BYKdb

Dataset for cluster tadcd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

696 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1T5MMH4      ------------------------------------MELAKNNIHHQPLPSEG-------
A0A2W4R1L8      ---------------------------------------METGTFKSGNSIEG-------
A0A2E5CV79      ------------------------------------------------------------
A0A2D4ZVH1      ------------------------MHFNGNSSNGYNSGYSPLENETDSYIEKE-------
A0A0K8QSK7      --------------------------------MEDPRLEIPGLPFFPEFEQSE-------
A0A1V6CN82      --------------------------------MTEYNDTDRTQDSAAQEELPV-------
A0A1M4XZ45      --------------------------------MTQSEINKN-NQINSSSDDDT-------
A0A399D319      --------------------------------MTQMDINKNGHQINQSQDDDS-------
A0A1M6GR99      ------------------------------------------MNQQKLPEQNI-------
A0A1M6TTV4      --------------------------MNFSPEHNVLNQTNNQNADSSGSPLDD-------
A0A4Q8RX32      ---------------------------------------------MALYDGQI-------
K0X1U5          ----------------------------------------MEEKYTSERKNDN-------
R5EXK3          ----------------------------------------MEEKYTSERRNDN-------
A0A401UAP7      ------------------------------------------MDKGFTNESET-------
A0A1W2GF52      ---------------------------MNPRNVHIPQDIRSHHNPENDGAFEN-------
A0A2G5L7B8      -----------------------------MRPIHGGQN----HNQSEGDPLSN-------
A0A523GAC0      ----------------------------MTNQTFDIEKDNFVVRGQHSYLGGE-------
L8JW09          -------------------------------------MENKNIYSDTEKPTEG-------
A0A5C7MX19      ------------------------------------------------------------
A0A364XUP5      ----------------------------------MMLESNKIGPPVALPNTEG-------
A0A1M5RLA9      -----------------------------------MLETPKNIQPQQSQANEA-------
A0A385SFR9      -----------------------------------MLEIPKNIPPQQSPANEP-------
A0A5M4A9J4      --------------------------------MKEQQPQPQPVFMPFFEQEEK-------
A0A5M4B1C7      ----------------------------------MKEKQPQLVSVPFFEEEEK-------
A0A0D3LFR6      ----------------------------MKEDTTYVEYTDAPDEQPEGGPLQS-------
M7N6D4          ----------------------------MKEETTYVEYTEGQDTK-GWLPIHN-------
A0A1Q3ZMZ7      ------------------------------------------------------------
A0A2D8JJW3      ---------------------------------------------MATQSNKQ-------
A0A2W2AFF7      ---------------------------------MQDKNYTNHIVAAEQQEEGS-------
A0A2N5YXE2      ------------------------------------------MENKIPIFNQK-------
A0A2W1NDY9      -----------------------------------MNNFHINNENAISSLNKD-------
A0A5C8AQR5      ----------------------------------------MGSSERKIIINKE-------
A0A1G0CI31      ---------------------------------------MNGAQQPSLLINRE-------
A0A556N0M0      ----------------------------------------MNSSNSSIFINKD-------
F2IKD6          ----------------------------------------MNNSNTSIFINKD-------
A0A1I7BM74      ----------------------------------------MNSSKNRFFVNTE-------
A0A2G2FJ17      ----------------------------------------MEKRNNSIYVNTN-------
A0A077ENE7      -----------------------------------MNTINQKGYTIGDKKEHS-------
T0NN57          -----------------------------------MNMASQKINMTKESKEQF-------
X5K347          -------------------------------------MASQKINMTKESKEQF-------
A0A2I0QZ80      ----------------------------------------MEVNKKKLFVNTT-------
A0A3E1F1A3      ----------------------------------------MINQKGKIFVNTT-------
A0A2U2XBJ3      ----------------------------------------MINQRGKIFVNTT-------
