QILELNSRL----SMARYL
A0A415GGC6      DKDISSFKS-RNLLPDVE-----TAAQQYMQKSGDVDK---QILELNSRL----SMARYL
A0A413DBH9      DKDISSFKS-RNLLPDVE-----TAAQQYMQKSGDVDK---QILELNSRL----SMARYL
A0A1Y4PQK7      DENISSYKS-EHLLPDVQ-----TASNLYMAQNSQISS---QILALNTQL----SLVRYI
A0A1Y4IH41      DENISSYKS-EHLLPDVQ-----AASNLYMAQSSQTSS---QILALSTQL----SMVRYI
A0A3A6AAP4      DENISSYKS-EHLLPDVQ-----AASNLYMAQSSQTSS---QILALSTQL----SMVRYI
A0A6I0ZRD2      DENISSYKS-EHLLPDVQ-----AASNLYMAQSSQTSS---QILALSTQL----SMVRYI
A0A1Y4DYA7      DENISSYKS-ENLLPDVQ-----AAANMYMTQSNATNS---QILVLNTQL----AMTRYV
A0A1Y3X4I9      DENISSYKS-ENLLPDVQ-----AAASMYMTQSSETSS---QILALNTQL----AMTRYV
A0A1Y4FNK8      DENISSYKS-EHLLPDVQ-----AAASMYMAQSSETNA---QILALNTQL----SMARYI
A0A355FD59      DEDISSFKS-KNLLPDVE-----AASGMYMEQSRETSN---LLLSLKSQL----SMANYI
A0A359CEZ9      DEDISSFKS-KNLLPDVE-----AASGMYMEQSRETSN---LLLSLKSQL----SMANYI
A0A353Q7B4      DEDISSFKS-KNLLPDVE-----AASGMYMEQSRETSN---LLLSLKSQL----SMANYI
F8X3A5          DEDISSYKR-QNLVPDVD-----AASSMYMAQSRETSN---LMLDLNTRL----SMARYM
A0A1M3KVR9      DEDISSYKR-QNLVPDVE-----AASSMYMAQSRETSN---LMLDLNTRL----SMARYM
A0A4Y9IJS3      DEDISSYKR-QNLVPDVE-----AASSMYMAQSRETSN---LMLDLNTRL----SMARYM
A0A495WI87      DEDISSYKS-EHLLPDVQ-----AASSMYMAQVNETDA---QLLALNNQL----YMARYI
A0A354M4S6      DEDISSYKS-EHLLPDVQ-----AASSMYMAQVSETDA---QLLALNNQL----YMARYI
R7DH52          DEDISSYKS-EHLLPDVQ-----AASSMYMAQVSETDA---QLLALNNQL----YMARYI
A0A4Q5E7L5      DEDISSYKS-EHLLPDVQ-----TASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A4P8LP09      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A4R4GZU7      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A016CWA4      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A1C6H117      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A0M1W0V2      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A139KA16      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A174VQ92      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A1Q6HCG0      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A1Y4JYM9      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A3A5QW67      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A3A5RQE6      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A3A6BP07      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A3E5E153      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A3Q9IP20      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A412WV15      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A413ICP6      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A414KYB9      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A5B3FWR2      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A6L4P3V7      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
E5WX00          DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
K0X3P3          DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A415TAH7      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYI
A0A078T2W6      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSEANA---QILSLNNQL----YMTRYI
A0A6I1AQV4      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A5C6L2P1      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A412MJT7      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A3E4WKT5      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A3A5YY33      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A078TAH2      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A1E9CFZ7      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A373FYU5      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A3A5TZ72      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A3A5XBP2      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A3A6MEG9      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A3E4JP35      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A3E4KP40      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A3E4NX82      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A3E4XFU8      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A412RG70      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A412TD37      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A413GAA4      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A414M7I4      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A496BTA0      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A496D2V6      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A4Q5G1P5      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A5C6KCA6      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A5M5AHM5      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A6I0KZV6      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A6I0Y5K7      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A6I1BFB8      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A6I2P5W5      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A6N8DC51      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
E5UZA2          DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A069SMG6      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A6A2RTB3      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A6I0VY00      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYI
A0A1M4YZ07      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A0P0FQW1      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A5M5C0W6      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6I0H151      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A642LZ22      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6I0HI59      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A642NJ89      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6I0HI52      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6L3JTQ2      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6L4EED9      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6I0YVB5      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6L5RHE2      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6N3AEV2      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6L3KG29      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6G0G4T5      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6I0HFG9      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A4Q5E5M7      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6L4F5W0      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
C3RFN5          DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A3A5Z014      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6I0ING7      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6L5S265      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A078S3Q8      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A069SJV7      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A3E5DXI5      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A3E5EM98      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A3E5F453      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A6N2YYD4      DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
I9T3G6          DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A3E4SYU0      DEDISSYKS-EHLLPDVQ-----AASSIYMAQSSQTNA---QILALNNQL----YMTRYI
A6LGY1          DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
K5ZSH4          DEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYI
A0A1H4ADG3      EGNIQHFKQ-HNELADLP-----TQSQSLIANAGENAK---ELAAQQVQL----SITNSL
A0A5B8VUR8      EGNIQHFKQ-SNDLADLP-----SQSQSLISNAGANAK---DLATQQVQL----SITNSL
A0A0D3L8Q3      EKDVEEYKR-ERRLTNVG-----TEAQLYLQGRTGYDQ---QLSEYELQL----EILNSI
A0A2N3U785      EENVERYKR-SNEVTNLD-----SDARMYVEKAADYNR---QISEWQVQI----DVLQTI
A0A5B6TJH8      EKNVEQYKS-QNEVTDVN-----TQASDYLAQASDYNK---QLSEWAIQI----DILRSI
A0A519U664      EKGVEKFKS-QNALTDIS-----SQASGYETQASNYTQ---QLAEWATQI----DLLESL
A0A519MA34      EKGVEKYKS-QNALTDIA-----SQASGYETQAASTTQ---QLSEGATQI----DLLESL
A0A519UCX0      EKGVEKFKS-VNALTDIT-----SQASDFQAQNSTTTQ---QLSEWATQI----DLLESL
A0A0E3ZG78      EKDVEQYKR-QHELTDVN-----IQASNYLNIASGYNK---QLSDWAIQI----EILESI
A0A1I6BRK6      EKGVASYKS-TNSLTDIA-----AQATSYAEQATNYDS---QIAEWATQS----EVLESL
A0A243WAB1      EKGVEKYKS-VNGLTDIS-----TQASDYTAQASDYNK---QLSEWGIQI----DVLESI
A0A6G8C8X6      EKGVEKYKS-IHGLTDIS-----TQASNYTNQASDYNK---QLSEWAIQI----DVLESI
A0A416GA42      DNQIASYRS-ANQLID-G-----TQSGLYLQRADQFQN---EAVQLQTEL----ELTRYL
A0A1T3IYP5      ESNIEDLKI-ANQGIDIA-----TAGGTFLTEKNQYRS---EGAKVETDI----RLAEMM
A0A1T5K9D4      EDMMSGYRS-TKKLLDAN-----ADAAEYLSESRSYGS---DISQVETNL----SIAEYL
A0A077ENE7      ESNVENLKI-ANQGIDVA-----TAGSLYLNEKNQYKS---EGTKIETDI----RLAEMM
A0A6I5UW06      ESNVENLKI-ANQGIDVA-----TAGSLYLNEKNQYKS---EGTKIETDI----RLAEMM
T0NN57          ESDIENLKI-ANKGVDVE-----AAGGMYLSESNQYKT---EKTKIETDI----RLAEMM
X5K347          ESDIENLKI-ANKGVDVE-----AAGGMYLSESNQYKT---EKTKIETDI----RLAEMM
A0A060RD97      DTDIADYKQ-QSNVLDFS-----AAANMYMQTSNEIRR---DAAEVENQI----AMANYI
A0A3C1ITV0      DSDIERFKS-SNRLLDMN-----AETAQVTQESSKYSE---QAFLANNQL----AVARFI
R7HN19          DSDIERFKS-SNRLLDMN-----AETAQVTQESSKYSE---QAFLANNQL----AVARFI
A0A350IHV0      EESLKQYKE-THKITDIA-----SISEAYLKESTDYSA---KSFEVNNQL----AIAKFI
R5RVP0          EENLKDYKS-SHKITDIR-----SLSAAYLEESTEYKA---KSFDVNNQL----AIAKFI
R6A0L2          ENQLASFKK-RNQLVDFD-----KTPQAMIDESSTARQ---QSLQAETQL----NVAKYL
R7LG80          ENNLASFKK-RNSVLDFE-----TTAQSITQESSLARQ---KTLEAETQL----NVAQYL
A0A2L2WX98      RDQMAKFLS-DNKLTDFE-----QSAQMYLTESSAARK---QRLELETQV----AVARYL
A0A6N8KXI9      ESDIENLKS-RNQGIDVG-----TASEIYLTDSRQYQA---DKNKIETDI----KLANMM
G5GD56          ENRLASFKQ-QNRVIDFQ-----QAAGTVTAQSADARQ---QALQLETQL----SVARYL
R5KD55          DNDISRYKS-KNLLPDVE-----KAYSLSMERADKNSA---ILLDLNTKL----SVAGYI
A0A174QNT3      EDQLTIFKQ-EHRIVDIN-----ANANIYLQEGSKAKE---ESIQLEAQL----NVVEFI
A0A4S2FGS1      ENKLTTFKQ-EHRIVDIN-----SNANLYLQEGSKAKE---ESIQLEAQL----NVVEFV
R9I0H0          ENKLTTFKQ-EHRIVDIN-----SNANLYLQEGSKAKE---ESIQLEAQL----NVVEFV
K5BUT9          EEDLTDFKQ-RNQIVDMS-----ANATQYLAESSKVKE---ESAQLETEL----SIARSI
A0A174FPA3      EEDLTDFKQ-RNQIVDMS-----ANATQYLAESSKVKE---ESAQLETEL----SIARSI
R6S9Y6          EEDLTDFKQ-RNQIVDMS-----ANATQYLAESSKIKE---ESAQLETEL----SIARSI
A0A642LIH6      EEDLTDFKQ-RNQIVDMS-----ANATQYLAESSKVKE---ESAQLETEL----SIARSI
C9KX15          EEDLTDFKQ-RNQIVDMS-----ANATQYLAESSKVKE---ESAQLETEL----SIARSI
A0A6H0KRK1      EEELTDFKQ-RNRIIGSE-----GNGTQFLAESSRMKT---ETLQMETEL----SIAQSI
R6DAG6          EEELTDFKQ-RNRIIGSE-----GNGTQFLAESSRMKT---ENLQMETEL----SIAQSI
A0A3L8AAP1      EEELTDFKQ-RNRIIGSE-----GNGSQFLAESSRMKT---ENLQMETEL----SIAQSI
A0A4S2AYX2      EEELTDFKQ-RNRIIGSE-----GNGSQFLAESSRMKT---ENLQMETEL----SIAQSI
A0A4Y9H477      EEELTDFKQ-RNRIIGSE-----GNGSQFLAESSRMKT---ENLQMETEL----SIAQSI
A0A0E2M2Y7      DTEIETFKK-SNNITDIS-----TDVGAFLKSNADLQK---DQLVVERNL----SLAKYI
A0A0K2J6Z0      DTEIETFKK-SNNITDIS-----TDVGAFLKSNADLQK---DQLVVERNL----SLAKYI
B2RKZ8          DTEIETFKK-SNNITDIS-----TDVGAFLKSNADLQK---DQLVVERNL----SLAKYI
A0A212GC82      DTEIETFKK-SNNITDIS-----TDVGAFLKSNADLQK---DQLVVERNL----SLAKYI
A0A254MU12      DTEIETFKK-SNNITDIS-----TDVGAFLKSNADLQK---DQLVVERNL----SLAKYI
R6CQ93          ETELESFKQ-SNQLMDIG-----SLAGRYMGEAQTYSA---DAMEQETQL----KLAQFI
A0A3D1NQW3      DRNIEKFKK-DNKIYDIV-----SEAEQTITESAQYKT---DGLSLENQI----RMTEFL
B0MT10          DRNIEKFKK-DNKIYDIV-----SEAEQTITESAQYKT---DGLSLENQI----RMTEFL
R7JGW9          DRNIEKFKK-DNKIYDIV-----SEAEQTITESAQYKT---DGLSLENQI----RMTEFL
A0A3D2BF46      DRKISTYKK-DNEMYDIT-----AQATQSLTESSQFKT---AGLSVENQI----SMAQYI
A0A358R538      DRGIEELKR-SNRMIDLQ-----SEAARNVTESSRYKA---EGLSLENQI----AVARFV
A0A1Y4AAB8      DRDIENFKR-DNRMVDLA-----SEATRNVEESSQFKA---EGLSLENQI----NVAEFI
A0A1Y3WWY9      DRDIENLKK-DNQMVDIA-----SEATRSVTESSQYKA---EGLSLDNQI----NVAQFI
A0A1Y4U5L4      DRDIENLKK-DNQMVDIA-----SEATRSVTESSQYKA---EGLSLDNQI----NVAQFI
A0A1Y3VCJ1      DRDIENLKK-DNRMVDIS-----SEATRSLTESSQYKA---EGLSLDNQI----NIAEFV
A0A1Y3QTW7      DSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYI
R6XWY7          DSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYI
A0A4Y1X9Y9      DSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYI
A0A4Y1WM66      DSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYI
A0A6N4GYT3      DSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYI
A0A174AVF1      DSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYI
A0A656Q4F4      DSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYI
A0A1Q6EIY0      DRDIEDIKK-SNKMIDIT-----SEATRTITESTRYKA---ESLTIENQI----SVADFI
A0A5B5VN71      DRDIEDIKK-SNKMIDIT-----SEATRTITESTRYKA---ESLTIENQI----SVADFI
E4M8L3          DRDIEDIKK-SNKMIDIT-----SEATRTITESTRYKA---ESLTIENQI----SVADFI
I3YQ50          DRDIEDIKK-SNKMIDIT-----SEATRTITESTRYKA---ESLTIENQI----SVADFI
R5UEY8          DRDIEDIKK-SNKMIDIT-----SEATRTITESTRYKA---ESLTIENQI----SVADFI
A0A1H4D866      DRDIEDIKK-DNQMVDIT-----SEAARSVSESSKYKA---EGLSLENQI----NVAEFI
A0A5B3G4Y7      DRNIEDIKK-DNRMVDIT-----SEAARSVSESSRYKT---EGLSLENQI----NVAEYI
A0A374A9J5      DRNIEDIKK-DNRMVDIT-----SEAARSVSESSRYKT---EGLSLENQI----NVAEYI
A0A5B3GQN5      DRNIEDIKK-DNRMVDIT-----SEAARSVSESSRYKT---EGLSLENQI----NVAEYI
A0A1Q6E9S3      DRNIEDIKK-DNRMVDIT-----SEAARSVSESSRYKT---EGLSLENQI----NVAEYI
D4IJ36          DRNIEDIKK-DNRMVDIT-----SEAARSVSESSRYKT---EGLSLENQI----NVAEYI
A0A414Q925      DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
A0A415PUS9      DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
A0A108TCU0      DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
A0A413BA42      DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
S3Y344          DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
A0A4Q5G8Y8      DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
A0A412TGL3      DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
A0A413VJ33      DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
A0A414L0W6      DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
A0A412DP39      DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
A0A413ZSE8      DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
B0NP84          DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
R6AK43          DAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
A0A412N2D9      DAEIENYKK-KNKLTDIA-----SESALYLKSSSMLDT---EGLSVENQL----NMAQYM
A0A1Y4JYS9      DAEIENYKK-KNKLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
R6LHA4          DAEIENYKK-KNKLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYM
A0A3E5HPT8      ETDIEDLKR-ANNGVDIN-----TVAGMYIQDSRQYES---SIKELDTQL----QLVSFI
C6IJ48          ETDIEDLKR-ANNGVDIN-----TVAGMYIQDSRQYES---SIKELDTQL----QLVSFI
Q8A3U2          ETDIEDLKR-ANNGVDIN-----TVAGMYIQDSRQYES---SIKELDTQL----QLVSFI
A0A3R6S1H6      ESEIETFKK-ENLLTDIV-----SETGIYLQNSNLYQQ---EGLGLENQL----SLARSI
A0A3R6SD81      ESEIETFKK-ENLLTDIV-----SETGIYLQNSNLYQQ---EGLGLENQL----SLARSI
A0A354WXN6      DANIESFKR-ENQLTDIT-----SETGMYLQNTSQYNQ---ESLSLQSQL----QLAKYI
R5IP14          DSQIETFKK-ENELTDIT-----SEAGMSLTMKSGYMS---EGVSLENQI----SLVNFI
A0A316SZX7      DSEIANFKS-TNKLTDIS-----SEAQSQLQQSSAFKK---EGLSLENQI----NLALFI
A0A1Y4AIY1      DTDIETFKR-EHQLTDIT-----SETGMYLQNTSQYRK---EGLSLENQL----SVAQYI
A0A0J6CIR2      DADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYI
A0A3D8HG59      DSHIESFKR-ENQLTDIV-----SETGMYLKESSEYSR---EGLSLENQL----TLARYI
A0A3R6S408      DSHIESFKR-ENQLTDIV-----SETGMYLKESSEYSR---EGLSLENQL----TLARYI
F3ZRU7          DTQIETFKK-TEKLTNIT-----SDAEMFITETTGLKK---EELEVLNQL----SLGQYI
A0A1C5Q1F3      ESQIADYKS-QHNLADIS-----TQTGSFMERSNRYQQ---EGVTLENQR----TLALYI