A0A4Q4KU94      ----------------------------------------MNSQKGKIFVNTT-------
A0A2U1FKU2      --------------------------MPTEEKRITPYGGASRS--ESGEDISF-------
A0A0A2F954      --------------------------MNLNEGSQNTFTRQGRSYISDTEDTAF-------
A0A0A2FW91      --------------------------MNLNEGSQNTFTRQGRSYISDTEDTAF-------
A0A2D2N2N1      --------------------------MNLNEDSKNTFTRQSRSYISDTEDTAF-------
Q7MWZ2          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
T2NDT6          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
W1R7P9          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
A0A1R4AFZ0      --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
A0A1R4DVZ7      --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
A0A5M4B212      -----------------------------------MDALNSNSANQMTTIVRQ-------
A0A1T5K9D4      -----------------------------------------MENGNNQKNSGQ-------
A0A3D1KEX9      ----------------------------------MAEQYIEGAQQLQQEENEE-------
A0A358Y7S2      ---------------------------------------MSTGPIKKRVLNKE-------
A0A1X7J248      --------------------------MSNQQTRYQRNLEGNNSHRPQNQETEV-------
E4TQD2          --------------------------MSNQQTRYQRNLEGNTSQKPQNQESEV-------
A0A2J6HHN3      ------------------------------------------MKQKIAKFNDE-------
A0A1Y3WMT8      ----------------------------------------MEENYTSERRNDS-------
A0A1Y4GQU1      ----------------------------------------MEENYTSERRNDS-------
A0A1V5W8T5      ------------------------------------------------MFNDS-------
A0A2T8HKA9      ---------------------------------------MLKDTNIAGAEDKS-------
A0A3B8INU3      --------------------MAETNQEDYRARIQGGYPGERLEPFGNSSVLDK-------
A0A414ZBF2      -------------------------------MRKDKFEDFDFIDFNESRSEES-------
A0A1Q3Q573      ----------------------------MENKLDLTGSGGSAPKGQQTNFAEG-------
A0A662BAY3      --------------------------------MTNNDNSGPVLRNLSSQTSED-------
A0A4U3L369      -----------------------------MEYNLNGNGAASNGSISHTDDADI-------
A0A357YNR3      -----------------------------------MSMYSEVEYEFNKLADKP-------
A0A5E8AX52      -----------------------------MTENSNTSGSGLGADVNESDAFND-------
F4KK08          --------------------------------MEYQTASTQQEPIRSSEEVST-------
A0A496LCF9      ------------------------------------MKNINSDNHSNPIFDEE-------
A0A5P2G2A9      -----------------------------------MAENLLSNSGKGENAEEA-------
A0A419VXB7      -----------------------------------MDRKEELLKLLLQKEEQP-------
C3J7R8          ---------------------------MEYRESETKSIEQELKRPSLVEAASF-------
A0A0B0BTJ4      ----------------------------------MTENNKDIIDGRKEEENKS-------
A0A3B9CNN6      ----------------------------------MTENNKDIIDGRKEEENKS-------
R5X290          ----------------------------------MTENNKDIIDGRKEEENKS-------
A0A1Q6E6I7      ----------------------------------MTENNQDIIDGRKEEENKS-------
A0A1G8BVM8      --------------------------------MSKNSEQFDFVDFNDGNSNDN-------
A0A2G2F510      ------------------------------------------MSNKSFIINKN-------
A0A316JZ08      ------------------------------------------MAKQKLFINTS-------
A0A1I1FXP9      ---------------------------MLQNAEAINNALVELEEEEELRAEKG-------
A0A3N4H5N3      -------------------------------------MYMKRVLGNKMGNEEP-------
A0A2P8EAX2      ---------------------------------------MNQNKARNKGAGEP-------
A0A4V2F6N9      ---------------------------------------MSHNRTKNKGAGEP-------
A0A3B9FXJ0      --------------------------------MSNNAKFQAAPQQESTSGSSG-------
R5GSU5          -----------------------------------MANQNYINPPAVQQETED-------
A0A2A3UE91      ------------------------------MFNPQVESANNQLKDITEKFNSG-------
A0A0A2G557      ------------------------------MNNNLYTNPEEGFIENNLSEEQM-------
A0A2N2WFW8      -----------------------------------------MAEYKKSKLNDD-------
A0A1F3IU95      -----------------------------------------MTDSRKIKFNDE-------
A0A3D0VUF6      -----------------------------------------MTDSRKIKFNDE-------
A0A1T4PT95      ----------------------------MNSNPYSNSSDVIMEKHQEIPEENM-------
A0A4P5TMD1      -----------------------------------MLEKKIILSPMQKILGED-------
A0A651GU15      ---------------------------MIDENISKVNQSYEGYKERLTNFGSQ-------
A0A3Q9FR88      --------------------------------MTDFDKEWDDLNNEGDNLSNN-------
A0A553GEX3      --------------------------------MTDFDKEWDDHDNDGDNLSNN-------
A0A150ADJ9      --------------------------------MTDFDKEFDDFDREDGNIADS-------
A0A1B1FWQ4      --------------------------------MSDFEKEWEDLENNEESSAND-------
A0A1S1Z228      --------------------------------MSDFEKEWEDLDNNEESSAND-------
A0A2A4PYG9      ----------------------------MYNQTTSGTDNVNAYQDRMSNFSQE-------
A0A1F3K695      -----------------------------------------MEEKKIPLINEK-------
A0A353KZR1      -----------------------------------------MEEKKIPLINEK-------
A0A2N2WYB5      -----------------------------------------MYQGKIPLINDK-------
A0A1F3K4G0      -----------------------------------------MYQGKIPIINDK-------
A0A356H8Y3      -----------------------------------------MYQGKIPIINDK-------
A0A351HSA6      -----------------------------------------MYQGKIPIINDK-------
A0A1F3Q014      ---------------------------MLQEDISKTNDNFERYKERISNFSGE-------
A0A2A4YXP3      -----------------------------MEENTSSNNLNEERARKRSNLNTE-------
A0A2D5KD44      ---------------------------MQEQLSPHELEKLKQSQSSLSSFNTD-------
A0A1F3R158      ---------------------------------MSEEYRDKQNNEAISNFNTE-------
A0A2M8ADX2      ---------------------------------MNDEFNNKENKETVSNFNTE-------
A0A1J5B2H0      -----------------------------------------MQPKKFSIINEE-------
A0A1V5N756      -----------------------------------------MANIKISYLNDE-------
A0A1F3SJM1      -----------------------------------------MSNKKSLIINKS-------
A0A2G2EB96      ------------------------------------------MSSKGIIINTS-------
A0A2G6PRA9      ------------------------------------------MNNKGLIINKS-------
A1ZKR2          -------------------------------MTDQSNIPNINTPSEDDDFLNA-------
A0A1Q3GX01      -------------------------------MEEQNHILPNNNSSENDDFFSS-------
A0A349DQI4      -------------------------------MEERNHILPTNNDSENDDFLSN-------
A0A2N3IIZ0      ------------------------MAQYLTEEERFRRLLQTDDIDSGESPLEA-------
A0A497D5Z2      --------------------------------MTPPNQRNNKPVSGKSASNED-------
A0A662B170      --------------------------------MTPPNQRNNKPVSGKSASNED-------
A0A2A5FYT6      --------------------------------METSSFSNNNEHNAFAKQQSD-------
A0A2E6SYP1      -----------------------------------------MEKEKLSILNDE-------
A0A2E5RLE8      -----------------------------------------MEKEKLSILNDE-------
A0A2E7TQF6      -----------------------------------------MEKEKLSILNDE-------
A0A2E6GVY9      -----------------------------------------MEKEKLSILNDE-------
A0A350JJ90      -------------------------------------MTEETNTNNLGVHSSQ-------
A0A3M1CDV2      ------------------------------MLVANTDNEYHSYKQRLENFSNN-------