R7A239          ESQIADYKS-QHNLADIS-----TQTGSFMERSNRYQQ---EGVTLENQR----TLALYI
A0A3R6HIK7      DANIETFKR-ENQLTDIK-----SETGMYLQNTSQYKQ---EGLSLENQV----AVAKYI
K5ZVW7          DANIETFKR-ENQLTDIK-----SETGMYLQNTSQYKQ---EGLSLENQV----AVAKYI
A0A1Y4D5Z0      DANIEAFKR-ENQLTDIS-----SETGMYLQNTSKYKQ---EGLSLENQL----AMAKYV
A0A413VXJ7      DANIEAFKR-ENQLTDIT-----SETGMYLANTSLYRQ---EGLSLENQL----SIAKYI
I9RSN9          DANIEAFKR-ENQLTDIT-----SETGMYLANTSLYRQ---EGLSLENQL----SIAKYI
U6RJK5          DANIEAFKR-ENQLTDIT-----SETGMYLANTSLYRQ---EGLSLENQL----SIAKYI
A0A1Q6GA32      DANIEAFKR-ENQLTDIT-----SETGMYLANTSLYRQ---EGLSLENQL----SIAKYI
I9RPU6          DANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIARYI
I8YFS5          DANIESFKR-ENQLTDIT-----SETGMYLANTSRYKQ---EGLSLENQL----SIVKYI
A0A6L3FCC6      DANIESFKR-ENQLTDIT-----SETGMYLQNTSRYKQ---EGLSLENQL----SIVKYI
I8Y597          DANIESFKR-ENQLTDIT-----SETGMYLQNTSRYKQ---EGLSLENQL----SIVKYI
A0A1Q6GBF5      DANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIARYI
I8YFZ3          DANIENFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIVRYI
A0A1Q6GDH2      DANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIAKYI
U6RSB0          DANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIARYI
I9SIK1          DANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIAKYI
I9GXM2          DANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIAKYI
I9TP59          DANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIAKYI
R5S343          DSSIASFKS-EHRLTDAG-----LETGVFLQESSLYNQ---TGLGLDNQL----SLAKYI
A0A1M6K7I9      DADIESYKR-ENQLTDIT-----SETGMYLQTTTKYKQ---EGLSLENQL----SLAEYI
A0A5M6A8C8      DADIESYKR-ENQLTDIT-----SETGMYLQTTTKYKQ---EGLSLENQL----SLAEYI
A0A6L3FBE6      DANIESFKR-ENQLTDIT-----SETGMYLQNTSRYKQ---EGLSLENQL----SISKYI
A0A6L3FNG1      DANIESFKR-ENQLTDIT-----SETGMYLQNTSRYKQ---EGLTLENQL----SIAKYI
A0A3R5ZMK1      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A6L6NFJ9      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSRNQQ---EGLSLENQL----SLAKYI
A0A1Y3ZIA4      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
K5Y1A4          DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A4Q5CIT0      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A6L6NWL9      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A3R6K8X4      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A6N8D6C8      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A3R6BKI7      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A6N8CW60      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A412M2W1      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
K5ZX55          DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A415BDM7      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A6L6MX19      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A1Q6I3T6      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A414XX40      DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A7AEU7          DSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYI
A0A5F0U645      DAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYI
K5ZBN2          DAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYI
A0A0J6CKW3      DAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYI
A0A0F5IQM7      DAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYI
A0A496CDT3      DAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYI
A0A6G1ZKM3      DAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYI
S0GLB0          DAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYI
A0A3R6NLC1      DAEIEVFKR-ENQLTDIH-----SEAGLYLQEGSQYSQ---EGLGLENQL----TLAKYI
A0A416WYC9      DAEIEVFKR-ENQLTDIH-----SEAGLYLQEGSQYSQ---EGLGLENQL----TLAKYI
A0A0F5IT40      DADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYI
A0A496CX20      DADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYI
A0A5F0UBI0      DADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYI
A0A6G1ZHG0      DADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYI
S0GSI7          DADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYI
K5YB65          DADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYI
A0A0F5IWP9      DADIETYKR-ENQLTDIS-----SETGMYLQESSQYSQ---EGLGLENQL----TLAKYI
A0A0F5IZT8      DADIETYKR-ENQLTDIS-----SETGMYLQESSQYSQ---EGLGLENQL----TLAKYI
A0A417LKQ2      DADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EGLGLENQR----TLAKYI
A0A416TME1      DADIETYKR-ENRLTDIS-----SETGMYLQESSQYSK---EGLGLENQR----TLAKYI
A0A416XPE8      DADIETYKR-ENRLTDIS-----SETGMYLQESSQYSK---EGLGLENQR----TLAKYI
L8JI02          EGWLENFRA-KSNIQDIS-----YTAENLSKNLDRLES---EKADLQVKL----KYYTYI
A0A4Q5WS95      EKQIQSYKA-QKGIVDLS-----EQGKLYLKNVGEIDQ---KLAEVNMKM----AVLGQV
A0A501VZX6      ENKVVKYKS-SEGVVNLS-----EQGKLYLESVEGRDL---KMSDIDLQL----AVLDKV
A0A399SH26      ESRVQKYKT-SKGIVDLS-----EQGRTFLQNMSANDS---KVEDINLQL----AVLAKI
A0A501W1A9      EEKIVEFRS-TKGAVNLN-----EQGRMFLQNVGENDR---RLGEINLQL----AVLDNV
A0A0E3ZGV6      EDKIVKYKS-TQGAVNLN-----EQGKLFLQSVDNNDR---RLNEINLQL----AVLDNV
A0A1I2N4S1      EEQIVKYRA-SNGAVNLN-----EQGKLYLQSVDFNDR---RMNEINLQL----AVLDNV
A0A2T5YE44      EEQIVKYRS-SNGAVNLN-----EQGKLYLQSVDFNDR---RMNEINLQL----AVLDNV
A0A1M5BA90      ENRLQKFRN-QKGVVDLS-----EQGKLYLQNVGDNDR---KMTDINMQL----AMLNEV
A0A512B879      ENQLRKFKT-DKGVVDIS-----EQGRLYLQNVGDNDR---KMTEVNMEM----AMLNEV
A0A559PPI3      ESENEQYRS-SKGVVDLS-----QQSRIYLQDAGHNDQ---RIADIRLKL----SVLDKV
A0A1T5CS78      EYKIQQYKS-NEGVVDLS-----EQGRLYLQDVGENDK---QISELELQL----AVLNNV
A0A0Q9Z8F1      EYNIQEYKS-NQGVVDLS-----EQGRLYLQDVGENDK---QISELELQL----AVLNNV
A0A2N0U0M7      EYKIEEYKS-NQGVVDLS-----EQGRLYLQDIGENDK---QISELELQL----AVLNNV
A0A1V9FHD0      EGKIQTFRT-NQGVVDLT-----EQGKQYLENVGTNDR---KIADLSMEL----AALDEM
A0A4V4H170      EHIIQSFRT-DKGVVNLG-----EQSRQYLENVGSNDR---KIADLSMQL----AALGEM
A0A1V9F098      EQRIQTFRT-DKGVVDLS-----AQGRQYLENVGSNDR---KMADLSMQL----ASLNEM
A0A4R2VU64      EQKIQTFRT-EKGVVDLG-----AQGRQYLDNVGSNDR---KMVDISMQL----ASLNEM
A0A4S8HY23      ERTVQSFRT-DKGIVDLG-----EQSKQYLENVGSNDR---KMADLSMQL----AALEEM
A0A1V9F383      ESVVQTFRT-DKGVVDLG-----EQSKMYLENVGDNDR---KIADLSMQK----AALDEM
G8TRZ6          ESVVQTFRT-DKGVVDLG-----EQGKMYLDNVGDNDR---KIADLSMQI----AAVDEM
A0A4R5DL69      EEKIESFRR-KNHITDMA-----EQSRLLLANSSLYDK---EKLQVNLEL----DMISSL
A0A1M4YED3      ERTIQQYKS-QKGIVDIS-----EQGKEFLRTVSDNER---QATSINMQV----STLDQI
A0A2H3NSN0      ENEWQQFAR-RHDVAIDG-----QDGNRVATDYVEMMG---QRDQLEFQL----QEEQRT
A0A2P6C324      ENEWEAFAR-SNAIVTEG-----LDGQNVAAEYAELQS---QRDALTFQL----EQEKRT
A0A7C2DZI7      ERQWETFAR-SRQVVRLG-----PQGERLVAEVAQLEA---QRDAARFQL----EQERSA
A0A1M6XHU0      ERQWEAFAR-SRQVVRLG-----PQGERLVAEVAQLEA---QRDAARFQL----EQEKSA
G2SF81          ERQWEAFAR-SRQVVRLG-----PQGERLVAEVAQLEA---QRDAARFQL----EQEKSA
A0A5S9EYW1      ERQWEAFAR-SRQVVRLG-----PQGERLVAEVAQLEA---QRDAARFQL----EQEKSA
D0MHQ9          ERQWEAFAR-SRQVVRLG-----PQGERLVAEVAQLEA---QRDAARFQL----EQEKSA
A0A126PFG0      EADEAGYRS-QQGLTDIA-----SQSKVYLENAQANDS-----RLNEAQV----QLAV--
A0A3M1N7Z3      ----------QDTLYRVE-----TKEDILFMEARKDRALSLYQDLNKLDK----SLSVEY
                                                                            

A0A1T5MMH4      MDGL----------QTGN----------FSVN-PSIRQALPEYM--FKDIDEVQSLLLQ-
A0A2W4R1L8      LDDM----------SNGV----------YLVN-PVHRLYFPQAI--NDNLDKLSELQMS-
A0A2E5CV79      ISFL-----NSKLSAEEK----------NFAT-KISTDINAQMIVLRKEINQLESQSIQ-
A0A2D4ZVH1      IAQY----------ENQL----------NEIK-PGLADLYSDAI--GPVIERYQYALAEL
A0A0K8QSK7      RNYI-------I--QNQE----------LESI-MAPSAMGVEDPMMTSLTQELNTLTLE-
A0A1V6CN82      KTYI-------L--ENRD----------VGSI-LVPSSVGINDPLLSGLLSQYNQLTVE-
A0A1M4XZ45      RDYI-------STSSSQE----------METV-IAPSAMGIQDPLLNSLILQLNELITE-
A0A399D319      RDYI-------HSDTNKE-----------ETI-IAPSAMGIQDPLLNSLILRLNELITE-
A0A1V5IPN7      LDVL--------RKQLQD----------QDSL-LVKVENVLQAPYIGELRRQITNTQAT-
A0A1M6GR99      KEYN---------SDNSD----------DTQI-VPPSAMGVQDPLLNNLIEELSTAQTQ-
A6EBM4          RNTI---------TTEQT----------NTPL-NLSLEGTIDPLL-ATLAQNLNSLLHE-
A0A7C5M4P4      SQQL------------KS----------GRKI-SLPGPATEFPAHLVSLVDEMNLLINE-
A0A1M6TTV4      SEQL---------DEGTP----------ISPV-DMPKEI-------MQLLVDYNKLKNE-
A0A4Q8RX32      NSNF---------NKDDD----------FTDY-SLTILSDLNNQVLNDLLNEYVDLVGR-
K0X1U5          DSFL--------NKPENK----------YSLV-PVTTGLPDRGA--AEAINEYNKLLLE-
R5EXK3          DSFL--------NKPENK----------YSLV-PVTTGLPDRGA--AEAINEYNKLLLE-
A0A401UAP7      KEDL---------KDGKT----------ERYV-SLTDKETLPQEV-INDVLAYQKKREA-
A0A1W2GF52      GENF---------RNGQQ----------VSIF-KMPTRI-------TELVNSYNDLVND-
A0A2G5L7B8      NKQL---------GEGTP----------ITTL-GLPKPF-------LEMLAEYNELKNE-
A0A523GAC0      QSNV--GNQTGAPERLLQ----------YSSY-NEDI---------NTTLSKLGDLVRE-
L8JW09          LADL--ENNKTEFLGISQ-----------ETY-PKHI---------ADAYNELSVQISE-
A0A364XUP5      SDGL------------RS----------KKFF-VSPGLRKILPEYISKNLDRVQELFLT-
A0A1M5RLA9      MDGM------------KA----------GDLS-ISLTQLHALPPTVAKNLEQLEDLYRD-
A0A385SFR9      MEGL------------KT----------GDLF-ISLTQLHALPPTIAKNLEQLEDLYRD-
A0A5M4A9J4      LNYL---------KSNND----------LKQI-AAPSTVGINNPMLVSLLQQLAGQTLD-
A0A5M4B1C7      LQYL---------KSNNS----------IEQI-AAPSTMGVDDPMIVNLLQQLTSQTLS-
A0A0D3LFR6      SSRI-------KSEDTYF----------AQSL-VNRAGDDFPADI-KTLLDQLNKLISE-
M7N6D4          ASRI-------EAEDSYF----------AQSL-VNRQDGNFPAEL-KGLVEELNTLTSE-
A0A4D7K1D4      QAQL---------GNNEQ----------LEFG-SLTLENFPESI--TELIEEINVLETE-
A0A5C7MX19      KKIF---------KDTEF----------SSIP-LVALQEKDIDV--NDLITRINVLKNE-
A0A1Q3ZMZ7      KRRI-----NSTSSETEI----------SNIL-IEIANEEYSGII-RTQIETLQEMITD-
A0A2D8JJW3      KEIY--------------------------------------------------------
A0A2W2AFF7      QKYL--------HENVNN----------RRVV-PSSLVLQDPTF--VALIDKYNGVQLE-
R7PCR1          ESYL---------HSKSK----------DDEF-IPMLDLGDAGI--QQEISAYNDILIE-
A0A1G9E2A9      EAYV------NRVDSTLE----------VEFI-PSTRAIRDEQL--LSLVNQLNTKRIE-
A0A098LL25      KDLI--------LGDQEV----------NSFI-PALSQVENPQL--SAAINSLNTLQEE-
A0A6J4H627      QELI--------NHKDDL----------SSFI-PSVPLLPDPQL--QTYTNDINRLQQE-
A0A6C0GJI1      QNII--------ETEGDL----------ASFI-PSIPLLTDQQL--GELTQNINKLQQE-
A0A2T2YJE8      DQLL--------NKSSNL----------DQMI-PSLKELDDAQL--LKQIAQLSDLQLD-
A0A127B287      -----IQQRIRKGDDLSL----------VISS-LQLQEQQDPQL--AQLLTELNDLQAQ-
A0A6P1P2P6      -----IQQRIRKDDDLTA----------VISS-LQLQEQQDPQL--AQLLTELNDLQAQ-
A0A3M9N829      -----IQSKMQQDEDLGL----------IVAG-LQGQPNQDPQL--SELLTELSQLQAR-
A0A0P0CSF9      -----IQTKVQRNEDLGM----------IASS-IQGQENQDPQL--AEQLTELSDLQAQ-
A0A5M8QQB8      -----IQAKVQRNEDLGM----------VVSG-LQGQEGQDPQL--TEQLTELSDLQAR-
A0A3M9MNC3      -----IQSKVQKNEDLGM----------IAST-IQGQENQDPQL--AEQLTELSDLQAQ-
A0A5B6TAX2      -----IQAKVQRNEDLGM----------VVSG-LQGQGNQDPEL--AEQLTELSDLQAR-
A0A5N1IQ33      TGLI-GQNRVFVREGQSL----------EQSI-PAIGALENPQI--AEQISILNEQQGD-
A0A512AYT3      ARLV-SQAGQDEQESD-L----------EQVI-PSLKAVEDQEL--SSRISELSNLQLY-
A0A5M6CYN7      AQLI-N------NDSE-L----------DQVI-PSLKAVEDQEL--SQRIAELSDMQLY-
A0A369QP10      DQLI--------GRNTSL----------DQMI-PSLKELDDEQL--SNRISQLSNLQLD-
A0A126PDF2      SRMV-QQTHITRNEDETI----------EQSI-PGLGDINDPIL--SQLLSQLNGMQWE-
A0A2Z3GKA1      SRMVQQQTHITRNENETI----------EQSI-PGLGDINDPVL--SQLLSQLNGMQWD-
A0A502GZP7      ARVV-QQAHITRNENETI----------EQSI-PGLGDINDPLL--SQLLSQLNGMQWD-
A0A519SBU8      RRLM-DSEQLTRNDDETV----------ADNI-PGLAEIEDPIL--EKLLDQLDNEQRE-
A0A4Q3JNZ3      GRMM-NRDQLTRTDDETV----------ADNL-PGLIELADPVL--TGMLEQLDAQQRS-
A0A519Q9V3      SRLM-NRDQLTNNDDETV----------TDNL-PGLAELEDQVL--TGLLEQLDGQQRS-
A0A0M3RW20      ARLI-QRERITRDENVSV----------EQSV-PGLVTLEDPIL--TQQITELNLAQQD-
A0A495VFX4      ARSV-QREHITRDENTSV----------EQSV-PGLVTLEDPVL--TQQITELNLSQQD-
A0A1S9B3W0      TRLV-EQERLT-KDDETV----------EQSI-PGLAALEDPVL--SQQIGFLNEQQRE-
A0A1W1VRL3      SSLV-EQDQLTANEDSTV----------AQSI-PGLAELEDGRL--TQEIEALNDQQWD-
A0A1M6R305      AALA-EQGTITAREDLTV----------EESI-PALATIENPQL--SQQLTEVNSLQWN-
A0A4Z0PHK3      TRLV-EEDRLTQSEDATL----------EQSI-PGIAAFEDGQL--TGQLAELNNLQWN-
A0A2M9B9H9      SRLV-EQDRLTQNEDATL----------EQSI-PGIAAVEDAQL--TQQLSELNALQWN-
A0A4Z0QCY9      TRLV-EQDRLTANEDATL----------EQSI-PGIAAIEDNQL--TSQLTELNSLQWN-
A0A418R9X5      SRLV-EQERLTSRQDGDV----------MQTI-PALSTIEDAQL--TKRITELSDLQLD-
A0A428JSJ3      ARLV-EQERLTDREDGDV----------FQTI-PALSTIKDGQL--LQRITELSNLQLD-
A0A428KI59      ARLI-EQERLTDREDGDV----------FQTI-PALSTIKDGQL--TQRIIELSDLQLD-
W8F1I6          ARLI-EQERLTDREDGDV----------FQTI-PALSTIKDGQL--TQRIIELSDLQLD-
A0A246FQC0      ARLV-EQDRLTVRPDGDV----------MQSI-PALAEVKDGQL--VQRITELSDAQLD-
A0A372E5P8      GQLL-DREQLTTRADGDV----------MQSI-PALADVKDGQL--IQRITELSDAQLD-
A0A1H3EMW1      GRLL-QQEQLTTRADGDV----------MQSI-PALAEVKDGQL--VQRITELSDAQLD-
A0A1H9ZSN3      GQLL-DREQLTTRADGDV----------MQSI-PALAEVKDAQL--VQRITELSDAQLD-
A0A5N1J2M4      SALL-AKN-------THV----------DQII-PTLGSLQDQQL--SEKIKELGTLQTR-
A0A519S476      GRIM-ARDQLTRSDDETV----------AENL-PGLSEIEDESL--VSLLEELDTRQRR-
A0A4Q3JRW8      SRLM-NREQLTRNDDETV----------ADNL-PGLAELDDPTL--VALLDQLDGQQRQ-
A0A519M923      SRLM-NRDQMTRNDDETV----------AETL-PGLVELDDPVL--MGMLDQLDGQQRS-
A0A4Z0ENW1      SRLT-SAEYLTPSDEVTV----------DQTI-PGLALLEDPAL--SQQLNNLNILQQN-
A0A519UDB4      GRLA-SQELIMTNENSTL----------AESI-PGLAILNDGPI--TQQLNDLHILQQN-
A0A3S0QKV1      SRLV-QQERITSRDDETV----------EQSI-PGLALLEDPQL--TQLMSVLNEQQRD-
A0A328BL48      SRVV-ETERLIGSDELTV----------EESI-PGLAVLQDPQI--SQQLTVLNEQQRE-
A0A5R8WLY4      SRVV-EKDRVVGSDELTV----------EESI-PGLAVLQDPQI--SQQLTALNEQQRE-
A0A1I5WSL8      EVMA-RQDRLTRDETQTV----------EQSM-PAIVGIEDAQL--LQQLNELNNLQWN-
A0A0U3JVM7      AQMA-SQGSLTRDETQTV----------EQSI-PALAGIEDPQL--AQQLNELNDLQWQ-
A0A1G1SSV2      ANMA-NQDRLTRDETQTV----------EQSL-PALAGIEDAQL--GQELNQLNSLQWR-
A0A1G1SXV7      TNMA-NQERLTRDETQTV----------EQSL-PALAGIEDAQL--GQELNQLNSLQWR-
A0A6G8CBJ6      SRLV-EQDQITSNEDSTV----------AQSI-PGLAELEDNRL--IQEIEALNSQQWD-
A0A0W8EDI5      AQLV-EQNQVMVQEGDDI----------EQSI-PALAILEDAQL--TQQIGVLNDQQAD-
A0A3B7RBP8      ASLV-QQNRVLTREGETI----------EQSI-PALTVLEDAQL--SQQIALLNDQQAD-
A0A3R9P8H7      ARLI-EQDRLTDRADGDV----------LQSI-PALTDAKDGQL--VARIQELSDAQLD-
A0A238WIA7      SNQI-ESNQFVAREDVSA----------EQSI-PALAEIKAPEL--TERIGELYGLQLD-
A0A212UCJ7      NSQI-AQNRIVASEERSA----------EQSI-PALAELKAPEL--AARIGELYDLQLQ-
A0A4Z0MQE1      NSQI-EQNRIIAVEGRSA----------EQSI-PALAEVKAPEL--TERISELYGLQLE-
A0A4Z0PCF4      NGQI-EQNRFVAVEGVSA----------EQSI-PALAELKSPEL--TERVSELYGLQLD-
A0A6M6BED0      NGQI-EQNRFVAVEGVSA----------EQSI-PALAEIKAPEL--SERVSELYDLQLQ-
A0A5D6VDG1      ARLT-SRDRIARDENASI----------DQSV-PGLSQLEDPVL--TQQITELNAAQQD-
A0A6H1CVS0      ARLT-SRDRIARDENASI----------DQSV-PGLSQLEDPVL--TQQITELNAAQQD-
A0A243WHR7      VALV-ESNQLTNSEEASI----------SESI-PGLKQLGDEQV--TQQINRLNDLQWN-
A0A5B8A0P6      SRLV-EQERLTTSEDLTV----------EKSI-PGLALLEDPGL--TEQLTELNNQQYN-
A0A076HRT9      ADLA-ERGTITSREDLTV----------EQSI-PALATLENSQL--SQQLGELNDLQWN-
A0A4Z0PVM7      TNLV-EQGRLTESEDATL----------EQSI-PGISAIEDNQL--TSQLTELNSLQWN-
A0A1M6DHW8      ARLV-EQDRLIASDEATL----------EEGI-PGIALLDDSPL--TQQLSELNDLQRN-
A0A4Q5LC61      TRLV-EQDRLVASEEATL----------EESI-PGLATLEDSPL--TQQLEELNQLQQN-
A0A2N5YXE2      SEKI--EKD----PELKT----------YEIL-AMLSGQQSETFI-AGMINSLQELLNK-
K0XJ09          ERYL--T------DNENG----------KQLI-PNVSGVGDSGL--QNQITTYNEILLQ-
R5EUZ0          ERYL--T------DNEHS----------KQLI-PNVSGVGDSGL--QNQITTYNEILLQ-
W0EQS0          QKAF--S------GKENN----------KQLI-PNVSGVGDAGL--QSQIEAYNAMILQ-
A0A1Y3WE15      QRAF--A------NEKGD----------KQLI-PNVSGVGDAGL--QKQIESYNEMLLQ-
A0A1Y4GUK3      HRAF--T------NDKDN----------KQLI-PNVSGVGDAGL--QSQIEAYNEMLLQ-
A0A2U1FKU2      QAFL--R------QTNSD----------NELM-PANLGLTEQGI--DNSIAQYNELKLR-
A0A0A2F954      QSFL--R------QTSTD----------NELM-PANLGLTERGI--DNSITLYNELKLK-