A0A522EYA6      ---------------------------MLADQFSNSSNSFSQYKERVSNLSQE-------
A0A4P5U6G4      ----------------------------------MQEEKKIILSPLQKLIGSD-------
A0A2E2TFD1      ---------------------------MIQDAREEQNESLDLYKERLTKFSQD-------
A0A2E4ELE6      ---------------------------MIHEDTSRNNENLDKYKERLTNFSQE-------
A0A2E3XZI5      ---------------------------MKQENFVQTEENINRYKENITSLTQD-------
A0A2M7NLQ9      --------------------------MSDFDENPFINPAQAADASNEENFLAD-------
I4AFR0          --------------------------MSDFDENPFINTVPTAETSNEENMLAD-------
A0A2N2Y3E5      -----------------------------------------MEERRIPILNET-------
A0A2D9D7T6      ---------------------------------------MSSLNQRKLIVNKD-------
A0A1F3PPL5      ------------------------------------------MQKKIPLINET-------
A0A357QK06      ------------------------------------------MQKKIPLINET-------
A0A662AEA4      -----------------------------------------MQQNKIPIINEK-------
A0A0S2HYK8      -----------------------------------------MQNRKIPIINDT-------
A0A2N5ZWN6      -----------------------------------------MQKNKIPIINDT-------
A0A0F2NS19      ----------------------------MQEDQFAH------KKEVVSNFNTE-------
A0A2A5H8X6      ----------------------------MQEDQFAH------KKEVVSNFNTE-------
A0A2H0GAU8      ----------------------------MEEEQFSN------KREPISNFNTE-------
A0A2M8FTK1      ----------------------------MEEEQFSN------KREPISNFNTE-------
A0A2A5B3B0      ----------------------------MEENNSSNNINEE-KTRKRSNLNTE-------
A0A5C6RXM7      ----------------------------MESNNQINSNQDVIKNRKHSTFNTE-------
A0A2E0FJ09      ---------------------------MIEEEISKRNDSFERYRERLTNFSSE-------
A0A1F3FZ62      ------------------------------------------MAAKISQINTE-------
A0A1F3K211      ------------------------------------------MAAKISQINTE-------
A0A1F3KLL5      ---------------------------------------MKQQQRLIPVINDK-------
A0A359D1M1      ---------------------------------------MKQQQRLIPVINDK-------
A0A2E7CT70      ---------------------------MIPEEIKNTEDNLLRYRERIANFSKD-------
A0A2D5V560      ---------------------------MESENFKXVEXNFQRYKENVADLTQE-------
A0A2D7K5A8      -----------------MVNHYSNQSIMGAEEFKGAEENIQRYKENVSDLTQE-------
A0A2E1XQ82      -----------------MVNHYSNKSIMGVEDFKGTEDSIQRYKENVADLTQE-------
A0A1V6I2U9      -----------------------------------------MDENKTSLFNQK-------
A0A1F3C1M2      -----------------------------------------MSEKKIPLINEK-------
A0A1F3DS87      -----------------------------------------MTEKKIPLINEK-------
A0A2H0B957      -----------------------------------------MEQKNIPILNEK-------
A0A1F3CFW6      -----------------------------------------MEQKRIPILNEK-------
A0A2M7E2T8      -----------------------------------------MEQKRIPILNEK-------
A0A2M7NC69      -----------------------------------------MEQKRIPILNEK-------
A0A5C8A5B4      --------------------------------------------MNVAPSADT-------
A0A4Y9ITE2      --------------------------------------MKEINITSNKGKDKK-------
A0A5M8NYX7      ---------------------------------------METTNMQAEQSGEE-------
A0A3D5KRY6      ------------------------------------------------------------
A0A1V5IPN7      ---------------------------------------MDQNNQPSTVPQPE-------
A0A0E3V905      ----------------------------------MSANTYTYTQHQLVESDGL-------
A0A553ETH6      ----------------------------------------MNSINENNQEYEG-------
A0A640Q161      ------------------------------------MAVNSREELNVGVFENE-------
A0A640QU49      ------------------------------------MAVNSREEFHNGMFENE-------
A0A1Q3PII2      -------------------------------------MLATKIPSTDLALSRD-------
A0A351BXT2      -----------------------------MNKPSLNGKSNHTAVNSPELRESK-------
A0A2K8Z965      ---------------------------------MTNESNYSYTTHQVVESEGL-------
A0A418M8U8      ---------------------------------MNNQFQHSYVPYKMMEPEEL-------
I2GTA4          ---------------------------------MNNQFNHSYVPYKMMEPEEL-------
A0A2K8ZAJ2      ----------------------------------MNMNPNVYTPYQTADVESK-------
A0A368JPA3      ---------------------------------MKSSNMYSYPMYPQGEINSS-------
A0A5N1JI29      ---------------------------------MKSSNMYSYPMYPQGEINSS-------
A0A3P1BT12      ---------------------------------MKSSNMYGYPMYPQGEITSS-------
A0A3P1CI15      ---------------------------------MKSANMYNYPMYPQGEMSSS-------
A0A4R8CUK1      ---------------------------------------MHTNPINLRRKISS-------
A0A3D0MYJ7      ---------------------------------MNKNQDIFIDETKSGTETTI-------
A0A662AH13      ------------------------------------MNSGYNNNNSGFEIEET-------
A0A5C7QA01      -----------------------------------------MNQNQNTHTEDT-------
A0A3D3LS70      -----------------------------------MSDKSNNIPSVLKKDKEI-------
A0A1G1TM36      ------------------------------------------------------------
A0A1G7ZF38      -------------------------------------MLANKTQIAD---FQD-------
C6VS52          -------------------------------------MLTTKGPTNDYPPFQD-------
A0A0P7X1V8      --------------MTDTNGHNTNGYNGRYRGEEIANQYSGQAGLQREDNDDE-------
A0A3B0C2S4      -------------MPILGCLFKIVSVFLPHIFNLKKRMAESPFSLDYDETEES-------
L8JI02          -------------------------------------------------MNDK-------
A6EBM4          -------------------------------------MTGESRKGQRGPSHRE-------
A0A416GA42      --------------------------------------MEQQNKQNVSGSGLE-------
A0A4R5DL69      -----------------------------------MASYLENITSIESGSTVN-------
A0A1T3IYP5      -----------------------------------MDTIKQKNYIIENKKEQS-------
A0A1M4YED3      --------------------------------------------MSAPKHTQE-------
A0A3P1Z8V4      ----------------------------------MIQSSSSHPDYPHLPSDSD-------
A0A2N3U785      -------------------------------------MNKKDIFLAEPENF---------
A0A0E3ZG78      -------------------------------------MMDKELFPLSSERAGE-------
A0A1I6BRK6      -------------------------------------MDSQELFSSDLSQAKA-------
A0A243WAB1      -------------------------------------MNTRELFPLNSEQVEE-------
A0A126PFG0      ---------------------------------MEPFNGQVSTFYTAATASQP-------
A0A3M1N7Z3      -----------------------------------------------MPIQQE-------
A0A2H3NSN0      --------------------MNTNDQNALDIRRKKVEQIGLSRSDNSDTESNA-------
A0A2P6C324      --------------------MNDTSQNLTPYRKQA-EKIGLQSSNSGS-DDNT-------
A0A1M6XHU0      --------------------MAHYRHHSLIVARGG-QRGGLPPASSETRDEGR-------
A0A5S9C8G0      --------------------MAHYRHHSLIVARGG-QRGGLPPASGETRDEGR-------
G2SF81          --------------------MAHYRHHSLIVARGG-QRGGLPPASGETRDEGR-------
A0A5S9EYW1      --------------------MAHYRHHSLIVARGG-QRGGLPPASDEKRDEGR-------
D0MHQ9          --------------------MAHYRHHSLIVARGG-QRGGLPPASDEKRDEGR-------
A0A4D7K1D4      ------------------------------------------------------------
A0A3C1ITV0      ----------------------------------MKEDYNSIGAAETEDQKNE-------
R7HN19          ----------------------------------MKEDYNSIGAAETEDQKNE-------
A0A060RD97      ---------------------------------------MVENKINNEQDPKS-------