A0A0A2FW91      QSFL--R------QTSTD----------NELM-PANLGLTERGI--DNSITLYNDLKLK-
A0A2D2N2N1      QSFL--R------QTSTD----------NELM-PANLGLTERGI--DNSITLYNELKLK-
Q7MWZ2          QSFL--R------QTSTD----------NELM-PANLGLTERGI--DNSITLYNELKLK-
T2NDT6          QSFL--R------QTSTD----------NELM-PANLGLTERGI--DNSITLYNELKLK-
W1R7P9          QSFL--R------QTSTD----------NELM-PANLGLTERGI--DNSITLYNELKLK-
A0A1R4AFZ0      QSFL--R------QTSTD----------NELM-PANLGLTERGI--DNSITLYNELKLK-
A0A1R4DVZ7      QSFL--R------QTSTD----------NELM-PANLGLTERGI--DNSITLYNELKLK-
A0A7C0WKI7      LNYL--KSQLGDRRESLE----------NDLS-QIA----------TPYIRQLRERIAEK
A0A2A8CVM9      RDQL--AQFEP--GLRET----------VQQE-QEASGLRSEISVLERKIGEMRAEAAQY
A0A5M4B212      EEYL--S------KNEDL----------ESLV-APTTVGINDPLL-VNLLQELSQLNIE-
A0A3D1KEX9      REYV--V------KNASN----------TNLI-PDLNLGDNGAM--QGQIGKYNDAVIQ-
A0A358Y7S2      QGKL--TSNP---NRLDI----------YKVI-PEMIGKKSFEGAVIRQIEELNDLLEK-
A0A1X7J248      QKQL--EKDTLSFDKINY----------LVLP-SNM----------QPLFEEFSELKEE-
E4TQD2          QSQL--DKDTLSFDKINY----------LVLP-SNM----------QPLFEEFSELKRD-
A0A2J6HHN3      ILSV--EN-----EENDV----------LFLI-SMLTGTESYTYL-SPYLTSLQDLEFK-
A0A1Y3WMT8      DSFM--N------SPENK----------YSLV-PITTGLPDRGA--AEAINEYNKLLLE-
A0A1Y4GQU1      DSFL--N------RPENK----------YSLV-PVTTGLPDKGA--AEAINEYNKLLLE-
A0A6A0R272      ENEL---------NQGKK----------LSEI-SINAEGNMDPTL-NQLITAFNNLKIQ-
A0A1V5W8T5      NKQI--AAG----KDFNA----------VELI-SILSGSSSESMV-LNFLNGIQQLQKQ-
A0A2T8HKA9      RDYI--Y------DAGRS----------EKLI-PSNMGLADLNV--DRYISDYNSALLR-
A0A2I0QZ80      KEKL--NSDP---NSNDV----------YRLI-PNIIGQSYEGSL-TKQIQELYELIER-
A0A3E1F1A3      KKKI--EGNP---NSLDV----------YRLI-PIIIGKSYESSL-NQQIQELYELIEE-
A0A2U2XBJ3      QDKL--EGNP---NSLDV----------YRLI-PVIIGKSYESSL-NSQIQELYNLIEE-
A0A4Q4KU94      ESKL--KGNP---NSLDV----------YRLI-PVIIGKSYESSL-SIQIQELYNLIEQ-
A0A3B8INU3      FSSV--IDSADIPDQSLL----------FPHL--------------NTALQEYGNLKVE-
A0A2W1NDY9      VEGI--NSK----NRVSI----------YNLI-PTLAGTRFQPLL-EGQIEKLYRLLED-
A0A5C8AQR5      SGKL--KAEP---NRLEI----------YKIL-PEMLGKSYESSL-SKQIEDLHQMLEK-
A0A1G0CI31      SSKL--RNDP---NRLEI----------YRLI-PEMLGKSFEISL-TRQITDLHALLQR-
A0A556N0M0      HSKL--KLEP---NRLDI----------YRLI-PEMLGKSYELSL-TKQITDLNTLLER-
F2IKD6          NSKL--KTEP---NRLDI----------YRLI-PEMLGKSYESSL-TKQITDLNTLLER-
A0A1I7BM74      KTEI--NNSP---RSTEV----------YKLL-PVLIEKSYQNAL-KDQIETLFSKLEQ-
A0A2G2FJ17      SLKL--KQSP---ESLDV----------YKLI-PELIGKSFEGSL-NLQVKELHELLET-
A0A2E3R1D0      LAAL--QSELSRLES-QL----------GTRL-SSNLDSELAAA--RERIQQLNAELEVF
A0A2T2USC0      LQSL--KEELANIRP-NL----------AERI-ASGLGEELSQV--QKEKAEVASEINAV
A0A2T2V0F3      LTSK--QEELANIRP-NL----------AERI-SSGLEEELSQV--QREKAQVTAEINAV
A0A2T2S682      LNTK--KKELKRIRP-RL----------AERL-SSGIQTELKQV--QQEKANVAAEINRV
D5H561          LESL--REELESIQPGQL----------SDQL-ASTVDQEISSL--QSEIAKLELSKQQL
A0A2H3NWA9      FNAQ--QDNIESIEP-QL----------AERL-ASNIDSELARV--QEERAELKQQLDQA
A0A2A8CVB6      LDEK--RSELEKIEP-QI----------SDRL-SSTTGDVLESV--QEEKARLQARIDQI
A0A2P6C1S6      LETQ--KEELGTIEP-KL----------AERL-SSSLGQRLSSL--QTEQAELESKIDRV
A0A2T2UTM4      LETR--KEELRQIEP-KL----------AERL-SSDLGEKLSTF--QTEKAELEVKIDRV
A0A414ZBF2      KDYL--Q------DNSKT----------AELI-PSSIGINDNGI--QNQINEYNTTLTK-
A0A1Q3Q573      KMLL---------QKTKD----------YSTL-PILQFKEEEMSI-AGEIENINQLQRS-
A0A662BAY3      REYI---------INNQE----------LETI-IAPSAMDIDDPLLNALILELNNLSIE-
A0A4U3L369      KEYL--Q------DERNN----------KRIV-PSNLVTSDPTF--TELVGKYNTLMIE-
A0A357YNR3      NDYV--Q------NINNH----------EQLI-PANSGINSQSL--NNQINSYNNLVLE-
A0A5E8AX52      QEQM--DKGE-------------------PLL-LANYNSRSLPEFISGSLTEYNKLFGE-
F4KK08          RGHL--K------DKNQM----------ESLI-PANVGIASPSI--EAAIAKYNEFLLK-
A0A6B5PK86      NQRM--NENS---NRLEI----------YRIL-PELLGKSYESAI-AGHIEALHLLLEE-
A0A2G2F510      HKMI--GSSP---NRLEV----------YKML-PEMLGKSYETSL-VKHIEELHLLLER-
A0A316JZ08      DNQL--ERAP---NRLEV----------FRMI-PEMLGKSYEASL-VTHITDLHDMLEQ-
A0A496LCF9      RNYL--K------SNIDR----------ESLA-SPATLGIQEPRL-IALVDKYNELQIK-
A0A5P2G2A9      LDYV--L------NTKNN----------QRPV-PSLLATPDPAL--ESILTQYNALVLQ-
A0A3C0ZQC7      LTSY--QEELAK-QEPNV----------AKAI-GEANDPYIRLLQEQLAMLEVRRDVTV-
A0A419VXB7      RGYI--G------EDGNM----------KNIV-FPSVVGITDVGL-NSMVVRLSELNSK-
A0A0B0BTJ4      GDIL---------NGKEE----------IGIL-PVNIGIENQAL--SNAINKYNELVLE-
A0A3B9CNN6      GDIL---------NGKEE----------IGIL-PVNIGIENQAL--SNAINKYNELVLE-
R5X290          GDIL---------NGKEE----------IGIL-PVNIGIENQAL--SNAINKYNELVLE-
A0A1Q6E6I7      GDIL---------NGKEE----------IGIL-PVNIGIENQAL--SNAINKYNELVLE-
C3J7R8          KDYL--K------SPSSK----------DELI-PANVGLNEASA--DNLIREYNSLLLR-
A0A1G8BVM8      KNYL--H------DNANK----------SELI-PGNLGINNSGI--ESQIARYNETMTL-
A0A1I1FXP9      RNTI--I------NNQDI----------RKII-PALKHINDQELV--DLAEALSDLQNQ-
A0A3N4H5N3      ENLI--NSQSSQ-GDLIP----------SSLV-SLDPAL-------GDLLTRYNDLQRD-
A0A2P8EAX2      ESLI--AVQGSG-NETIP----------SSFV-TLDPTL-------SELLSKYNDLLRE-
A0A4V2F6N9      ENLI--AVQGNG-NETIP----------SSFV-TLDPTL-------SDLLAKYNDLLRE-
A0A3B9FXJ0      LDYA--N------NNIED----------LDAL-SGYFGNLKFNNF-APYFNSLSELEKQ-
R5GSU5          EDFL--K------NNSKA----------DQVI-PVLNDMVDQGI--QQQITEYNKLVLE-
A0A2A3UE91      QANI--AKN----KNIDI----------YQLI-SLMSGTEYESVI-KDVTQNIQKLLSE-
A0A0A2G557      KEHL--T------NPSSA----------NGLI-PASSGLEDLAS--NSLIKEYNTLYLY-
A0A2N2WFW8      YNTF--ES-----GNSDF----------VVLL-SLLSGLESQVYL-APYLQSLKELEMK-
A0A1F3IU95      YKAF--SS-----GNADI----------ITLL-PLISGIESQVYL-SPYLQSLKDLEMR-
A0A3D0VUF6      YKAF--SS-----GNADI----------ITLL-PLISGIESQVYL-SPYLQSLKDLEMR-
A0A1T4PT95      KEHL--T------NPSTA----------GGLI-PASSGLEDLSS--NTLINEYNTLYLY-
A0A6I6JYY3      RDYV--GNN-------QE----------LETL-IAPSAMGINDPLLNSLILQLNDLITQ-
A0A2A4PYG9      ADMI--KKK----DDIDV----------YNLL-PALTGSSFQDEI-SDLVQSLHKLLAK-
A0A1F3K695      QEQI--NSK----ANLNI----------FELI-ALLSGTKSGNVI-EGILNTLQSLITQ-
A0A353KZR1      QEQI--NSK----ANLNI----------FELI-ALLSGTKSGNVI-EGILNTLQSLITQ-
A0A2N2WYB5      STQV--NVD----NELNI----------YELI-ALLSGTKSEAIL-VSVLNNLQQLISE-
A0A1F3K4G0      NQQV--AND----HDLNI----------YELI-ATLSGTKSETIV-VNVLNNLQELINK-
A0A356H8Y3      NQQV--AND----HDLNI----------YELI-ATLSGTKSETIV-VNVLNNLQELINK-
A0A351HSA6      NQQV--AND----HDLNI----------YELI-ATLSGTKSETIV-VNVLNNLQELINK-
A0A1F3Q014      ETTL--SNS----KNIDT----------YTLI-AMLAGTTTESNI-TSAVEALHKLLIQ-
A0A2D5KD44      KKQI--KEGG---EQIDI----------YEFL-PILVGSQFESSI-SSLIEQLNDLLLK-
A0A6N9NIX1      YNQI--NVDP---EKIDV----------YQIL-PILMGSDFQKSL-EGLMSELNFLLIE-
A0A2A4YXP3      KKSI--SLNN---DDIDV----------YDLL-PILAGTDYAGGI-MSLITSLKEFLIQ-
A0A1F3R158      NNSV--KGKI---KDINV----------YNLL-PILSGTEYEIRI-TTLITDLQTLLLQ-
A0A2M8ADX2      NNSV--KGKI---KEINV----------YNLL-PILAGTEYEIRI-TSLITDLQSLLIQ-
A0A1J5B2H0      EITF--NAS----ENVDI----------YKLI-ATIAGSEFQGII-SSLLNNLQDLLLK-
A0A1V5N756      EEFV--NQS----KDLDV----------YELY-ALVAGSQFQSSV-SGNLQAIQNLLMQ-
A0A651GU15      EKVA--LANP---EETDI----------YALI-PLIVGTRLENSL-SGLITDLREILLR-
A0A3Q9FR88      RHFL--EAD-------SS----------IVYI-QAYATILTDGSI-SSSLDELAKLETE-
A0A553GEX3      RHFL--EAD-------SS----------IVYI-QAYATILTDGSI-SSSLDELAKLETE-
A0A150ADJ9      RHFL--EAD-------SS----------IVYI-QAYATILTDGSI-ASNLSELAKLEVQ-
A0A1B1FWQ4      RTLL--QAD-------SS----------IVYI-QAYATILTDGSI-SSSLDELAKLETE-
A0A1S1Z228      RHFL--EAD-------SS----------IVYI-QAYATILTDGSI-SSSLSELAKLETE-
A1ZKR2          DDLV--N------KQGDL----------SEFL-PTLTTPIQGLGQLQPLISKLNQLQEN-
A0A1Q3GX01      ENLM--E------QDKEL----------VLYL-PETSAGLQGLTQ---IMNQINKLQEE-
A0A349DQI4      ENLI--A------EDKEL----------VLYL-PENTSGLQSLTE---ILKKISKLQED-
A0A4P5TMD1      LGYF--N------LYKDS----------SKLL-LGIVDQKYVGL--QSYVEALDKLQSD-
A0A2N3IIZ0      EIFV--NQRF---VDSKN----------IPLM-PDVDGAI------LQQISELNRLRQI-
A0A1F3SJM1      DQKL--NAKV---SRLNV----------YRMI-PEMLGKSYETAL-VGHIESLHTLLEK-
A0A2G2EB96      KQKL--SKTP---NRLEV----------YKLL-PELLGRSYERAL-EGHLNQLHDFLER-
A0A2G6PRA9      KRKL--SKSP---NRLEV----------YKLL-PELLGRSYEASL-AGHLRELHEFLER-
A0A497D5Z2      RDYI---------RNNQH----------LGNV-IAPSAMGIDDPLLNSLIAELNTLIVE-
A0A662B170      RDYI---------RNNQH----------LGNV-IAPSAMGIDDPLLNSLIAELNTLIVE-
A0A2A5FYT6      EKKI--TANE---KEIDP----------YTII-PVLTGTHFEKNI-SRQINSLHQLLIK-
A0A2E6SYP1      QLKL--SENP---SNEEL----------YSIL-LLNSTNKYL----SSVGTSLKQLLAK-
A0A2E5RLE8      YSAI--SNKI---NHEEL----------YSIL-LLNSKNQYI----STTSSRLRNLLSE-
A0A2E7TQF6      YSAI--SNKI---NHEEL----------YSIL-LLNSKNQYI----STTSSRLRNLLSE-
A0A2E6GVY9      YSSI--SNKI---SHEEL----------YSVL-LLNSKNQYI----STTASRLRKLLSD-
A0A350JJ90      RGGI--QIEK---TGVDI----------YNLL-PVLAGTEFENSV-KGQIEELQNLVLT-
A0A3M1CDV2      LNNI--QTQ----KNIDL----------YQLI-SLASGTSYEESI-KNITSNIQKLLLE-
A0A6C1QGZ7      EKSL--QFE----DEADI----------FRLI-AILSGSEFRGNI-SGMLRTLQDQLLD-
A0A4P5U6G4      QDYF--N------RYEDS----------TRLF-SGIVDVQFSAL--QEFVRMLDKLQAD-
A0A2E2TFD1      KQAA--TSSS---DSVEV----------HQLI-PLLTGTQFEDNL-LQQIAYLQELQIE-
A0A2E4ELE6      KAAS--DGEK---DSVDV----------YDLL-PLLAGTQFEIGI-KKQIQFLHELLLE-
A0A522EYA6      EKSI--EGK----KEVDS----------YQLV-SLLTGIEFESAL-NNQINSLQELLKS-
A0A2E3XZI5      DLMF--DENLSSKITTSS----------IKNI-SLLTNIFYEDELIKIMITQLQEDVLK-
A0A6I7QXV0      ENYI--SGQ----EDLSS----------IPKG-INIANLEQY----THYLEAISDLEKE-
A0A2M7NLQ9      STLL--EDD--------S----------TLLV-ALTYSSMLKDTNLKNRIEKVYDEEKE-
I4AFR0          STLL--END--------S----------TLLI-ALTYSTILKEPSLKIRLEEVYEEEKE-
A0A2N2Y3E5      LDYL--KK-----KDLSA----------VELI-AIIPQNLNSSVL-TSILSEIQSLIKE-
A0A2D9D7T6      KSKI--TPNP---DRIQI----------YKLI-PEMLGKKNLEANVIKQVEELNALLEK-
A0A1F3PPL5      KSEV--AEN----KNIDV----------YELI-ALLSGTKSEGYI-SNILESIQQKNDQ-
A0A357QK06      KSEV--AEN----KNIDV----------YELI-ALLSGTKSEGYI-SNILESIQQKNDQ-
A0A662AEA4      QKQI--VKG----KDSNI----------YEII-AILSGTKFDGVI-VNVLNNLQKLISK-
A0A0S2HYK8      KTQL--ETN----QQLNT----------YEMI-ATLAGTNSEKVL-VSILTNLQNLINE-
A0A2N5ZWN6      NDQL--KKQ----GQINI----------YEMI-ATLAGTSSEKVL-VNILSNLQQLINE-
A0A2E0FJ09      ATVI--TDNP---LELDI----------YNVL-PILIGSEFESNL-YTLISVLHKKLML-
A0A1F3FZ62      EKNF--SSI----KDLDV----------YKLI-AFISGTEVNKIV-KGNLDAIQSILLQ-
A0A1F3K211      EKNF--SSI----KDLDV----------YKLI-AFISGTEVNKIV-KGNLDAIQSILLQ-
A0A1V6I2U9      LDKL--KSN----PEINT----------YELL-AMLSGQKSEVFL-SSMINSLQELLNR-
A0A2H0B957      LDEI--SKT----PNINA----------YNLI-SLLPLK--DNNILLSLLNQIQNLITQ-
A0A1F3CFW6      LDEI--SKT----PNIKV----------YDLI-SLLPSK--NDGILISLLNQMQNLINQ-
A0A2M7E2T8      LDEI--SKT----PNIKV----------YDLI-SLLPSK--NDGILISLLNQMQNLINQ-
A0A2M7NC69      LDEI--SKT----PNIKV----------YDLI-SLLPSK--NDGILISLLNQMQNLINQ-
A0A1F3KLL5      EKQL--SAG----ENLKY----------YDLY-SLLSGTKSENVV-SRLLEEINKLEND-
A0A359D1M1      EKQL--SAG----ENLKY----------YDLY-SLLSGTKSENVV-SRLLEEINKLEND-
A0A0F2NS19      SKSV--TGKI---NTIDI----------YNLL-PTLTGTEYEASI-TALITNLQNLMVQ-
A0A2A5H8X6      SKSV--TGKI---NTIDV----------YNLL-PTLTGTEYEASI-TALITNLQSLMVQ-
A0A2H0GAU8      SKSV--SGKL---NTIDV----------YNLM-PTLTGTEYEASI-SALITNLQGLLVQ-
A0A2M8FTK1      SKSV--SGKL---NTIDV----------YNLM-PTLTGTEYEASI-SALITNLQGLLVQ-
A0A2A5B3B0      KTSI--SSND---KDIDV----------YELL-PILAGTEYAGGI-MSLITTLKELLFR-
A0A5C6RXM7      SSSI--ESEL---KNVDV----------YKLL-SILAGTDYSSGI-TSLVTELKRLLLL-
A0A1F3C1M2      NEYV--NKN----SNLNI----------LDLI-AILSGT-KSEGLIVSILNKLQDLINQ-
A0A1F3DS87      NEYV--NKN----SNLNI----------LDLI-AILSGT-KSEGLIVSILNKLQDLINQ-
A0A6A0R6K9      KKEI--DKN---GENIDI----------YKLL-PLLIASTYDNSL-KQLVDNLNQELIH-
A0A2E7CT70      QEMF--QSTLSKKISSNS----------IKSL-S-LSKIFYDNLVIQNMIESLEKNVIK-
A0A2D5V560      SDMF--ENXLSTEINSTS----------MKNI-SLLTAIFYNESLTSKMIEQLQEDVNK-
A0A2D7K5A8      SNMF--ENNLSTEINSSS----------VKNI-SLLTTIFYGESLTSKMIDQLEKDVIQ-
A0A2E1XQ82      SNMF--ENNLSTEINSSS----------VKNI-SLLTTIFYGESLTSKMIAQLEEDVNQ-
A0A5C8A5B4      LSKI--------RSSSDL----------RNVPAPSSSG-I-DDPVLNNLVIEITKLSAD-
A0A4Y9ITE2      RELM--------NDPNHR----------YDLI-PTPYG-A-EAAV--DAIAEYNKLILE-
A0A5M8NYX7      KNYL--------SNPDNK----------NNGA-PANVG-I-TDPMVISLMNAYNTEIFE-
A0A3D5KRY6      KYYL--------ENRDQN----------KDLVFPSIEQ-L-TDPALIETVKKLNGLYSN-
A0A0E3V905      QKYI--------EGKGDT----------RGNT-PAVVG-L-SDPVLLSLINNLTQLEQQ-
A0A553ETH6      KIFL--------KNLEAD----------KVS--EVNYE-Q-LPRFIGENIRLLNELFLE-
A0A640Q161      RNDV--------SLDDIA---------------RLPEV-L-NHPTIRDVRRDEAKAMTR-
A0A640QU49      RNDV--------SLNDIA---------------RLPEV-L-NHPTIRDVRRDEAKAMTR-
A0A1Q3PII2      AAHL--------RAKPTM----------AI---PSALY-P-REDNFADLVTKYNDMLLS-
A0A351BXT2      KSEI--------ERMDPT----------LVNF--LQGK-V-DELYLTEIQSKIAELESQ-
A0A2K8Z965      QKYV--------ETKSEN----------RGNTPPAVVG-L-NDPVLLGLITNLTTLEQQ-
A0A418M8U8      QRYI--------NNRSLD----------RGAT-PALVG-L-NDPVLFSLIEKLTQLDLQ-
I2GTA4          QRYI--------NNRSLD----------RSAT-PALVG-L-NDPVLFSLIEKLTQLDLQ-
A0A2K8ZAJ2      ERYV--------QSHSGR----------KGVA-PATLG-L-SEPILTSLLTKAAELELK-
A0A368JPA3      EKYV--------RSKGEN----------RGVL-PTTLK-F-SDPTLTALIGKLTELETQ-
A0A5N1JI29      EKYV--------RSKGEN----------RGVL-PTTLK-F-SDPTLTALIGKLTELETQ-
A0A3P1BT12      EKYI--------RAKGEN----------RGML-PATLK-F-NDPALTSLISKLNDLEQQ-
A0A3P1CI15      EKYI--------RSKKDN----------RAAL-PATLK-F-NDPTLTSLLGKLTDLEVQ-
A0A4R8CUK1      EQYI--------REEGTH----------YCSL-PAMLD-F-SDPAVTAFVTKIQDLERQ-
A0A3D0MYJ7      RRKI--------SEISPE-----------VDL-YVNSQ-A-NQSKFTTISNEIASLEVK-
A0A662AH13      KAEI--------DKKNPT-----------LSK-YIENY-A-STPRMLALQEAIGNYELQ-
A0A5C7QA01      -----------------------------------------------------IELKQQ-
A0A3D3LS70      KSEL--------EKLDPQ-----------LIT-YVESQ-I-SQSYVEEIQKTIANVEAE-
A0A1G1TM36      ERYL--------RNPQPA-----------ATV-PTTLG-I-TDEALNNLVGRLTSLQLQ-
A0A1G7ZF38      EAHL--------RE-KSA-----------TAI-PSALY-P-QESNFAAMVSKYNETQLA-
C6VS52          EDHL--------RK-SPS-----------TAI-PSLLY-P-QESNFSALASTFNEMQLN-
A0A7C1LGX3      KNSV--------VGQAAF-----------ELL-PVDVG-L-ENSGLNSMVDRYNDQVLQ-
A0A2A4G4B1      KKSV--------LEGG------------IQLL-PTNIG-L-DHSGVKETIDNFNQLILE-
A0A0P7X1V8      LEAY--------QQELDR------------LT-PGLSE-Q-LTASIAPRINQLQVFLAD-
A0A6P1P355      EQYV--------VLKSNS----------GGMA-PSTLG-I-KDPALTQLLQKLYDSEIE-
A0A5C8KAD6      EKFV--------VSRNSS----------TGSI-PSTLG-I-NDPILSDLLQKLQNLEIQ-
A0A5N1J695      ENYV--------ISKNKA----------TGIV-PSTLG-V-NDPVLEQLLQKLYNAETQ-
A0A3B0C2S4      KNAV--------LGQSA-----------YGLL-PVDVG-L-ENSGINSLVAEYNEMAIE-
A0A3N2M1H3      KDFL--------DDSANK----------FNII-PANTG-L-DNPSIEKDIATYNTILLA-
A0A4S2G8T2      KDFL--------DDSANK----------FNII-PANTG-L-DNPSIEKDIATYNTILLA-
A0A212K7W5      LSHL--------KDSRTK----------DMLL-PANLG-I-EGTNIDRQINEYNTLLLK-
F5IU11          LSHL--------KNPRTK----------DILL-PANLG-I-EGANIEGQINEYNTLLLK-
A0A7C1QWC7      LDYF--------NTNKDI----------AGLA-PPSAANV-VDPIMNTLVLELLDLNAQ-
A0A352Z1R7      LDAL--------NSTLRK----------GNIY-SPAIM-R-DDPLVAGLATKLSELEIQ-
A0A3N2N6F7      IDYM--------QSPANK----------GKLL-PGNLG-I-ENQGIVAQITEYNNLQLE-
A0A4P7VVU7      LDYI--------KNPDTN----------GQLV-PANAG-L-ENPGIEAQINEFNQLQLE-
A0A2V1ILM4      LDYI--------KNPDTN----------GQLV-PANAG-L-ENPGIEAQINEFNQLQLE-
A0A3N2L0E8      LDYI--------KNPDTN----------GQLV-PANAG-L-ENPGIEAQINEFNQLQLE-
A0A3N2LFC5      LDYI--------KNPDTN----------GQLV-PANAG-L-ENPGIEAQINEFNQLQLE-
A0A0A2F501      RQHL--------GTDTNA----------TQLI-PAISG-I-GNKLIDQQIGEYNQKMLE-
R5B7P0          KDYI--------GKEDNR----------NQPL-PANMG-L-SSQTIENGISEYNSKILQ-
R5B0L5          RNYL--------GSESSR----------NQPL-PVNVG-S-GSPAIESQIAQYNDAMLE-
A0A6I1TEC0      RSSL--------VGRVSK----------NQVL-PSNTG-I-DSPGIEQQIAEYNKTLLE-
A0A3R5XWG1      RSSL--------VGRVSK----------NQVL-PSNTG-I-DSPGIEQQIAEYNKTLLE-
A0A5P0Y910      RSSL--------VGRVSK----------NQVL-PSNTG-I-DSPGIEQQIAEYNKTLLE-
A0A414YFM3      RSSL--------VGRVSK----------NQVL-PSNTG-I-DSPGIEQQIAEYNKTLLE-