A0A0D3L8Q3      ------------------------------------MTDQDNLL---LEDSEQ-------
A0A5B6TJH8      ---------------------------------MQRLAGTEELFPLKAEKKDN-------
A0A519U664      -------------------------------------MDNKELFPLSSEQPES-------
A0A519UDD1      -------------------------------------MANDDLFPVSREQPGT-------
A0A519MA34      ------------------------------------MDNNKELFPLSSEQPES-------
A0A519UCX0      ------------------------------------MDNNKELFPLASEQPES-------
R7PCR1          ----------------------------------MANNTVSSTVNQAELKEES-------
A0A350IHV0      ----------------------------MALENNNIDNRPALRNANGEEDGDI-------
A0A1G9E2A9      -------------MVEPTEIQHLGRPIDNE---------------EEESFLSV-------
A0A098LL25      -----------MSLLEDEDKRSLNGSGQRVSFADDSEE--------EDDVFGD-------
A0A2T2YJE8      -----------MTNKESIVLEELENNYAAAVEV------------EEDSGGSD-------
A0A127B287      -----------MSVKTGNNLDELDYHTSNADI-------------EEEDSGSS-------
A0A3M9N829      -----------MSVKAANDLDELDHRLGSDEG-------------EEEDGGAS-------
A0A0P0CSF9      -----------MSVKTVNDLDELDHRLGSGED-------------EDDDGGTS-------
A0A5M8QQB8      -----------MSVKTANDLDELDHRLGSGED-------------EEDDGGTS-------
A0A3M9MNC3      -----------MSVRTVNDLDELDHRLGGVED-------------EEDDGGAN-------
A0A5B6TAX2      -----------MSVKTVNDLDELDHRLGGVED-------------EEDDGGTS-------
A0A5N1IQ33      -----------MAVDKDAELEELIRTAGGEEGT-------------EDDAGAG-------
A0A512AYT3      -----------MALEKFADIDEL-NSRVADTES-------------EEEGGSD-------
A0A5M6CYN7      -----------MALEKFADIDEL-NSRVTDTDS-------------EEEGGSD-------
A0A369QP10      -----------MANKESIVLEELDNS-----------NYASTIEVEEESRGSD-------
A0A126PDF2      -----------MAVNENAELEALIRNAIDGGTEPPTAA--TVGAAADDEADGG-------
A0A2Z3GKA1      -----------MAVNENAELEALIRNAIDGGTEPPTAA--TVGAAADEEADDG-------
A0A502GZP7      -----------MAINENAELESLIRNAIDGGAEQPAAA--TAGGAADEEGSEG-------
A0A519SBU8      -----------MALSENAELEELIRRATGETASQLPPT-GAAAAADEEDLGGG-------
A0A4Q3JNZ3      -----------MALSENAELEELIRRATGETAGQLPPTQGPTVGDEPEDLGGG-------
A0A519Q9V3      -----------MAVSENAELEELIRKATGDTAGQLPPTSGPVLAAEQDDTGSS-------
A0A0M3RW20      ---------------------------------MNTPE--P----ESETEGSG-------
A0A495VFX4      -----------MAKNENTELEDLIRNSLGNQPTVSVPE--P----ESETENSG-------
A0A1S9B3W0      -----------MAVNENAELEELIRNATS-GGVNTPAP--PASESDDDNVGGG-------
A0A1W1VRL3      -----------MAAKEETELEELIRNA---NGIETEDK--E----DE---GDG-------
A0A1M6R305      -----------MAVNENAELEELIRNATGSGGASTVSA--ESEVVEE---GGG-------
A0A4Z0PHK3      -----------MAVNENAELEELIRNA---GGTETNAA--E----DE---GDG-------
A0A2M9B9H9      -----------MAVNENAELEELIRSA---GGAEPNAV--E----DE---GGG-------
A0A4Z0QCY9      -----------MAVNENAELEELIRNA---GGAEPNAA--E----DE---DGG-------
A0A418R9X5      -----------MAAKEDAELEELIRNA---GG--EPEE--E----EE---GGG-------
A0A428JSJ3      -----------MAAKEDAELEELIRSA---GG--EPEE--E----ED---GGG-------
A0A428KI59      -----------MAAKEDAELEELIRNA---GA--EPEE--E----EE---GGG-------
W8F1I6          -----------MAAKEDAELEELIRNA---GA--EPEE--E----EE---GGS-------
A0A246FQC0      -----------MATKEDAELEELIRNA---GG--EEVE--E----DD---GGG-------
A0A372E5P8      -----------MAVKEDAELEELIRQA---GGGEPTED--E----DD---GGG-------
A0A1H3EMW1      -----------MAAKEDAELEELIRNA---GR--ESEE--Q----ED---GGG-------
A0A1H9ZSN3      -----------MAAKEDAELEELIRNA---GG--EPEE--E----DD---GGG-------
A0A5N1J2M4      -----------MMPTQSTELDELE-------------VKPAIVDAEEESSGSD-------