A0A6A7UIA7      RSSL--------VGRVSK----------NQVL-PSNTG-I-DSPGIEQQIAEYNKTLLE-
A0A6A7VPS3      RSSL--------VGRVSK----------NQVL-PSNTG-I-DSPGIEQQIAEYNKTLLE-
A0A374THP7      RNYL--------TGKVGK----------NQLL-PSNTG-I-ESPGIEQQIAEYNKSQLE-
A0A6G1VND1      RNYL--------TGKVGK----------NQLL-PSNTG-I-ESPGIEQQIAEYNKSQLE-
A0A0A2EVS5      RGHI---------TGGQG----------RELL-PVNSG-I-NSPVIEREISEYNETLLQ-
A0A1T4NAJ7      RGHI---------TGGQG----------RELL-PVNSG-I-NSPVIEREISEYNETLLQ-
A0A255T941      RHEL---------TSKSI----------DQTL-PTNSG-I-ANANIETQINNYNNMVLD-
A0A3N2KCL3      KSYL--------GAASDN----------EKML-PMNSG-V-ANVDIQSQITDYNNLVLQ-
A0A4P7VSV0      KSYL--------GAASDN----------EKML-PMNSG-V-ANVDIQSQITDYNNLVLQ-
A0A2V1IJY1      KSYL--------GAASDN----------EKML-PMNSG-V-ANVDIQSQITDYNNLVLQ-
A0A4P7VXK7      KSYL--------GAASDN----------EKML-PMNSG-V-ANVDIQSQITDYNNLVLQ-
A0A1Y4CHN5      KSYL--------AAGESQ----------NQLL-PANSG-I-SGGNIENQISEYNTAQLQ-
A0A1M6I2S6      RREL---------NNKEL----------SQLL-PTNSG-I-ANVNIESQIGEYNTMVLD-
A0A1Y3V692      RREL---------NNKEL----------SQLL-PTNSG-I-ANVNIESQIGEYNTMVLD-
F3PXM2          RGEL---------NGKGL----------TQLL-PANSD-I-GNSHIESLIGEYNAQVLE-
A0A174AHH7      RREL---------NSKDM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A174JCE8      RREL---------NSKDM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A3E4JMC4      RREL---------NSKDM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A412SND6      RREL---------NSKDM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A414IEQ9      RREL---------NSKDM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A6I0U0V8      RREL---------NSKDM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A6L5S9H7      RREL---------NSKDM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A0M1W8D8      RREL---------NSKDM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A3R6GKX5      RREL---------NSKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKIVLD-
A7V4S1          RREL---------NSKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKIVLD-
B0NU19          RREL---------NSKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKIVLD-
D4V601          RREL---------NSKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKIVLD-
A0A4Q0U3M9      RREL---------NSKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKIVLD-
A0A4R4H1Q2      RREL---------NSKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKIVLD-
A0A6I0GII7      RREL---------NSKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKIVLD-
A0A6I0KYU7      RREL---------NSKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKIVLD-
A0A397WLT5      RREL---------NSKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKIVLD-
A0A6A2J529      RREL---------NSKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKIVLD-
A0A6L6P8N9      RREL---------NSKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKIVLD-
A0A6N8DDD8      RREL---------NSKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKIVLD-
A0A015XH67      RREL---------GGKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A078RZN2      RREL---------GGKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A4R4I3T9      RREL---------GGKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A6L0K5          RREL---------GGKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A7ACT5          RREL---------GGKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A6KY94          RREL---------GGKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A173UQR8      RREL---------GGKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A3R6HK75      RREL---------GGKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A412B7D1      RREL---------GGKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A412VNY9      RREL---------GGKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A414LTU9      RREL---------GGKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
I9Q4U4          RREL---------GGKEM----------NQPL-PTNSG-I-ANVNIESQIGEYNKMVLD-
A0A373ISF0      LKEL---------KEKSL----------SQPL-PTNSG-I-ANSNIESQISEYNNMVLN-
U6RF62          LKEL---------KEKSL----------SQPL-PTNSG-I-ANSNIENQISEYNNMVLN-
A0A662ZZD5      RKEL---------NNKKL----------SQLL-PTNSG-I-ANVNIESQIGEYNTIVLE-
A0A3A5TI83      RKEL---------NNKKL----------SQLL-PTNSG-I-ANVNIESQIGEYNTIVLE-
A0A415NEB6      RKEL---------NNKKL----------SQLL-PTNSG-I-ANVNIESQIGEYNTIVLE-
A0A6I0I238      RKEL---------NNKKL----------SQLL-PTNSG-I-ANVNIESQIGEYNTIVLE-
A7AJ60          RKEL---------NNKKL----------SQLL-PTNSG-I-ANVNIESQIGEYNTIVLE-
A0A6A2JF01      RKEL---------NNKKL----------SQLL-PTNSG-I-ANVNIESQIGEYNTIVLE-
A0A6I0Y2Y2      RKEL---------NNKKL----------SQLL-PTNSG-I-ANVNIESQIGEYNTIVLE-
A0A6I2Q447      RKEL---------NNKKL----------SQLL-PTNSG-I-ANVNIESQIGEYNTIVLE-
A0A395YYT3      RKEL---------NNKKL----------SQLL-PTNSG-I-ANVNIESQIGEYNTIVLE-
A0A015UXN7      RKEL---------NNKKL----------SQLL-PTNSG-I-ANVNIESQIGEYNTIVLE-
A0A5M5W148      RKEL---------NNKKL----------SQLL-PTNSG-I-ANVNIESQIGEYNTIVLE-
A0A6I2NTL0      RKEL---------NNKKL----------SQLL-PTNSG-I-ANVNIESQIGEYNTIVLE-
A0A016E4F9      RKEL---------NNKEL----------DQLL-PTNSG-I-ANVNIESQIGEYNTMVLD-
A0A4Q5CFJ7      RKEL---------NNKEL----------GQLL-PTNSG-I-ANVNIESQIGEYNTMVLD-
A0A6N3HG44      RKEL---------NNKEL----------GQLL-PTNSG-I-ANVNIESQIGEYNTMVLD-
A0A6H9P0U9      RREL---------NTKQL----------DQTL-PANSG-I-VSANIETQISEYNNLVLD-
A0A108TH71      RREL---------NTKQL----------DQTL-PANSG-I-VSANIETQISEYNNLVLD-
I8VXH0          RREL---------NTKQL----------DQTL-PANSG-I-VSANIETQISEYNNLVLD-
A0A412S0N6      RREL---------NTKQL----------DQTL-PANSG-I-VSANIETQISEYNNLVLD-
A0A412IIJ0      RREL---------NTKQL----------DQTL-PANSG-I-VSANIETQISEYNNLVLD-
A0A0P0FM97      RREL---------NTKQL----------DQTL-PANSG-I-VSANIETQISEYNNLVLD-
R6KTP3          RREL---------NTKQL----------DQTL-PANSG-I-VSANIETQISEYNNLVLD-
A0A139LU87      RREL---------NTKQL----------DQTL-PANSG-I-VSANIETQISEYNNLVLD-
A0A1C6B3Y5      RREL---------NTKQL----------DQTL-PANSG-I-VSANIETQISEYNNLVLD-
A0A6L3KCD1      RREL---------NTKQL----------DQTL-PANSG-I-VSANIETQISEYNNLVLD-
E2NMQ4          RREL---------NTKQL----------DQTL-PANSG-I-VSANIETQISEYNNLVLD-
A0A412YDB9      RREL---------NTKQL----------NQTL-PTNSG-I-VSANIETQISEYNNLVLD-
R7DY01          RREL---------NTKQL----------NQTL-PTNSG-I-VSANIETQISEYNNLVLD-
A0A414LGK8      RREL---------NTKQL----------NQTL-PTNSG-I-VSANIETQISEYNNLVLD-
A0A415IPQ4      RREL---------NAKQP----------DQPL-PTNSG-I-VNANIETLISEYNNLVLD-
A0A3E5BRW7      RREL---------NAKLL----------DQPL-PANSG-I-VNANIETLIGEYNNLVLD-
K9DXS6          RREL---------NAKLL----------DQPL-PANSG-I-VNANIETLIGEYNNLVLD-
A0A1M6KFV3      RREL---------NSKQL----------NQPL-PANSG-I-VNANIETLISEYNNLVLD-
A0A1Q6G7L3      RREL---------NSKQL----------NQPL-PANSG-I-VNANIETLISEYNNLVLD-
A0A413H235      RREL---------NSKQL----------NQPL-PANSG-I-VNANIETLISEYNNLVLD-
A0A1M5B2J8      RNYL--------TSETNR----------FQLL-PANSG-I-DNPNIASQINEYNNQLLE-
A0A255RCT5      RNYL--------TSETNR----------FQLL-PANSG-I-DNANIGSQITEYNNQLLE-
A0A1Y4GLF5      RNYL--------ANDANK----------SQLL-PANSG-I-DNGNIESQISEYNRQLLQ-
A0A1H3XSC0      RNYL--------TNDANK----------NQLL-PANSG-I-ESANIESQIAEYNRQLLQ-
A6LE40          RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A4Y1VPX5      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6N2XMM4      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
B3JI46          RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A358R8U0      RNYL--------SDENNR----------TQLL-PANSG-I-ESTNIESQISEYNTKLLQ-
R6WSB6          RNYL--------SDENNR----------TQLL-PANSG-I-ESTNIESQISEYNTKLLQ-
A0A401LPX7      KNYL--------TDENNK----------YQLL-PANSG-I-ENASLSTQLNEYNTKLLE-
A0A6G0GNY9      KNYL--------TNENNK----------HQLL-PANSS-I-ENASLATQLNEYNTKLLE-
A0A6I1BFM0      KNYL--------TNENNK----------HQLL-PANSS-I-ENASLATQLNEYNTKLLE-
A0A3A5Z900      KNYL--------TNENNK----------HQLL-PANSG-I-ENANLATQLNEYNTKLLE-
A0A285TGL6      KNYL--------TNENNK----------HQLL-PANSG-I-ENASLATQLNEYNTKLLE-
A0A3A5RFX4      KNYL--------TNENNK----------HQLL-PANSG-I-ENASLATQLNEYNTKLLE-
A0A1Q6IUW9      KNYL--------TNENNK----------HQLL-PANSG-I-ENASLATQLNEYNTKLLE-
A0A413XDP6      KNYL--------TNENNK----------HQLL-PANSG-I-ENASLATQLNEYNTKLLE-
A0A6N8CVT6      KNYL--------TNENNK----------HQLL-PANSG-I-ENASLATQLNEYNTKLLE-
K6AP24          KNYL--------TNENNK----------HQLL-PANSG-I-ENASLATQLNEYNTKLLE-
A0A6I2NHV3      KNYL--------TNENNK----------HQLL-PANSG-I-ENASLATQLNEYNTKLLE-
A0A662ZYI7      KNYL--------TNENNK----------HQLL-PANSG-I-ENASLATQLNEYNTKLLE-
A0A078RYI7      KNYL--------TNENNK----------HQLL-PANSG-I-ENASLATQLNEYNTKLLE-
C7XEQ8          KNYL--------TNENNK----------HQLL-PANSG-I-ENASLATQLNEYNTKLLE-
D7INX6          KNYL--------TNENNK----------HQLL-PANSG-I-ENASLATQLNEYNTKLLE-
K5ZG55          KNYL--------TNENNK----------HQLL-PANSG-I-ENASLATQLNEYNTKLLE-
A0A3N2N9B8      RNYL--------TAESSR----------NQLL-PANSG-L-VG-DIASQVGEYNDLLLQ-
A0A3N2NMI0      RTYL--------TAEDSR----------NQLL-PANSG-L-VG-DIAKQVSEYNEMLLQ-
A0A359I8H7      RDYL--------NNPGNA----------KSVI-PVNTG-I-GSPTLEAQISNYNNLLLT-
A0A3N2KA63      RDYL--------NNPGNA----------KSVI-PVNTG-I-GSPTLEAQISNYNNLLLT-
A0A4Q0IMT7      RDYL--------NNPGNA----------KSVI-PVNTG-I-GSPTLEAQISNYNNLLLT-
A0A3B9FAU3      KGML--------TRGAKS----------RKLL-PTNAG-L-ESTGIEQQIAEYNTLLLQ-
A0A3C1E5L7      KGML--------TRGAKS----------RKLL-PTNAG-L-ESTGIEQQIAEYNTLLLQ-
A0A4Q0UAV1      RREV--------QN-ASL----------DQPL-PNPAG-I-EGTTVESQIAEYNTIVRE-
A0A354SN68      KEYL--------SNVKNR----------NQLL-PVNSG-I-GNEGIEGLINDYNAQILQ-
A0A6L5XFL0      RKQM--------SEGAYK------------IL-PANTG-I-DNTVLSQQIGSYNEKVLQ-
A0A3N2N595      RNYL--------SADNDN----------TKLL-PIPSE-V-ENVDVKSQLTNYNDLILQ-
A0A0A2DUD9      RNLL--------KN-LDK----------SRLL-PVNSF-V-NNPSLEQQIGEFNDLLLK-
A0A3P1ZBJ5      SQML--------TNEKNK----------FDLL-PANSG-I-NSSSVEALIGDYNGNILQ-
R5FHS9          LSYI--------TNPKQR----------NHVL-PANFG-L-TDQNIEQQIESYNKDLIE-
A0A413TW79      RDFL--------TGKVGK----------NQLL-PANIG-I-DSPGIEQQITEYNKQQLE-
A0A3E5E9M7      RDFL--------TGKVGK----------NQLL-PANIG-I-DSPGIEQQITEYNKQQLE-
A0A3E4SK73      RDFL--------TGKVGK----------NQLL-PANIG-I-DSPGIEQQITEYNKQQLE-
A0A415GGC6      RDFL--------TGKVGK----------NQLL-PANIG-I-DSPGIEQQITEYNKQQLE-
A0A413DBH9      RDFL--------TGKVGK----------NQLL-PANIG-I-DSPGIEQQITEYNKQQLE-
A0A1Y4PQK7      RNYL--------ATTAGQ----------NQLL-PANSG-L-ENVGIEKQISEYNTLQLQ-
A0A1Y4IH41      RNYL--------ATTAEQ----------NQLL-PANSG-L-ENVGIEKQISEYNTLQLQ-
A0A3A6AAP4      RNYL--------ATTAEQ----------NQLL-PANSG-L-ENVGIEKQISEYNTLQLQ-
A0A6I0ZRD2      RNYL--------ATTAEQ----------NQLL-PANSG-L-ENVGIEKQISEYNTLQLQ-
A0A1Y4DYA7      RNYL--------TNNNNK----------NQLL-PANSG-I-ESSGIENQILDYNTLQLQ-
A0A1Y3X4I9      RNYL--------TGGNSR----------NQLL-PANSG-I-ESSGIEKQIADYNALQLQ-
A0A1Y4FNK8      RNYL--------TNATSK----------NQLL-PANSG-I-ESPGIEQQIANYNTAQLR-
A0A355FD59      RNYL--------TGPAYT----------NQLL-PANSG-I-ENSGIESQISEYNTLQLQ-
A0A359CEZ9      RNYL--------TGPAYT----------NQLL-PANSG-I-ENSGIESQISEYNTLQLQ-
A0A353Q7B4      RNYL--------TGPAYT----------NQLL-PANSG-I-ENSGIESQISEYNTLQLQ-
F8X3A5          RNHL--------MTSTNN----------NQLI-PANSG-I-ESASVENQITEYNTIQLQ-
A0A1M3KVR9      RNHL--------MTSTNN----------NQLI-PANSG-I-ESASVENQITEYNTIQLQ-
A0A4Y9IJS3      RNHL--------MTSTNN----------NQLI-PANSG-I-ESASVENQITEYNTIQLQ-
A0A495WI87      RNYL--------GGESNK----------YQLL-PANSG-I-ENSNLGDQITEYNNKLLQ-
A0A354M4S6      RNYL--------GGESNK----------YQLL-PANSG-I-ENSNLGDQITEYNNKLLQ-
R7DH52          RNYL--------GGESNK----------YQLL-PANSG-I-ENSNLGDQITEYNNKLLQ-
A0A4Q5E7L5      RNYL--------TNDANR----------TQLL-PANSG-I-ENANIESQITEYNKQLLQ-
A0A4P8LP09      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A4R4GZU7      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A016CWA4      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A1C6H117      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A0M1W0V2      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A139KA16      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A174VQ92      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A1Q6HCG0      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A1Y4JYM9      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3A5QW67      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3A5RQE6      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3A6BP07      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3E5E153      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3Q9IP20      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A412WV15      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A413ICP6      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A414KYB9      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A5B3FWR2      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6L4P3V7      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
E5WX00          RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
K0X3P3          RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A415TAH7      RNYL--------SNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A078T2W6      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6I1AQV4      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A5C6L2P1      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A412MJT7      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3E4WKT5      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3A5YY33      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A078TAH2      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A1E9CFZ7      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A373FYU5      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3A5TZ72      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3A5XBP2      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3A6MEG9      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3E4JP35      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3E4KP40      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3E4NX82      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3E4XFU8      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A412RG70      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A412TD37      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A413GAA4      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A414M7I4      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A496BTA0      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A496D2V6      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A4Q5G1P5      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A5C6KCA6      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A5M5AHM5      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6I0KZV6      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6I0Y5K7      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6I1BFB8      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6I2P5W5      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6N8DC51      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
E5UZA2          RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A069SMG6      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6A2RTB3      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6I0VY00      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A1M4YZ07      RNYL--------TNDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A0P0FQW1      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A5M5C0W6      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A6I0H151      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A642LZ22      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A6I0HI59      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A642NJ89      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A6I0HI52      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A6L3JTQ2      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A6L4EED9      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A6I0YVB5      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A6L5RHE2      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A6N3AEV2      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A6L3KG29      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A6G0G4T5      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A6I0HFG9      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A4Q5E5M7      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
A0A6L4F5W0      RNYL--------ANDANR----------TQLL-PANSG-I-ESVNIESQIAEYNKQLLQ-
C3RFN5          RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3A5Z014      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6I0ING7      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6L5S265      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A078S3Q8      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A069SJV7      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3E5DXI5      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3E5EM98      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3E5F453      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A6N2YYD4      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
I9T3G6          RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A3E4SYU0      RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A6LGY1          RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
K5ZSH4          RNYL--------ANDANR----------TQLL-PANSG-I-ESANIESQIAEYNKQLLQ-
A0A1H4ADG3      IEYM--------HSQNGN----------DRVV-PASLT-I-NDGSLSAIIDNYNKLLLQ-
A0A5B8VUR8      IGYM---------SQNGN----------DRVI-PASLT-I-NDGNLNTIIDSYNKLLLQ-
A0A0D3L8Q3      EDYL--------RREGNE----------VGIV-PSTLS-I-TDHTLNRLIERYNELQLE-
A0A2N3U785      EDYL--------TKSKNK----------SILV-PSTLN-I-KDPTLQDLISRFNELQLE-
A0A5B6TJH8      EKYL--------SQDKGE----------YRMV-PSSLG-I-QDQTLMSLIGKFNELQLE-
A0A519U664      ESYL--------RKNTGQ----------YSIV-PSSLG-L-KDETLLGLIGKF-------
A0A519MA34      EGYL--------RKNAGQ----------YSIV-PSSLG-L-KDETLLGLIGKFNELQVT-
A0A519UCX0      ESYL--------RKNAGQ----------YSIV-PSTLG-L-KDETLLVLIAKFNELQAT-
A0A0E3ZG78      ESYL--------NKDENQ----------YKMV-PSTLS-I-QDVTLMGLIARFNELQLD-
A0A1I6BRK6      ENYL--------KNNNN------------SIV-PNSLG-I-KDETLAKLIGRFNEVELE-
A0A243WAB1      ENYL--------KRTNGQ----------YSMV-PSTLG-I-KDETLLGLIGKFNELQLE-
A0A6G8C8X6      ETYL--------RKTSGQ----------YSMV-PSSLG-I-QDPTLMSLITKFNELQLE-
A0A416GA42      KEFL--------LQPKND----------KSLI-PVNIG-V-SETNLVNQIAEYNKMRLQ-
A0A1T3IYP5      RSYL--------SAKGKQ----------NNLI-PNNTG-L-VDASVENQIAEYNTTLLK-
A0A1T5K9D4      RDYV--------RGSMDS----------FEVI-PANTG-L-NDANLDQAISQYNDLVIK-
A0A077ENE7      RSYL--------MNKGKQ----------NNLI-PNNTG-L-VDSGVEGQIAEYNKALLK-
A0A6I5UW06      RSYL--------MNKGKQ----------NNLI-PNNTG-L-VDSGVEGQIAEYNKALLK-
T0NN57          RSYL--------VNKNKR----------NDLI-PNNTG-L-VDASVEGQIAEYNMALLK-
X5K347          RSYL--------VNKNKR----------NDLI-PNNTG-L-VDASVEGQIAEYNMALLK-
A0A060RD97      KDYL--------LDPINA----------NALI-PRVSG-A-QNLGVDSQIDSYNELRLK-
A0A3C1ITV0      REYL--------VDNTRQ----------YDLL-PSNSG-V-GSQAIEEQIAEYNKRLLE-
R7HN19          REYL--------VDNTRQ----------YDLL-PSNSG-V-GSQAIEEQIAEYNKKLLE-
A0A350IHV0      KEYL--------KDPQHD----------GALI-PSNLG-L-DSKTVDSQITEYNQMVLT-
R5RVP0          KEYL--------ENPAHS----------GALI-PANSG-L-TSTTVEAQIKEYNSLVLN-
R6A0L2          DEYL--------HTHSNS----------HDLI-PA-LN-V-GDASFNTQIAAYNDQMNK-
R7LG80          YNYL--------DNQTND----------RDLI-PA-LS-L-KDASFNTTIDKYNQLQMQ-
A0A2L2WX98      TQYL--------QNSSKR----------NETV-PV-LS-L-PEASFTPLIGEYNNQMLE-
A0A6N8KXI9      RDYL--------RSAERT----------KDLI-PNNTG-L-VDANVESQINEYNNILLK-
G5GD56          QEFL--------QNNSNE----------HQII-PA-IN-L-ERATFNGQIDTYNQLMNE-
R5KD55          RDYI--------TNRANT----------NQLL-PANMG-L-DDGKTDGLIDKYNALQLE-
A0A174QNT3      KKYV--------TDKSKS----------ADLI-PNVSG-V-GDAGVQTQIEDYNEMMLQ-
A0A4S2FGS1      KNYV--------TDKTRS----------SDLI-PNVSG-V-GDVGVQSQIESYNEMMLQ-
R9I0H0          KNYV--------TDKTRS----------SDLI-PNVSG-V-GDVGVQSQIESYNEMMLQ-
K5BUT9          KSYL--------ADVTRK----------DQLI-PNVTG-V-GDVSMQSQITAYNELMLQ-
A0A174FPA3      KTYL--------ADVTRK----------DQLI-PNVTG-V-GDVSMQSQITAYNELMLQ-
R6S9Y6          KTYL--------ADVTRK----------DQLI-PNVTG-V-GDVSMQSQITAYNELMLQ-
A0A642LIH6      KTYL--------ADVTRK----------DQLI-PNVTG-V-GDVSMQSQITAYNELMLQ-
C9KX15          KTYL--------ADVTRK----------DQLI-PNVTG-V-GDVSMQSQITAYNELMLQ-
A0A6H0KRK1      KSYL--------LDATRN----------NQLI-PNVSG-V-GDASVQSQITAYNELMLQ-
R6DAG6          KSYL--------LDATRN----------NQLI-PNVSG-V-GDASVQSQITAYNELMLQ-
A0A3L8AAP1      KSYL--------LDATRN----------NQLI-PNVSG-V-GDASVQSQITAYNELMLQ-
A0A4S2AYX2      KSYL--------LDATRN----------NQLI-PNVSG-V-GDASVQSQITAYNELMLQ-
A0A4Y9H477      KSYL--------LDATRN----------NQLI-PNVSG-V-GDASVQSQITAYNELMLQ-
A0A0E2M2Y7      QSFL--------RQTSTD----------NELM-PANLG-L-TERGIDNSITLYNDLKLK-
A0A0K2J6Z0      QSFL--------RQTSTD----------NELM-PANLG-L-TERGIDNSITLYNDLKLK-
B2RKZ8          QSFL--------RQTSTD----------NELM-PANLG-L-TERGIDNSITLYNDLKLK-
A0A212GC82      QSFL--------RQTSTD----------NELM-PANLG-L-TERGIDNSITLYNDLKLK-
A0A254MU12      QSFL--------RQTSTD----------NELM-PANLG-L-TERGIDNSITLYNDLKLK-
R6CQ93          KEYL--------TDPTKS----------RDLI-PSGTG-I-SDASVEGQINQYNSLKLK-
A0A3D1NQW3      KEYL--------LDPTKT----------NELI-PGTLS-I-NSPAINSQIEGYNTELQR-
B0MT10          KEYL--------LDPTKT----------NELI-PGTLS-I-NSPAINSQIEGYNTELQR-
R7JGW9          KEYL--------LDPTKT----------NELI-PGTLS-I-NSPAINSQIEGYNTELQR-
A0A3D2BF46      RDYL--------LNDTKL----------RDLI-PANVA-I-TNVSISDQIKNYNELMLR-
A0A358R538      SDYL--------RDPAHA----------GELI-PMAAS-V-ASETVAAQIDRYNEAILT-
A0A1Y4AAB8      RSYL--------LDREHA----------GDLI-PAMAA-I-ANSGITEQISAYNEGILR-
A0A1Y3WWY9      RSYL--------SDPSKA----------GELI-PAMAS-V-TNAAVSAQIDEYNTSILQ-
A0A1Y4U5L4      RSYL--------SDPSKA----------GELI-PAMAS-V-TNAAVSAQIDEYNTAILQ-
A0A1Y3VCJ1      RGYL--------ADPAKS----------GELI-PAMAA-I-SNGAVTAQIDEYNATILQ-
A0A1Y3QTW7      RDYL--------NNPTHA----------GELI-PMVAS-L-TNNGIVAQITEYNDAILR-
R6XWY7          RDYL--------NNPTHA----------GELI-PMVAS-L-TNNGIVAQITEYNDAILR-
A0A4Y1X9Y9      RDYL--------DDPSHA----------GDLI-PMVAS-L-TNNGIVAQITEYNDAILR-
A0A4Y1WM66      RDYL--------DDPSHA----------GDLI-PMVAS-L-TNNGIVAQITEYNDAILR-
A0A6N4GYT3      RDYL--------DDPSHA----------GDLI-PMVAS-L-TNNGIVAQITEYNDAILR-
A0A174AVF1      RDYL--------DDPSHA----------GDLI-PMVAS-L-TNNGIVAQITEYNDAILR-
A0A656Q4F4      RDYL--------DDPSHA----------GDLI-PMVAS-L-TNNGIVAQITEYNDAILR-
A0A1Q6EIY0      REYL--------NDPSHA----------GDLI-PMVAS-M-TNNGIVAQISEYNEAILR-
A0A5B5VN71      REYL--------NDPSHA----------GDLI-PMVAS-M-TNNGIVAQISEYNEAILR-
E4M8L3          REYL--------NDPSHA----------GDLI-PMVAS-M-TNNGIVAQISEYNEAILR-
I3YQ50          REYL--------NDPSHA----------GDLI-PMVAS-M-TNNGIVAQISEYNEAILR-
R5UEY8          REYL--------NDPSHA----------GDLI-PMVAS-M-TNNGIVAQISEYNEAILR-
A0A1H4D866      RTYL--------NDPKNA----------GELI-PMMAS-V-TNQGISSQIADYNNAILR-
A0A5B3G4Y7      RTYL--------NDPKNV----------GELI-PAMAA-AGTNTAIAKQIEDYNSAILR-
A0A374A9J5      RTYL--------NDPKNV----------GELI-PAMAA-AGTNTAIAKQIEDYNSAILR-
A0A5B3GQN5      RTYL--------NDPKNV----------GELI-PAMAA-AGTNTAIAKQIEDYNSAILR-
A0A1Q6E9S3      RTYL--------NDPKNV----------GELI-PAMAA-AGTNTAIAKQIEDYNSAILR-
D4IJ36          RTYL--------NDPKNV----------GELI-PAMAA-AGTNTAIAKQIEDYNSAILR-
A0A414Q925      KEYL--------QDNSKT----------TELV-PASIG-I-DDMGVQNLIMEYNTVLTR-
A0A415PUS9      KEYL--------QDNSKT----------TELV-PASIG-I-DDMGVQNLIMEYNTVLTR-
A0A108TCU0      KEYL--------QDNSKT----------TEPV-PASIG-I-DDMGVQNLIMEYNTVLTR-
A0A413BA42      KEYL--------QDNSKT----------TEPV-PASIG-I-DDMGVQNLIMEYNTVLTR-
S3Y344          KEYL--------QDNSKT----------TEPV-PASIG-I-DDMGVQNLIMEYNTVLTR-
A0A4Q5G8Y8      KEYL--------QDNSKT----------TEPV-PASIG-I-DDMGVQNLIMEYNTVLTR-
A0A412TGL3      KEYL--------QDNSKT----------TEPV-PASIG-I-DDMGVQNLIMEYNTVLTR-
A0A413VJ33      KEYL--------QDNSKT----------TEPV-PASIG-I-DDMGVQNLIMEYNTVLTR-
A0A414L0W6      KEYL--------QDNSKT----------TEPV-PASIG-I-DDMGVQNLIMEYNTVLTR-
A0A412DP39      KEYL--------QDNSKT----------TEPV-PASIG-I-DDMGVQNLIMEYNTVLTR-
A0A413ZSE8      KEYL--------QDNSKT----------TEPV-PASIG-I-DDMGVQNLIMEYNTVLTR-
B0NP84          KEYL--------QDNSKT----------TEPV-PASIG-I-DDMGVQNLIMEYNTVLTR-
R6AK43          KEYL--------QDNSKT----------TEPV-PASIG-I-DDMGVQNLIMEYNTVLTR-
A0A412N2D9      KEYL--------QDNSKT----------TDPI-PASIG-I-DDMGVQNLIMEYNTVLTR-
A0A1Y4JYS9      KEYL--------QDNSKT----------TDPI-PASIG-I-DDMGVQNLIMEYNTVLTR-
R6LHA4          KEYL--------QDNSKT----------TDPI-PASIG-I-DDMGVQNLIMEYNTVLTR-
A0A3E5HPT8      KQYL--------QDSNKD----------DELI-PSNIG-L-SDLSIESQISRYNETLLR-
C6IJ48          KQYL--------QDSNKD----------DELI-PSNIG-L-SDLSIESQISRYNETLLR-
Q8A3U2          KQYL--------QDSNKD----------DELI-PSNIG-L-SDLSIESQISRYNETLLR-
A0A3R6S1H6      KEYL--------HDPQHE----------RDLI-PSNTG-I-PDVNIEQSIGKYNEMLLK-
A0A3R6SD81      KEYL--------HDPQHE----------RDLI-PSNTG-I-PDVNIEQSIGKYNEMLLK-
A0A354WXN6      KEYL--------IDPSHN----------ADLI-PANTG-V--DVNVESDISEYNTMLLK-
R5IP14          KDYL--------SDPVKI----------NDLI-PANTG-I-ESAEISGAISEYNQLLLK-
A0A316SZX7      KEYL--------SDEKHV----------SELL-PANTG-V-ADLGINEQIKEYNTLLLN-
A0A1Y4AIY1      RDYL--------SDPQKA----------LDLI-PANT--I-TDVTVEQQIAAYNEMLLK-
A0A0J6CIR2      RDYL--------TDPHKS----------SDLI-PANTG-I-ADVNIEGQISEYNNLLLK-
A0A3D8HG59      RSYL--------VDPSKE----------AELI-PANTG-I-SDSNVESQIGEYNALLLK-
A0A3R6S408      RSYL--------VDPSKE----------AELI-PANTG-I-SDSNVESQIGEYNALLLK-
F3ZRU7          KDYL--------IDPANR----------GKLI-PANTG-I-SDNTTEGQIKEYNTMLLQ-
A0A1C5Q1F3      RDYL--------ADPAKS----------GELI-PSNTG-I-SDGTIERQIMEYNELMLQ-
R7A239          RDYL--------ADPAKS----------GELI-PSNTG-I-SDGTIERQIMEYNELMLQ-
A0A3R6HIK7      RDYL--------SDPQKA----------LELI-PANT--I-TDMKVEQQISTYNEMLLK-
K5ZVW7          RDYL--------SDPQKA----------LELI-PANT--I-TDMKVEQQISTYNEMLLK-
A0A1Y4D5Z0      REYL--------SDPHKA----------SDLL-PANT--L-SDVNIEQQIAEYNTQLLK-
A0A413VXJ7      KDYL--------VDPQKN----------ADLI-PANTG-I-SDNSVESQISEYNEMLLK-
I9RSN9          KDYL--------VDPQKN----------ADLI-PANTG-I-SDNSVESQISEYNEMLLK-
U6RJK5          KDYL--------VDPQKN----------ADLI-PANTG-I-SDNSVESQISEYNEMLLK-
A0A1Q6GA32      KDYL--------VDPQKN----------ADLI-PANTG-I-SDNSVESQISEYNEMLLK-
I9RPU6          KEYL--------TDPQKN----------SDLI-PANTG-I-SDNSVEAQIKEYNDILLK-
I8YFS5          KEYL--------VDPQKS----------SDLI-PANTG-I-SDTSVEAQIKEYNDMLLK-
A0A6L3FCC6      KEYL--------VDPQKG----------SDLI-PANTG-I-SDNSVESQIKEYNDMLLK-
I8Y597          KEYL--------VDPQKG----------SDLI-PANTG-I-SDNSVESQIKEYNDMLLK-
A0A1Q6GBF5      KEYL--------TDPLKN----------SDLI-PANTG-I-SDNSVESQIKEYNDILLK-
I8YFZ3          KEYL--------TDPQKN----------SDLI-PANTG-I-SDNSVESQIKEYNDILLK-
A0A1Q6GDH2      KEYL--------TDPQKN----------SDLI-PANTG-I-SDNSVESQIKEYNDILLK-
U6RSB0          KEYL--------TDPQKS----------SDLI-PANTG-I-SDNSVESQIKEYNDILLK-
I9SIK1          KEYL--------TDPQKS----------SDLI-PANTG-I-SDNSVESQIKEYNDVLLK-
I9GXM2          KEYL--------TDPQKS----------SDLI-PANTG-I-SDNSVEFQIKEYNDILLK-
I9TP59          KEYL--------TDPQKS----------SDLI-PANTG-I-SDNSVESQIKEYNDILLK-
R5S343          REYL--------TDTRTR----------GKLI-PANTG-L-TDMNMEGRIGEYNELLLK-
A0A1M6K7I9      KQYL--------VDPSKV----------ADLI-PANTG-I-TDAGVEKQIAEYNEILLK-
A0A5M6A8C8      KQYL--------VDPSKI----------ADLI-PANTG-I-TDAGVEKQIAEYNEILLK-
A0A6L3FBE6      KEYL--------VDPQKN----------SDLI-PANTG-I-SDNSVESQIKEYNDMLLK-
A0A6L3FNG1      KEYL--------IDPQKN----------SDLI-PANTG-I-SDNSVEAQIKEYNDMLLK-
A0A3R5ZMK1      KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A6L6NFJ9      KNYL--------TDPGKS----------SELI-PANTG-I-SDVNIESQIGEYNEMLLK-
A0A1Y3ZIA4      KNYL--------TDPGKN----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
K5Y1A4          KNYL--------TDPGKN----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A4Q5CIT0      KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A6L6NWL9      KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A3R6K8X4      KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A6N8D6C8      KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A3R6BKI7      KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A6N8CW60      KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A412M2W1      KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
K5ZX55          KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A415BDM7      KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A6L6MX19      KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A1Q6I3T6      KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A414XX40      KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A7AEU7          KNYL--------TDPGKS----------SDLI-PANTG-I-SDVNIESQIGEFNEMLLK-
A0A5F0U645      REYL--------TDPHKG----------ADLI-PANTG-I-SDVSLESQISEYNTLLLK-
K5ZBN2          REYL--------TDPHKG----------ADLI-PANTG-I-SDVSLESQISEYNTLLLK-
A0A0J6CKW3      REYL--------TDPHKG----------ADLI-PANTG-I-SDVSLESQISEYNTLLLK-
A0A0F5IQM7      REYL--------TDPHKG----------ADLI-PANTG-I-SDVSLESQISEYNTLLLK-
A0A496CDT3      REYL--------TDPHKG----------ADLI-PANTG-I-SDVSLESQISEYNTLLLK-
A0A6G1ZKM3      REYL--------TDPHKG----------ADLI-PANTG-I-SDVSLESQISEYNTLLLK-
S0GLB0          REYL--------TDPHKG----------ADLI-PANTG-I-SDVSLESQISEYNTLLLK-
A0A3R6NLC1      REYL--------TDPHKG----------ADLI-PANTG-I-SDANVESQISEYNALLLK-
A0A416WYC9      REYL--------TDPHKG----------ADLI-PANTG-I-SDANVESQISEYNALLLK-
A0A0F5IT40      RDYL--------TDPHKS----------SDLI-PANTG-I-ADVNIEGQISEYNNLLLK-
A0A496CX20      RDYL--------TDPHKS----------SDLI-PANTG-I-ADVNIEGQISEYNNLLLK-
A0A5F0UBI0      RDYL--------TDPHKS----------SDLI-PANTG-I-ADVNIEGQISEYNNLLLK-
A0A6G1ZHG0      RDYL--------TDPHKS----------SDLI-PANTG-I-ADVNIEGQISEYNNLLLK-
S0GSI7          RDYL--------TDPHKS----------SDLI-PANTG-I-ADVNIEGQISEYNNLLLK-
K5YB65          RDYL--------TDPHKS----------SDLI-PANTG-I-ADVNIEGQISEYNNLLLK-
A0A0F5IWP9      RDYL--------IDPHKS----------SDLI-PANTG-I-ADVNIEGQISEYNNLLLK-
A0A0F5IZT8      RDYL--------IDPHKS----------SDLI-PANTG-I-ADVNIEGQISEYNNLLLK-
A0A417LKQ2      RDYL--------TDPHKS----------SDLI-PANTG-I-ADVNIEGQISEYNNLLLK-
A0A416TME1      RDYL--------TDPHKS----------ADLI-PANTG-I-ADVNIEGQISEYNNLLLK-
A0A416XPE8      RDYL--------TDPHKS----------ADLI-PANTG-I-ADVNIEGQISEYNNLLLK-
L8JI02          SESL--------AEGRFG----------DVVA-PSTFG-L-EDPLLSSLLIELSKLNQE-
A0A4Q5WS95      EQYV--------SAKQRD----------GSLV-PSTLG-I-DDPLLSGLLEKLYQADLE-
A0A501VZX6      ENYV--------IAKEKA----------RGIV-PSTLG-L-NDAVLSQLLQKLYNAEIE-
A0A399SH26      ENYI--------IAKDKS----------AGIV-PSTLG-I-NDPVLTQLLQKLYDNEIQ-
A0A501W1A9      ESYV--------KAKNNT----------AGIV-PATLG-V-NDPVLSQLLQKLYDAEIQ-
A0A0E3ZGV6      ERYV--------VRKNKD----------LGIV-PSTLG-V-SDPVLSQLLQKLYNSEIQ-
A0A1I2N4S1      EKYV--------LSKEEN----------IGIV-PSTLG-V-SDPVLSQLLQKLYEAEIQ-
A0A2T5YE44      EKYV--------LSKEQN----------IGIV-PSTLG-V-SDPVLSQLLQKLYNAEIQ-
A0A1M5BA90      EKYV--------LSKNNQ----------IGIV-PSVVG-V-KDPLLSSLLQKLYDSQMQ-
A0A512B879      EKYV--------QAKDSQ----------IGIV-PSIAG-L-KDPLLAQLLQRYYDAQMQ-
A0A559PPI3      ENYI--------LSKDGG----------GSIV-PSTLG-I-DDPVLTQLLQKLYNSEIE-