A0A519S476      ------------------------------------------------------------
A0A4Q3JRW8      -----------MAVSENAELEELIRKATGEAAVQLPPTASSASTPELEDIGGG-------
A0A519M923      -----------MALSENAELEELIKRATSDTAGQLPAAQNQPQSAEPEDLGGG-------
A0A4Z0ENW1      -----------MASTENAELEELIRRASASGET--TPPTGPSFAEEEAEDGDN-------
A0A519UDB4      -----------MAMSENAELEELIRRTTTGADS--SSSISAATSEEEAE--DS-------
A0A3S0QKV1      -----------MAVNENAELEELIRNATGGSGA----AAPTASAPEAEEAGSG-------
A0A328BL48      -----------MAVNENAELEELIRNATSGGAA----PTAPAAESEDDSVGGG-------
A0A5R8WLY4      -----------MAVNENAELEELIRNATSGGAA----PTAPAAESEDDSVGGG-------
A0A1I5WSL8      -----------MAINENTELEELIRNATGGSAA--PPETPASSGADPEDDSAS-------
A0A0U3JVM7      -----------MAINENTELEELIRNATGGTAS--PPEAPSASGGDADDDAPG-------
A0A1G1SSV2      -----------MATNENRELEELIRNATGGTAS--LPEAPTVGASEPEDESAS-------
A0A1G1SXV7      -----------MATNENRELEELIRNATGGTAF--PSEAPAVGTGETEEESAS-------
A0A0W8EDI5      -----------MAVNKEAELEELIRASG---------EET------DDVAESS-------
A0A3B7RBP8      -----------MAIDKEAELEELIRSAGST-------EGQ------EEETDTA-------
A0A3R9P8H7      -----------MAANEDAELEEMIRNAGGN-------ESD------GEDDGGG-------
A0A238WIA7      -----------MAVNEEVELEDLVRNAGGE-------A--------DEDDGGG-------
A0A212UCJ7      -----------MAVNEDIELEELIRGAGGD-------A--------EEDQGGG-------
A0A4Z0MQE1      -----------MALNEEADLEELVRGAGGE-------A--------DEDQGGG-------
A0A4Z0PCF4      -----------MALNEEAELEDLVRSAGGE-------A--------DEDQGGG-------
A0A5D6VDG1      -----------MAINENAELEDLIRNSGGT-------PPVE---VQAEEENTG-------
A0A243WHR7      -----------MAVNENAELEELIRNAGGN-------EAEV-----EDDEGAG-------
A0A5B8A0P6      -----------MALKEEAELEELIRNSGGV-------DAEA-----ADEDSEG-------
A0A076HRT9      -----------MAVNENAELESLIRNATGG-------VSAVPVESEPADDGGG-------
A0A4Z0PVM7      -----------MAVNENAELEELIRSAGGA-------EPTA-----EDEDG-G-------
A0A1M6DHW8      -----------MAINENAELEELIRNAGGG-------DTEA-----EGEEGSG-------
A0A4Q5LC61      -----------MAVNENAELEDLIRNAGGG-------DVEA-----EGEDDPG-------
A0A2A8CVM9      -----MNDKNLSRFDSGDMTPAPLRNGHASNRMNGSAHHGGGSSGSSSEANAG-------
A0A3C0ZQC7      MNIGKGDIERIHRDGISQEP----------------------------------------
A0A2E3R1D0      MIDQPYPTAADRGA---------------------PGAPVRGEDPFYYGDRDG-------
A0A2T2USC0      --------------------------------------MNGQVGGMPAPQEDE-------
A0A2T2V0F3      MHDGSAPSGNGHSNRWNSMN---------------PVNGQSQPSGEHGARDDE-------
A0A2T2S682      -----MPRSSSFEYAGDGHPGNGRSAPDDEPSLY-DSAPDGPTGVD--------------
D5H561          --------MAHLQRRDPDQNGQG-----DIVRSW-EGGTNGAAGPSSGRQGIK-------
A0A2H3NWA9      -MASPSLPPNGQNGRHDAAPTPWPAQGQLYDEVY-HPEGNGVS-----------------
A0A2A8CVB6      MSPSSNMSSNGHRP--AGGPVNGIAGASLF---Y-DDNPQRGS-----------------
A0A2P6C1S6      -----MASTNGHPG-----SSQSVSVEDLL---YEDTTSRRSS-----------------
A0A2T2UTM4      -----MASTNGYPSGEEGPGSRSLAVEDLL---Y-DNSDRRSS-----------------
R5RVP0          -----------------------------MPIDNNLDNRPSQVRNEEE--NDL-------
R6A0L2          --------------------------------------METKSINPQEQQDEE-------
R7LG80          ---------------------------------------MNNVPDTFKRDEEE-------
A0A2L2WX98      ------------------------------------MENTNNATIEKEEAQLI-------
A0A285T4L1      ------------------------------------MQNNTL----SNKNEQS-------
G5GD56          ------------------------------------MSGSVQNKNKEEDIQLI-------
R5KD55          -------------------------------------METNPVTQQTEETTEE-------