A0A1T5CS78      ENYV--------ISKGSA----------GGMV-PSTLG-I-SDPILSQLIEKLYNLEVD-
A0A0Q9Z8F1      ENYV--------ISKGSA----------GGMV-PSTLG-I-SDPILSQLIEKLYNLEVE-
A0A2N0U0M7      ENYV--------ISKGSA----------GGMV-PSTLG-I-SDPILSQLIEKLYNLEVE-
A0A1V9FHD0      ERYA--------NSKDNN----------TETV-PSTMD-I-PDPVLTDLMQKMYTAKVE-
A0A4V4H170      ERYV--------NSNENN----------GNIV-PATLG-I-SDPVLSELMQKMYNAKVE-
A0A1V9F098      ERYV--------NSKENK----------GDII-PATIG-I-SDPVLTELMQKLYNGKLE-
A0A4R2VU64      ERFV--------SSKDNN----------ADML-PATMG-I-TDPLLTDMMGKLNNAKVE-
A0A4S8HY23      ERYV--------KSNENK----------GDVV-PATLG-I-SDPVLGELMQRMYNAKVE-
A0A1V9F383      ENYV--------TSRSNK----------GDLV-PATLG-I-TDPVLSDLMQKLYNKKVE-
G8TRZ6          ENYV--------NQKSNT----------GDLI-PSTLG-I-ADPILSDLMSKLYSKRVE-
A0A4R5DL69      QAFI--------KKNPNGIIP-------------SSIV-L-QSSDFTLLTDKYNTVQLS-
A0A1M4YED3      ERYV--------TSRNNK----------DGVA-PATLG-L-NDRGLTSLVERLAEAEAN-
A0A2H3NSN0      LDML--------VNQLNEAESSFRSDVEGE----QSVQ-S-MQNRIAALDQQIADLEAQ-
A0A2P6C324      LSIL--------EDQMERAQPSLRSAVLKE----QEVQ-S-LRTQIQALEDQIAELKAR-
A0A7C2DZI7      LQFI--------ERELQKLEPGLVNELVKS----RQVS-T-LEAQIDALSRKIAELRVQ-
A0A1M6XHU0      LQFI--------EQELQKLEPGLVNELVKS----RQVA-T-LEAQIDALSKKIAELKVQ-
G2SF81          LQFI--------EQELQKLEPGLVDELVKS----RQVS-T-LEAQIDALSKKIAELKVQ-
A0A5S9EYW1      LQFI--------EQELQKLEPGLVDELVKS----RQVS-T-LEAQIDALSKKIAELKVQ-
D0MHQ9          LQFI--------EQELQKLEPGLVDELVKS----RQVS-T-LEAQIDALSKKIAELKVQ-
A0A126PFG0      ---------------VSTIERTLRDPRPTATV-PTALG-I-TDATLSSLVEKLTELHAQ-
A0A3M1N7Z3      LNAF--------SEKLRRVLDTLRQDPAAEVA-FLPLG-A-LPEVQVPLTE-LNQLLEQ-
                                                                            

A0A1T5MMH4      ------------QERLKL----------SYNE-NTLAY----------------REKQQE
A0A2W4R1L8      ------------FDRLKL----------SYSE-VTFAF----------------REREQQ
A0A2E5CV79      ------------NAMIYG-------------E-NHSAV----------------IEIQKR
A0A2D4ZVH1      ETNKL-------LYLTKNP---------GISE-NNPEI----------------ARIENE
A0A0K8QSK7      ------------KSRLGNV---------RVS----PRL----------------NQINAQ
A0A1V6CN82      ------------KSKMSDV---------LIS----PRL----------------TQLNDQ
A0A1M4XZ45      ------------KSSQTSI---------RKGS-EHPTI----------------LRLNAQ
A0A399D319      ------------KSSQTSI---------KRGS-QHPII----------------LQLNAQ
A0A1V5IPN7      ------------IARLRTN---------ENYSENHPQM----------------KLLQEE
A0A1M6GR99      ------------KDNLIQ----------NNQQ-RNPIV----------------NRLDIQ
A6EBM4          ------------KEELLK----------VYNG-DAQAV----------------MRLNRQ
A0A7C5M4P4      ------------RERLGL----------SYRQ-NTYTY----------------RARQKE
A0A1M6TTV4      ------------RMLKLE----------SYNE-NTQVI----------------QRLNQR
A0A4Q8RX32      ------------KRHLIE----------NRQD-KSPQL----------------RELNFQ
K0X1U5          ------------RMRLLR----------TAKD-SNLAL----------------RTLTAQ
R5EXK3          ------------RMRLLR----------TAKD-SNLAL----------------RTLTAQ
A0A401UAP7      ------------INELKL----------SYKE-STFAY----------------QELQRD
A0A1W2GF52      ------------RALKLN----------SYNE-NTQVI----------------KRLDQQ
A0A2G5L7B8      ------------RLLKLD----------TYNE-NTQII----------------KQLNSR
A0A523GAC0      ------------RELLKI----------SYHK-NTFAV----------------IKVDQE
L8JW09          ------------RDKLRL----------SYNE-TTFAL----------------TRKEEE
A0A364XUP5      ------------QEKLKL----------SYNE-TTFAY----------------RELEKE
A0A1M5RLA9      ------------QEKLKL----------SYNE-ATFAY----------------RQRQKD
A0A385SFR9      ------------QEKLKL----------SYKE-VTFAY----------------RQRQKD
A0A5M4A9J4      ------------LTTLET----------TVIDKNHPTL----------------QQLRSQ
A0A5M4B1C7      ------------LKTLKT----------AVIDPNHPSV----------------IQLRTQ
A0A0D3LFR6      ------------KEVLLE----------HYNE-NTQAA----------------QMKIKQ
M7N6D4          ------------KEILLA----------SQNE-NTQAV----------------QLRNKK
A0A4D7K1D4      ------------RLQLLE----------KYNE-NTYAV----------------RKLNNE
A0A5C7MX19      ------------RNLVLL----------DVTP-DHPKV----------------RLLDKQ
A0A1Q3ZMZ7      ------------RDILLN----------KVQK-SNPEI----------------TIKEKQ
A0A2D8JJW3      ------------EQEIGK------------------------------------NDIPKS
A0A2W2AFF7      ------------RERMLM----------STTE-ENPMV----------------RNMDQQ
R7PCR1          ------------KKNLEQ----------NST--NSPVI----------------RDMNEA
A0A1G9E2A9      ------------QSTLLV----------STKP-TTQAY----------------QFGVTE
A0A098LL25      ------------RNRLLN----------SQRE-NTLVV----------------KTKNKS
A0A6J4H627      ------------RAMLAT----------TTRE-TTFAF----------------QTKDKQ
A0A6C0GJI1      ------------KALALA----------SSKS-TTFAI----------------QSKNQA
A0A2T2YJE8      ------------RNLMVQ----------SYKT-TTKAY----------------QLLEEE
A0A127B287      ------------RRKVLT----------TTRG-NTLSV----------------ELLDQQ
A0A6P1P2P6      ------------RRKVLT----------TARG-NTLSV----------------GLLDQQ
A0A3M9N829      ------------SRTARM----------TSRG-NTAAD----------------NLREEQ
A0A0P0CSF9      ------------QRTRRL----------TSRG-NTLAD----------------NSLEER
A0A5M8QQB8      ------------IRTQSM----------TSRG-NTTAE----------------KLAEEQ
A0A3M9MNC3      ------------QRTRKL----------TSRG-NTLAD----------------NALEER
A0A5B6TAX2      ------------LRTVRL----------TSRG-NTTAD----------------NALEEK
A0A5N1IQ33      ------------LNRLLE----------SYRP-TTTAV----------------QLKQEA
A0A512AYT3      ------------YKLLKR----------SYKD-STEAV----------------RRYQKE
A0A5M6CYN7      ------------YKLLLR----------SYKP-ETEAV----------------KRAQKE
A0A369QP10      ------------RSLMMQ----------SYKT-TTKAY----------------QLLEEE
A0A126PDF2      ------------QERIRR----------SYTG-ATEAV----------------QQKNAQ
A0A2Z3GKA1      ------------QERIRR----------SYTG-ATEAV----------------QQKNAQ
A0A502GZP7      ------------QERVSR----------SYTG-ATEAM----------------QQKNAL
A0A519SBU8      ------------LRLTLK----------SQTD-KTFAV----------------QRNQAI
A0A4Q3JNZ3      ------------LRLTLK----------SQTD-QTFAV----------------QRDEAV
A0A519Q9V3      ------------LRLTLK----------SQTD-KTFAV----------------QRDQAI
A0A0M3RW20      ------------LRRVLR----------SSTE-ATEAV----------------QQRKAA
A0A495VFX4      ------------LRRVLR----------SNTE-ATEAV----------------QQRKAA
A0A1S9B3W0      ------------MRKVLQ----------SYQPNATTAV----------------RIKEDQ
A0A1W1VRL3      ------------LRRVLR----------SYKE-TTEAV----------------KQRRVQ
A0A1M6R305      ------------LRRLSR----------SYKE-TTEAV----------------QQQREA
A0A4Z0PHK3      ------------LRRLLR----------SYNE-TTEAV----------------KQQQAA
A0A2M9B9H9      ------------LRRLLR----------SYNE-TTEAV----------------KQQQAQ
A0A4Z0QCY9      ------------LRRLLR----------SYNE-TTEAV----------------KQQQAA
A0A418R9X5      ------------LSQLLK----------SYQE-TTTAV----------------KLRRAE
A0A428JSJ3      ------------LSQLLK----------SYQE-TTTAV----------------KLRRSE
A0A428KI59      ------------LSQLLK----------SYQE-TTTAV----------------KLRRSE
W8F1I6          ------------LSQLLK----------SYQE-TTTAV----------------KLRRSE
A0A246FQC0      ------------LKRALL----------SYQPGATLAM----------------QTKEQN
A0A372E5P8      ------------LKRALL----------SYQPGATVAM----------------QIKEQS
A0A1H3EMW1      ------------LKRALL----------SYQPGATVAM----------------QIKEQS
A0A1H9ZSN3      ------------LKRALL----------SYQPGATLAM----------------QTKEQS
A0A5N1J2M4      ------------REVVLA----------SNQP-GTFAV----------------TSIETQ
A0A519S476      ------------LRLTLK----------SQTD-KTTAV----------------QLQQAE
A0A4Q3JRW8      ------------LRLTLK----------SQTD-KTFAV----------------QRNQAL
A0A519M923      ------------LRLTLK----------SQTD-KTLAV----------------QRNEAI
A0A4Z0ENW1      ------------LRRIRR----------SYQD-RLEAV----------------QGPLTQ
A0A519UDB4      ------------LRRVER----------SYTD-KTEAL----------------SQLRAQ
A0A3S0QKV1      ------------MRKILE----------SYQPNATAAV----------------RIREDQ
A0A328BL48      ------------LRQVLQ----------SYQP-TTTAV----------------QIRQSQ
A0A5R8WLY4      ------------LRQVLQ----------SYQP-TTTAV----------------QIRQSQ
A0A1I5WSL8      ------------LRRISR----------SYTD-KTETV----------------QRTKAD
A0A0U3JVM7      ------------LRRASR----------SYTD-KTEAI----------------QSKQAN
A0A1G1SSV2      ------------LRRVSR----------SYNE-STEAV----------------QGIRDD
A0A1G1SXV7      ------------LRRVSR----------SYNE-STEAI----------------QGIRDD
A0A6G8CBJ6      ------------LRRVLR----------SYKE-TTEAV----------------KQRRVQ
A0A0W8EDI5      ------------MNRLLE----------SYKP-TTTAV----------------QIRREQ
A0A3B7RBP8      ------------LNRVLE----------SYKS-TTTAV----------------QIKQEQ
A0A3R9P8H7      ------------LKRALL----------SYQPGATTAM----------------QTKEQF
A0A238WIA7      ------------LNRASV----------GYKP-TTTAI----------------QVIQDQ
A0A212UCJ7      ------------INRVSN----------SYTP-ETQTI----------------KNLQGQ
A0A4Z0MQE1      ------------INRISN----------SYTP-ATQAI----------------KNLQDQ
A0A4Z0PCF4      ------------INRISN----------SYTP-ETQTI----------------KNLQQQ
A0A6M6BED0      ------------INRISN----------SYTP-ETQTI----------------KNLQQQ
A0A5D6VDG1      ------------LRRVLR----------SNTE-ATEAV----------------QLRRAN
A0A6H1CVS0      ------------LRRVLR----------SNTE-ATEAV----------------QLRRAN
A0A243WHR7      ------------LRRILR----------SYQP-TTFTV----------------QQLQAD
A0A5B8A0P6      ------------LQRLLR----------SYKE-TTEAV----------------KQQESM
A0A076HRT9      ------------LRRLLR----------SYKE-TTEAV----------------QQQREQ
A0A4Z0PVM7      ------------LRRLLR----------SYNE-TTEAV----------------KQQQAA
A0A1M6DHW8      ------------LRRILR----------SYTP-ATEAV----------------QQQQST
A0A4Q5LC61      ------------LRRILR----------SYTP-ATEAV----------------KQQQSA
A0A2N5YXE2      ------------KEILLF----------DVTA-NNHKI----------------VTIDEQ
K0XJ09          ------------RERLAA----------NSGE-NNPLV----------------KDLDNN
R5EUZ0          ------------RERLAA----------NSGE-NNPLV----------------KDLDNN
W0EQS0          ------------RERLVA----------NSGE-SNPLV----------------RDLDSN
A0A1Y3WE15      ------------RERLAA----------NSGE-NNPLV----------------RDLDNN
A0A1Y4GUK3      ------------RERLAA----------NSGE-NNPLV----------------RDLDKN
A0A2U1FKU2      ------------YDRLKQ----------SSSE-NSPAV----------------QEAAMQ
A0A0A2F954      ------------YERLKQ----------SSSE-NSPAV----------------QEVGMQ
A0A0A2FW91      ------------YDRLKQ----------SSSE-SNPLV----------------QEMAMQ
A0A2D2N2N1      ------------YDRLKQ----------SSSE-NSPAV----------------QEVGMQ
Q7MWZ2          ------------YDRLKQ----------SSSE-NSPAV----------------QEVGMQ
T2NDT6          ------------YDRLKQ----------SSSE-NSPAV----------------QEVGMQ
W1R7P9          ------------YDRLKQ----------SSSE-NSPAV----------------QEVGMQ
A0A1R4AFZ0      ------------YDRLKQ----------SSSE-NSPAV----------------QEVGMQ
A0A1R4DVZ7      ------------YDRLKQ----------SSSE-NSPAV----------------QEVGMQ
A0A7C0WKI7      EARY--------IEYKIE----------GVNE-NFPNM----------------KKMKKD
A0A2A8CVM9      YVANDGLEGDTDRIETEFP---------QLAD-LLERI----------------NGLEKR
A0A5M4B212      ------------LTTLSAT---------VKDP-EHPRM----------------RQLSIQ
A0A3D1KEX9      ------------YTRLSA----------NSSN-SSSVI----------------QDYEKS
A0A358Y7S2      ------------KEELLK----------DVTL-ENEAI----------------KRIEIK
A0A1X7J248      ------------YQLSKT----------RYKK-ESQVL----------------LQRKIE
E4TQD2          ------------YQMAKT----------RYKK-ESQVL----------------LQRNLE
A0A2J6HHN3      ------------RQEYLI----------TMTE-NSTVI----------------ESIDKQ
A0A1Y3WMT8      ------------RMRLLR----------TAKD-SNLSL----------------RTLTAQ
A0A1Y4GQU1      ------------RMRLLR----------TAKD-SNLSL----------------LTLTAQ
A0A6A0R272      ------------KATLGV----------NFTI-DSKKA----------------RELDSQ
A0A1V5W8T5      ------------KEQLLI----------TVTP-DNHKV----------------KVIDQQ
A0A2T8HKA9      ------------RNRLLE----------GNNS-NNPYV----------------QELDQY
A0A2I0QZ80      ------------KEDLSY----------KVTQ-NNDII----------------QKLEKR
A0A3E1F1A3      ------------KEDLLF----------QVTP-QNEKI----------------SKLEGR
A0A2U2XBJ3      ------------KEDLLY----------QVTP-QNENI----------------KKLEMR
A0A4Q4KU94      ------------KEDLLY----------QVTP-ENENI----------------KKLIMR
A0A3B8INU3      ------------LDQLLL----------SHDP-RTLIV----------------RRTQQS
A0A2W1NDY9      ------------QEDASY----------RMTM-ENDGL----------------KNLESN
A0A5C8AQR5      ------------KEDLLF----------DVKP-DNSVI----------------VNLNQR
A0A1G0CI31      ------------KEDLLF----------DVTE-NNTEI----------------KNINIQ
A0A556N0M0      ------------KEELLT----------NVSE-NNSEL----------------KNLNSR
F2IKD6          ------------KEELLT----------NVTE-NNSEL----------------KNLNTR
A0A1I7BM74      ------------RENLLY----------TVTE-ESRTI----------------TQLDKK
A0A2G2FJ17      ------------KEDLLY----------KVTP-ENDMI----------------KKIETR
A0A2E3R1D0      YRQNPALRN---DTNPPA----------NIAR-LRTEL----------------ARVEAD
A0A2T2USC0      RRNNPNLEPGD-SSPKAR----------EFAR-LEEKS----------------RQLSRE
A0A2T2V0F3      KRNNPDLDPGG-TSPKAR----------EFAR-LKERA----------------RQLDRE
A0A2T2S682      KTRNPNLDADA-STARAK----------NLRQ-LQRRA----------------DRLERQ
D5H561          ELQS----GAP-TPADSA----------QAAQ-IDRRI----------------QKLRAR
A0A2H3NWA9      LERNSNLSPNPNGNALER----------ELAR-TQERI----------------DRLDTQ
A0A2A8CVB6      ERENPNLGA---GGTLQR----------DLRR-MKERV----------------SRLQER
A0A2P6C1S6      ERNNPDLEP---TSQLGR----------ELQR-MKTRA----------------QTLARR
A0A2T2UTM4      ERRNPDLDP---TSRLGQ----------ELQR-MKARA----------------ATLDRK
A0A414ZBF2      ------------KNKLMA----------NSSA-NNPIV----------------REMNAS
A0A1Q3Q573      ------------REIKLL----------ERTE-DHPEV----------------RLLDKQ
A0A662BAY3      ------------KSSMTS----------VKNT-EHPKL----------------KRLNAQ
A0A4U3L369      ------------RDRVSL----------NYPD-TNPLL----------------QNIDMQ
A0A357YNR3      ------------RNRLAR----------IASS-SNQSM----------------IDLNYQ
A0A5E8AX52      ------------REVLLG----------SYNE-NTHAV----------------SRMTQR
F4KK08          ------------RDQLQA----------NSSS-QNPLV----------------QELNTQ
A0A6B5PK86      ------------KEDVLF----------RLTP-ESSEV----------------KRIDKK
A0A2G2F510      ------------KEDLLY----------RVTP-ENSEV----------------KLLDRK
A0A316JZ08      ------------KEDLLV----------SLTP-NNEKV----------------ALVQKR
A0A496LCF9      ------------LL--------------DLGA-KNPQY----------------EVVSGQ
A0A5P2G2A9      ------------KERYAT----------TNTS-ENPGM----------------IALDSQ
A0A3C0ZQC7      ------------AQNPTYV---------GQDI-YTQKL----------------KEIDVQ
A0A419VXB7      ------------KETLSY----------SVHS-KNPGI----------------QVIDKE
A0A0B0BTJ4      ------------RMRLGT----------ETSD-DNPVI----------------REMNAQ
A0A3B9CNN6      ------------RMRLGT----------ETSD-DNPVI----------------REMNAQ
R5X290          ------------RMRLGT----------ETSD-DNPVI----------------REMNAQ
A0A1Q6E6I7      ------------RMRLGT----------ETSD-DNPVI----------------REMNAQ
C3J7R8          ------------RDQLIA----------NAET-QNPVV----------------ETLEKQ
A0A1G8BVM8      ------------RNKLLA----------NSTS-NNPII----------------NDLQTS
A0A1I1FXP9      ------------KEMMSY----------TAKE-GTLAA----------------RLRDKK
A0A3N4H5N3      ------------RQRLSR----------VVQP-NNQQI----------------LSLNEQ
A0A2P8EAX2      ------------RQRISR----------IVQP-NNQQL----------------ISLNEQ
A0A4V2F6N9      ------------RQRISR----------IVQP-NNQQL----------------IALNEQ
A0A3B9FXJ0      ------------KANLML----------SLPP-TDPKV----------------KLVTGQ
R5GSU5          ------------RNRLAP----------NTGE-NSPVM----------------NDLNQK
A0A2A3UE91      ------------KENLLY----------AVTP-NSENI----------------KQVNYQ
A0A0A2G557      ------------REQLLS----------ESGQ-TNPLI----------------ETQQKQ
A0A2N2WFW8      ------------KQDLLV----------HITE-NSTAV----------------ESVNSQ
A0A1F3IU95      ------------KQELLL----------RVTE-NSTAI----------------ESINAQ
A0A3D0VUF6      ------------KQELLL----------RVTE-NSTAI----------------ESINAQ
A0A1T4PT95      ------------RERLLS----------ESGQ-TNPLI----------------ETQQKQ
A0A6I6JYY3      ------------KSSLTSV---------RANS-QHPAI----------------VRLNAQ
A0A2A4PYG9      ------------KEEILY----------TATK-ESEAV----------------KGVNYQ
A0A1F3K695      ------------KEVLLN----------DVTN-NNHQI----------------KVVDKQ
A0A353KZR1      ------------KEVLLN----------DVTN-NNHQI----------------KVVDKQ
A0A2N2WYB5      ------------KEQLLN----------DVTP-NNLKI----------------KQLDKQ
A0A1F3K4G0      ------------KEQLLN----------DITR-DNLKI----------------KLLEKQ
A0A356H8Y3      ------------KEQLLN----------DITR-DNLKI----------------KLLEKQ
A0A351HSA6      ------------KEQLLN----------DITR-DNLKI----------------KLLEKQ
A0A1F3Q014      ------------KEEMLY----------DVKP-NSEAT----------------RLIDYQ
A0A2D5KD44      ------------KQELLF----------TMRE-NSNRI----------------QEIDYQ
A0A6N9NIX1      ------------KQNQLY----------SNTA-SSDQV----------------KNINYR
A0A2A4YXP3      ------------KENLQF----------EVTK-DSEII----------------KSLDHK
A0A1F3R158      ------------RQKILN----------EATK-ESDLI----------------KFHDQQ
A0A2M8ADX2      ------------RQKMLT----------EATK-ESDLI----------------KIQDQQ
A0A1J5B2H0      ------------REQLLY----------EVTL-NSSQI----------------ESINYQ
A0A1V5N756      ------------KEELLY----------NVTA-YNSQI----------------KQINYK
A0A651GU15      ------------KEEMGF----------NVKG-NHGAV----------------KNIEYQ
A0A3Q9FR88      ------------ALRIKD----------SYTS-NTIAS----------------NAKLEL
A0A553GEX3      ------------ALRIKE----------SYTS-NTIAS----------------NAKLEL
A0A150ADJ9      ------------ANRIKN----------SYTE-RTVAS----------------NAKLEL
A0A1B1FWQ4      ------------ALRIRE----------SYTS-NTVAS----------------NSTLEL
A0A1S1Z228      ------------ALRIKE----------SYTS-NTVAS----------------NSTLEL
A1ZKR2          ------------KKILAL----------KATG-SSIVV----------------KDINQK
A0A1Q3GX01      ------------KKLLDL----------KVNN-SSMVF----------------KDVNKK
A0A349DQI4      ------------KKLLDL----------RATS-SSMII----------------QNINQQ
A0A4P5TMD1      ------------KREKLL----------KLKP-ANPQI----------------INIDKQ
A0A2N3IIZ0      ------------RQNQEL----------SETS-ATYSY----------------QVLDIK
A0A1F3SJM1      ------------KEDLLY----------NVTE-ENEEV----------------VALTKK
A0A2G2EB96      ------------KEDLLF----------EVTE-ANSEI----------------AIINQK
A0A2G6PRA9      ------------KEDLLF----------EVTE-NNSEI----------------EIINQR
A0A497D5Z2      ------------KSSLTS----------VKNM-EHPKL----------------KRLNAQ
A0A662B170      ------------KSSLTS----------VKNM-EHPKL----------------KRLNAQ
A0A2A5FYT6      ------------KEEMLY----------SETE-KSEKI----------------KSIDYQ
A0A2E6SYP1      ------------RRELSF----------RVTE-ESYEV----------------KEIDFQ
A0A2E5RLE8      ------------KRSLSF----------RITE-ESYQV----------------KEIDFQ
A0A2E7TQF6      ------------KRSLSF----------RITE-ESYQV----------------KEIDFQ
A0A2E6GVY9      ------------KRSLSF----------RITE-ESYQV----------------KEIDFQ
A0A350JJ90      ------------RNRLLG----------GATM-DNPNI----------------RVYDQQ
A0A3M1CDV2      ------------KENLLY----------QVTP-NSEQI----------------KIINYQ
A0A6C1QGZ7      ------------RERLLY----------EVTA-ESRQI----------------EALNYQ
A0A4P5U6G4      ------------KRYFLL----------SKTA-NNPEV----------------INIEKQ
A0A2E2TFD1      ------------KDQSLY----------EVTQ-SSGRV----------------QNLDYQ
A0A2E4ELE6      ------------REQSLY----------EVTA-DNGRV----------------KNLEYQ
A0A522EYA6      ------------REELLY----------QVTP-TSEKI----------------KSIEFQ
A0A2E3XZI5      ------------RDLLLK----------EVTK-NNKNF----------------IQLNRQ
A0A6I7QXV0      ------------KNALLL----------NVKS-NHPQV----------------LLIEEN
A0A2M7NLQ9      ------------KKFMLD----------RLTK-QTAAY----------------QQKEKK
I4AFR0          ------------KKFMLD----------RVTK-QTGAY----------------QQKAKR
A0A2N2Y3E5      ------------KEKAMN----------NLTT-QSFQI----------------KSIDKQ
A0A2D9D7T6      ------------KENLLT----------GLTP-QNKEI----------------EILDQK
A0A1F3PPL5      ------------KDMLLN----------DVTN-NNHKI----------------KIVDKQ
A0A357QK06      ------------KDMLLN----------DVTN-NNHKI----------------KIVDKQ
A0A662AEA4      ------------KQQLLN----------DVTS-NNYQI----------------TTIDKQ
A0A0S2HYK8      ------------KNQLLN----------DVTE-NNMRI----------------KIIDKQ
A0A2N5ZWN6      ------------KNQLLN----------DVTE-NNMRI----------------KLIDNQ
A0A2E0FJ09      ------------YEDLIS----------ERTG-DHEEI----------------KKIRSQ
A0A1F3FZ62      ------------KEKMLY----------EITP-DNRQI----------------NALEYQ
A0A1F3K211      ------------KEKMLY----------EITP-DNRQI----------------NALEYQ
A0A1V6I2U9      ------------KEVLLF----------DLTS-NSHKI----------------QTLDEQ
A0A2H0B957      ------------RDAYLN----------NQTK-NSYQI----------------KVIEKQ
A0A1F3CFW6      ------------RDLYLN----------NQTQ-NSFQI----------------KVIEKQ
A0A2M7E2T8      ------------RDLYLN----------NQTQ-NSFQI----------------KVIEKQ
A0A2M7NC69      ------------RDLYLN----------NQTQ-NSFQI----------------KVIEKQ
A0A1F3KLL5      ------------REQMLS----------DVTA-NNYKI----------------KVIDKQ
A0A359D1M1      ------------REQMLS----------DVTA-NNYKI----------------KVIDKQ
A0A0F2NS19      ------------KQNLLS----------EVTV-NSGSV----------------KSLENQ
A0A2A5H8X6      ------------KQNLLS----------EVTV-NSGSI----------------KSLENQ
A0A2H0GAU8      ------------KQNLLG----------EVTV-SSEAS----------------KSLDRK
A0A2M8FTK1      ------------KQNLLG----------EVTV-SSEAS----------------KSLDRK
A0A2A5B3B0      ------------QENLQY----------EVTK-NNEVV----------------KSLKHQ
A0A5C6RXM7      ------------KENMLY----------EVTD-NSGAI----------------NSMNYK
A0A1F3C1M2      ------------KEILLN----------DVTK-NNHQI----------------QVIDKQ
A0A1F3DS87      ------------KEILLN----------DVTK-NNHQI----------------QVIDKQ
A0A6A0R6K9      ------------KQKLLF----------SNKE-DNSLL----------------KELDFQ
A0A2E7CT70      ------------RDELLR----------DVTE-SNENV----------------ILLNYQ
A0A2D5V560      ------------RDQLLK----------DITP-NNKNI----------------IILNGE
A0A2D7K5A8      ------------RDELLK----------DITP-NNKNI----------------ILLNGQ
A0A2E1XQ82      ------------RDELLK----------DITP-NNKNI----------------ILLNGQ
A0A5C8A5B4      ------------LAAQNLS---------TGAR-SNPTV----------------IAMERK
A0A4Y9ITE2      -------------RMKLVN---------NAKT-NNNAAL---------------RTISSQ
A0A5M8NYX7      -------------KNRATL---------GLKP-TNSIV----------------REYEER
A0A3D5KRY6      -------------REVLSY---------TVQE-KNPVL----------------VSLNNE
A0A0E3V905      -------------RDHLLH---------TTSE-LNPLL----------------ETVDSQ
A0A553ETH6      -------------REQLRL---------SYSE-TTFAL----------------TKKEQE
A0A640Q161      -------------VSELSN---------VYGP-KHPRM----------------IAANAE
A0A640QU49      -------------VSELSK---------VYGP-KHPRM----------------IAANAE
A0A1Q3PII2      -------------RVKALS---------QLSP-GHPDF----------------ILLEEQ
A0A351BXT2      -------------RD--VE---------ASIP-NDEKLREKTLAEYNRKIAPLRETLEEK
A0A2K8Z965      -------------RDQMAR---------TTSE-QHPML----------------ETINSQ
A0A418M8U8      -------------RSQLAR---------TTSD-QNPLL----------------QTIDTQ
I2GTA4          -------------RSQLVR---------TTSE-QNPLI----------------QTIDTQ
A0A2K8ZAJ2      -------------REDLLK---------TTSS-GSPLI----------------ESLDSQ
A0A368JPA3      -------------RTVLLR---------NSPE-PSAVL----------------RSLDDQ
A0A5N1JI29      -------------RTVLLR---------NSPE-PSPVL----------------RSLDDQ
A0A3P1BT12      -------------RSLLVR---------NSSD-SNPVL----------------RSLDDQ
A0A3P1CI15      -------------RNLLAR---------NSSE-SSPLL----------------RSLDDQ
A0A4R8CUK1      -------------RDRLVR---------TTSE-ANPIV----------------QSITHQ
A0A3D0MYJ7      -------------RDIELS---------T--V-ENPQVYAKVESDYNKKISTLKSQYDKY
A0A662AH13      -------------RDIALS---------DTTV-SDASK-PILKAEADRRIGELKTELDNE
A0A5C7QA01      -------------QADLVV---------KYTD-DHPAM----------------REINAQ
A0A3D3LS70      -------------RDMELT---------I--P-KDPKLIEKVKNEYDAKITALKKSLDEK
A0A1G1TM36      -------------RETLLT---------TTPA-GNPLF----------------KPLDSE
A0A1G7ZF38      -------------LTRALA---------SLAP-GHPEV----------------QSMEKQ
C6VS52          -------------RVKALT---------TLAP-NHPAV----------------TTLDSQ
A0A7C1LGX3      -------------RNKLLQ---------TVGI-QHPSL----------------IAISTQ
A0A2A4G4B1      -------------KNQLLE---------SASE-NHPTI----------------LTMNER
A0A0P7X1V8      -------------RETQRTLLLSRNPQLRNTP-DDPSL----------------IEINQQ
A0A6P1P355      -------------YQRLLS---------TTAE-NNPIL----------------LALASE
A0A5C8KAD6      -------------YQKLKN---------TTAE-NNPIL----------------ISLAEE
A0A5N1J695      -------------YNNLKN---------TTAE-NNPIL----------------LALADE
A0A3B0C2S4      -------------REKLIS---------TVGD-NHPTL----------------VTLSGQ
A0A3N2M1H3      -------------RNNLVS---------NSSE-RNPLV----------------EDYDSQ
A0A4S2G8T2      -------------RNNLVS---------NSSE-RNPLV----------------EDYDSQ
A0A212K7W5      -------------RNTLLA---------NSSD-NNPLV----------------LDIKQS
F5IU11          -------------RNTLQA---------NSSD-NNPLV----------------LDMKQS
A0A7C1QWC7      -------------RSAILS---------NNAE-KNLFL----------------DQIENK
A0A352Z1R7      -------------KRTLLT---------DYTE-NHPAV----------------RTIQGQ
A0A3N2N6F7      -------------RDQLLS---------TTGE-NSPLV----------------KDRDNS
A0A4P7VVU7      -------------RDKLSN---------STGD-TNPLL----------------QDYDKN
A0A2V1ILM4      -------------RDKLSN---------STGD-TNPLL----------------QDYDKN
A0A3N2L0E8      -------------RDKLSN---------STGD-TNPLL----------------QDYDKN
A0A3N2LFC5      -------------RDKLSN---------STGD-TNPLL----------------QDYDKN
A0A0A2F501      -------------RNSLRA---------NSSD-ENPIV----------------QDLTTQ
R5B7P0          -------------RNNLVA---------NSGE-ENVLV----------------KDLDQA
R5B0L5          -------------RNQLAA---------NSSH-THPMV----------------VDMDNR
A0A6I1TEC0      -------------RNNIVA---------NSSE-QNPLV----------------ADYDQN
A0A3R5XWG1      -------------RNNIVA---------NSSE-QNPLV----------------ADYDQN
A0A5P0Y910      -------------RNNIVA---------NSSE-QNPLV----------------ADYDQN
A0A414YFM3      -------------RNNIVA---------NSSE-QNPLV----------------ADYDQN
A0A6A7UIA7      -------------RNNIVA---------NSSE-QNPLV----------------ADYDQN
A0A6A7VPS3      -------------RNNIVA---------NSSE-QNPLV----------------ADYDQN
A0A374THP7      -------------RNNLVA---------NSSE-QNPLV----------------ADYDQS
A0A6G1VND1      -------------RNNLVA---------NSSE-QNPLV----------------ADYDQS
A0A0A2EVS5      -------------LNRLLS---------NSSE-KNPLV----------------IDMDRT
A0A1T4NAJ7      -------------LNRLLS---------NSSE-KNPLV----------------IDMDRT
A0A255T941      -------------RNRLIS---------NSSE-ANPLV----------------QDLTSS
A0A3N2KCL3      -------------RNSLLA---------KSSD-KNPLV----------------VQLNEQ
A0A4P7VSV0      -------------RNSLLA---------KSSD-KNPLV----------------VQLNEQ
A0A2V1IJY1      -------------RNSLLA---------KSSD-KNPLV----------------VQLNEQ
A0A4P7VXK7      -------------RNSLLA---------KSSD-KNPLV----------------VQLNEQ
A0A1Y4CHN5      -------------RNNLVA---------NSSD-ENPLV----------------KDMDNA
A0A1M6I2S6      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A1Y3V692      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
F3PXM2          -------------RNRLAA---------NSSE-KNPLV----------------VDLTAS
A0A174AHH7      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A174JCE8      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A3E4JMC4      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A412SND6      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A414IEQ9      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A6I0U0V8      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A6L5S9H7      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A0M1W8D8      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A3R6GKX5      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A7V4S1          -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
B0NU19          -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
D4V601          -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A4Q0U3M9      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A4R4H1Q2      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A6I0GII7      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A6I0KYU7      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A397WLT5      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A6A2J529      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A6L6P8N9      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A6N8DDD8      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A015XH67      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A078RZN2      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A4R4I3T9      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A6L0K5          -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A7ACT5          -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A6KY94          -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A173UQR8      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A3R6HK75      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A412B7D1      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A412VNY9      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A414LTU9      -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
I9Q4U4          -------------RNRLIA---------NSSE-KNPLV----------------KDLGNS
A0A373ISF0      -------------RNRLID---------NSSE-KNPLV----------------KDLASS
U6RF62          -------------RNRLIA---------NSSE-KNPLV----------------KDLANS
A0A662ZZD5      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A3A5TI83      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A415NEB6      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A6I0I238      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A7AJ60          -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A6A2JF01      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A6I0Y2Y2      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A6I2Q447      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A395YYT3      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A015UXN7      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A5M5W148      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A6I2NTL0      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A016E4F9      -------------RNRLIA---------NSSE-KNPLA----------------KDMANS
A0A4Q5CFJ7      -------------RNRLIA---------NSSE-KNPLV----------------KDMANS
A0A6N3HG44      -------------RNRLIA---------NSSE-KNPLV----------------KDMANS
A0A6H9P0U9      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A108TH71      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
I8VXH0          -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A412S0N6      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A412IIJ0      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A0P0FM97      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
R6KTP3          -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A139LU87      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A1C6B3Y5      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A6L3KCD1      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
E2NMQ4          -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A412YDB9      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
R7DY01          -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A414LGK8      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A415IPQ4      -------------RNRLIA---------NSSE-KNPLV----------------SNMANS
A0A3E5BRW7      -------------RNRLIA---------NSSE-KNPLV----------------KNMANS
K9DXS6          -------------RNRLIA---------NSSE-KNPLV----------------KNMANS
A0A1M6KFV3      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A1Q6G7L3      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A413H235      -------------RNRLIA---------NSSE-KNPLV----------------KNMASS
A0A1M5B2J8      -------------RNNLVS---------KSSV-KNPLV----------------VEMDAS
A0A255RCT5      -------------RNNLVS---------KSSD-KNPLV----------------VEMDAS
A0A1Y4GLF5      -------------RNNLVA---------NSST-DNPLV----------------VDMDQA
A0A1H3XSC0      -------------RNSLVA---------NSST-QNPLV----------------VDMDQA
A6LE40          -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A4Y1VPX5      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A6N2XMM4      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
B3JI46          -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A358R8U0      -------------RNSLVA---------NSST-QNPLV----------------VDMDQA
R6WSB6          -------------RNSLVA---------NSST-QNPLV----------------VDMDQA
A0A401LPX7      -------------RNSLVS---------HSSV-KNPLV----------------REMDKS
A0A6G0GNY9      -------------RNSLVS---------HSSV-KNPLV----------------REMDKL
A0A6I1BFM0      -------------RNSLVS---------HSSV-KNPLV----------------REMDKL
A0A3A5Z900      -------------RNSLVS---------HSSA-KNPLV----------------REMDKS
A0A285TGL6      -------------RNSLVS---------HSSA-KNPLV----------------REMDKS
A0A3A5RFX4      -------------RNSLVS---------HSSA-KNPLV----------------REMDKS
A0A1Q6IUW9      -------------RNSLVS---------HSSV-KNPLV----------------REMDKS
A0A413XDP6      -------------RNSLVS---------HSSV-KNPLV----------------REMDKS
A0A6N8CVT6      -------------RNSLVS---------HSSV-KNPLV----------------REMDKS
K6AP24          -------------RNSLVS---------HSSV-KNPLV----------------REMDKS
A0A6I2NHV3      -------------RNSLVS---------HSSV-KNPLV----------------REMDKS
A0A662ZYI7      -------------RNSLVS---------HSSV-KNPLV----------------REMDKS
A0A078RYI7      -------------RNSLVS---------HSSV-KNPLV----------------REMDKS
C7XEQ8          -------------RNSLVS---------HSSV-KNPLV----------------REMDKS
D7INX6          -------------RNSLVS---------HSSV-KNPLV----------------REMDKS
K5ZG55          -------------RNSLVS---------HSSV-KNPLV----------------REMDKS
A0A3N2N9B8      -------------RNSLVE---------KSSE-SNPLV----------------ISMDGQ
A0A3N2NMI0      -------------RNALVE---------KSSD-TNPLV----------------VTIDQQ
A0A359I8H7      -------------RNTLAA---------SSSD-TNPLV----------------VDYDGQ
A0A3N2KA63      -------------RNTLAA---------SSSD-TNPLV----------------VDYDGQ
A0A4Q0IMT7      -------------RNTLAA---------SSSD-TNPLV----------------VDYDGQ
A0A3B9FAU3      -------------RNSLIA---------NSSE-RNPIV----------------SDYDEQ
A0A3C1E5L7      -------------RNSLIA---------NSSE-RNPIV----------------SDYDEQ
A0A4Q0UAV1      -------------RNRMLA---------TSSD-NNPLV----------------QDRTNT
A0A354SN68      -------------RNNIVS---------NSSE-SNPLI----------------KDIDTG
A0A6L5XFL0      -------------RNNLVA---------NSSA-SNPLV----------------VDLDQS
A0A3N2N595      -------------RNSLVD---------KSSD-KNPLV----------------VSIDAQ
A0A0A2DUD9      -------------RNNLVK---------NSSE-SNPLV----------------VDLDAN
A0A3P1ZBJ5      -------------RNRLIM---------NSSE-KSPTV----------------IELEAR
R5FHS9          -------------RNQLLA---------NSSE-ANPLV----------------KDLDQS
A0A413TW79      -------------RNNLVA---------NSSE-QNPLV----------------ADYDQS
A0A3E5E9M7      -------------RNNLVA---------NSSE-QNPLV----------------ADYDQS
A0A3E4SK73      -------------RNNLVA---------NSSE-QNPLV----------------ADYDQS
A0A415GGC6      -------------RNNLVA---------NSSE-QNPLV----------------ADYDQS
A0A413DBH9      -------------RNNLVA---------NSSE-QNPLV----------------ADYDQS
A0A1Y4PQK7      -------------RNNLVA---------NSSE-QNPLV----------------MDIDQS
A0A1Y4IH41      -------------RNNLVA---------NSSE-QNPLV----------------MDLDQS
A0A3A6AAP4      -------------RNNLVA---------NSSE-QNPLV----------------MDLDQS
A0A6I0ZRD2      -------------RNNLVA---------NSSE-QNPLV----------------MDLDQS
A0A1Y4DYA7      -------------RNNLVA---------NSSV-NNPLV----------------ADMDQS
A0A1Y3X4I9      -------------RNNLVA---------NSSE-SNPLV----------------VDLDQS
A0A1Y4FNK8      -------------RNDLVA---------NSSE-KNPLV----------------IDMDQS
A0A355FD59      -------------RNNLLA---------NSSE-QNPLI----------------KDLDQS
A0A359CEZ9      -------------RNNLLA---------NSSE-QNPLI----------------KDLDQS
A0A353Q7B4      -------------RNNLLA---------NSSE-QNPLI----------------KDLDQS
F8X3A5          -------------RNNLVS---------NSSE-QNPLV----------------VDLDQS
A0A1M3KVR9      -------------RNNLVS---------NSSE-QNPLV----------------VDLDQS
A0A4Y9IJS3      -------------RNNLVS---------NSSE-QNPLV----------------VDLDQS
A0A495WI87      -------------RNSLVA---------NSSD-QNPLV----------------IDLDHA
A0A354M4S6      -------------RNSLVA---------NSSD-QNPLV----------------IDLDHA
R7DH52          -------------RNSLVA---------NSSD-QNPLV----------------IDLDHA
A0A4Q5E7L5      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A4P8LP09      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A4R4GZU7      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A016CWA4      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A1C6H117      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A0M1W0V2      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A139KA16      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A174VQ92      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A1Q6HCG0      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A1Y4JYM9      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3A5QW67      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3A5RQE6      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3A6BP07      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3E5E153      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3Q9IP20      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A412WV15      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A413ICP6      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A414KYB9      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A5B3FWR2      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A6L4P3V7      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
E5WX00          -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
K0X3P3          -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A415TAH7      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A078T2W6      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A6I1AQV4      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A5C6L2P1      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A412MJT7      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3E4WKT5      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3A5YY33      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A078TAH2      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A1E9CFZ7      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A373FYU5      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3A5TZ72      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3A5XBP2      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3A6MEG9      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3E4JP35      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3E4KP40      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3E4NX82      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A3E4XFU8      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A412RG70      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A412TD37      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A413GAA4      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A414M7I4      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A496BTA0      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A496D2V6      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A4Q5G1P5      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A5C6KCA6      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A5M5AHM5      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A6I0KZV6      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A6I0Y5K7      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A6I1BFB8      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A6I2P5W5      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A6N8DC51      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
E5UZA2          -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A069SMG6      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A6A2RTB3      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A6I0VY00      -------------RNSLVA---------NSST-ENPLV----------------VDMDQA
A0A1M4YZ07      -------------RNSLVA---------NSSA-ENPLV----------------MDMDQA
A0A0P0FQW1      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A5M5C0W6      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6I0H151      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A642LZ22      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6I0HI59      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A642NJ89      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6I0HI52      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6L3JTQ2      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6L4EED9      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6I0YVB5      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6L5RHE2      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6N3AEV2      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6L3KG29      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6G0G4T5      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6I0HFG9      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A4Q5E5M7      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6L4F5W0      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
C3RFN5          -------------RNSLVA---------NSSA-ENPLV----------------MDMDQA
A0A3A5Z014      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6I0ING7      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6L5S265      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A078S3Q8      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A069SJV7      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A3E5DXI5      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A3E5EM98      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A3E5F453      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A6N2YYD4      -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
I9T3G6          -------------RNSLVA---------NSSA-ENPLV----------------VDMDQA
A0A3E4SYU0      -------------RNSLVA---------NSSA-ENPLV----------------MDMDQA
A6LGY1          -------------RNSLVA---------NSSA-ENPLV----------------MDMDQA
K5ZSH4          -------------RNSLVA---------NSSA-ENPLV----------------MDMDQA
A0A1H4ADG3      -------------KERVLL---------SATP-DHPVV----------------KNLDNQ
A0A5B8VUR8      -------------KERALL---------SATA-DHPVV----------------KNLDNQ
A0A0D3L8Q3      -------------RQRLLL---------TNKP-NNPLV----------------MNLSEQ
A0A2N3U785      -------------RQGLLR---------TMQP-NNPLV----------------VNLNDQ
A0A5B6TJH8      -------------RERMLR---------TTNP-NNPLI----------------QNINEQ
A0A519U664      ------------------------------------------------------------
A0A519MA34      -------------RERMLR---------TNES-TSFLI----------------KNIDEQ
A0A519UCX0      -------------RESILR---------TSQA-NSFLI----------------NNTNEQ
A0A0E3ZG78      -------------RERMLR---------TAQP-KSPII----------------KNLNEQ
A0A1I6BRK6      -------------RQRMLR---------TMQP-TSVLI----------------QNTNEQ
A0A243WAB1      -------------RERTLR---------TTQP-SSLLV----------------QNLNEQ
A0A6G8C8X6      -------------RERILR---------TTQP-NNPLV----------------LNLNEQ
A0A416GA42      -------------CDKMES---------TTAV-ENPVV----------------QDLQQA
A0A1T3IYP5      -------------RNRLAE---------GGNN-LNPVV----------------LDLDDA
A0A1T5K9D4      -------------RDRLEK---------ASSS-VSPAV----------------MQIEDA
A0A077ENE7      -------------RNRLAE---------GGNS-SNPVV----------------LDLDDA
A0A6I5UW06      -------------RNRLAE---------GGNS-SNPVV----------------LDLDDA
T0NN57          -------------RNRLAE---------GGNT-SNPVV----------------MDLDEA
X5K347          -------------RNRLAE---------GGNT-SNPVV----------------MDLDEA
A0A060RD97      -------------LDKMLE---------SSGE-NNPLV----------------VDGRTQ
A0A3C1ITV0      -------------RQRLVA---------NSSD-SNPLV----------------SDINNQ
R7HN19          -------------RQRLVA---------NSSD-SNPLV----------------SDINNQ
A0A350IHV0      -------------RDRYMS---------DSSS-DNPLV----------------GDLNNS
R5RVP0          -------------RDRFAN---------ESSD-NNPLV----------------SDLNTS
R6A0L2          -------------RNTMVA---------NSSE-NQAVV----------------REMDRQ
R7LG80          -------------RNQMAN---------NSSD-DHAVV----------------RELDKQ
A0A2L2WX98      -------------RNRIAG---------NTSE-TSPTI----------------REIDNR
A0A6N8KXI9      -------------KNRLEE---------GSSS-ENPIV----------------KELNRD
G5GD56          -------------RNKNAA---------NSSG-QSPLV----------------RDLDKQ
R5KD55          -------------RNSLMA---------NGGK-NNPLV----------------KDIDKA
A0A174QNT3      -------------RNRLVS---------NSGE-SNPVV----------------QNMNKN
A0A4S2FGS1      -------------RNRLVT---------NSGE-NNPVV----------------QNMNRN
R9I0H0          -------------RNRLVT---------NSGE-NNPVV----------------QNMNRN
K5BUT9          -------------RNRLKE---------SSGE-KNPVV----------------QAADKN
A0A174FPA3      -------------RNRLKE---------SSGE-KNPVV----------------QAADKN
R6S9Y6          -------------RNRLKE---------SSGE-KNPVV----------------QAADKN
A0A642LIH6      -------------RNRLKE---------SSGE-KNPVV----------------QAADKN
C9KX15          -------------RNRLKE---------SSGE-KNPVV----------------QAADKN
A0A6H0KRK1      -------------RNHLLA---------ESGA-KNPVV----------------QTTDKN
R6DAG6          -------------RNHLLA---------ESGA-KNPVV----------------QTADKN
A0A3L8AAP1      -------------RNHLLA---------ESGA-KNPVV----------------QTADKN
A0A4S2AYX2      -------------RNHLLA---------ESGA-KNPVV----------------QTADKN
A0A4Y9H477      -------------RNHLLA---------ESGA-KNPVV----------------QTADKK
A0A0E2M2Y7      -------------YDRLKQ---------SSSE-SNPLV----------------QEMAMQ
A0A0K2J6Z0      -------------YDRLKQ---------SSSE-SNPLV----------------QEMAMQ
B2RKZ8          -------------YDRLKQ---------SSSE-SNPLV----------------QEMAMQ
A0A212GC82      -------------YDRLKQ---------SSSE-SNPLV----------------QEMAMQ
A0A254MU12      -------------YDRLKQ---------SSSE-SNPLV----------------QEMAMQ
R6CQ93          -------------RDKLIA---------DSSE-NNPVV----------------KELDNS
A0A3D1NQW3      -------------YMKLNS---------ESSE-NNPII----------------QNLGNG
B0MT10          -------------YMKLNS---------ESSE-NNPII----------------QNLGNG
R7JGW9          -------------YMKLNS---------ESSE-NNPII----------------QNLGNG
A0A3D2BF46      -------------RDKLAG---------NASS-NSPVI----------------QDFDSE
A0A358R538      -------------RSRLLA---------NGSE-QNPVI----------------GEMDRE
A0A1Y4AAB8      -------------REKLSE---------NSSA-NNPVM----------------QELDNN
A0A1Y3WWY9      -------------REKLLE---------NSSE-NSPVI----------------RDLDNL
A0A1Y4U5L4      -------------REKLLE---------NSSE-NSPVI----------------RDLDNL
A0A1Y3VCJ1  &