A0A174QNT3      -----------------------------------METNKTTDLKRTEN---V-------
A0A4S2FGS1      -----------------------------------METKKTTTSSPKEN---V-------
R9I0H0          -----------------------------------METKKTTTSSPKEN---V-------
K5BUT9          -----------------------------------MEYIQENERTLKKDEG-G-------
A0A174FPA3      -----------------------------------MEYIQENERTPKKDEG-G-------
R6S9Y6          -----------------------------------MEYIQENERTPKKDEG-G-------
A0A642LIH6      -----------------------------------MEYIQENERTPKKDEG-G-------
C9KX15          -----------------------------------MEYIQENERTPKKDEG-G-------
R6DAG6          -----------------------------------MEYTQENNEKTVKESGFN-------
A0A3L8AAP1      -----------------------------------MEYTQENNEKTVKESGLN-------
A0A4S2AYX2      -----------------------------------MEYTQENNEKTVKESGLN-------
A0A4Y9H477      -----------------------------------MEYTQENNEKTVKESGLN-------
A0A0E2M2Y7      -------------------------MNLIEDSKNTLAESRSRIYTKEE--TSF-------
A0A0K2J6Z0      -------------------------MNLIEDSKNTLAESRSRIYTKEE--TSF-------
B2RKZ8          -------------------------MNLIEDSKNTLAESRSRIYTKEE--TSF-------
A0A212GC82      -------------------------MNLIEDSKNTLAESRSRIYTKEE--TSF-------
A0A254MU12      -------------------------MNLIEDSKNTLAESRSRIYTKEE--TSF-------
R6CQ93          ------------------------------------MQNNNL----SGKNEQS-------
A0A3D1NQW3      -----------------------------MTPNNINPNSANSDTKQEE--HIT-------
B0MT10          -----------------------------MTPNNINPNSANSDTKQEE--HIT-------
R7JGW9          -----------------------------MTPNNINPNSANSDTKQEE--HIT-------
A0A414Q925      ------------------------------MGKDRFEDLDFIDFN-DSRRQEG-------
A0A415PUS9      ------------------------------MGKDRFEDLDFIDFN-DSRRQEG-------
A0A108TCU0      ------------------------------MGKDRFEDLDFIDFN-DNRRQEG-------
A0A413BA42      ------------------------------MGKDRFEDLDFIDFN-DSRRQEG-------
S3Y344          ------------------------------MRKDRFEDLDFIDFN-DSRRQEG-------
A0A4Q5G8Y8      ------------------------------MGKDRFEDLDFIDFN-DSRRQEG-------
A0A412TGL3      ------------------------------MGKDRFEDLDFIDFN-DSRRQEG-------
A0A413VJ33      ------------------------------MGKDRFEDLDFIDFN-DSRRQEG-------
A0A414L0W6      ------------------------------MGKDRFEDLDFIDFN-DSRRQEG-------
A0A412DP39      ------------------------------MGKDRFEDLDFIDFN-DSRRQEG-------
A0A413ZSE8      ------------------------------MGKDRFEDLDFIDFN-DSRRQEG-------
B0NP84          ------------------------------MGKDRFEDLDFIDFN-DSRRQEG-------
R6AK43          ------------------------------MGKDRFEDLDFIDFN-DSRRQEG-------
A0A412N2D9      ------------------------------MGKDRFEDLDFIDFN-DSRQQES-------
A0A1Y4JYS9      ------------------------------MGKDRFEDLDFIDFN-DSRQQES-------
R6LHA4          ------------------------------MGKDRFEDLDFIDFN-DSRQQES-------
A0A3D2BF46      --------------------------------MEE-NRNVNNVPAEGNEDSIN-------
A0A4Y1WUN1      --------------------------------MEE-NRNVNNVPAEGNEDSIN-------
A0A4Y1XL94      --------------------------------MEE-NRNVNNVPAEGNEDSIN-------
A0A358R538      --------------------------------MTE-RTINPQ---PAEETTGN-------
A0A1Y4AAB8      --------------------------------MIEQTPNTQHAPQNETSEAGM-------
A0A1Y3WWY9      --------------------------------MIEQQPNNIPQQAFNDDQAGT-------
A0A1Y4U5L4      --------------------------------MIEQQPNNIPQQAFNDDQAGA-------
A0A1Y3VCJ1      --------------------------------MAE-IQFNTQTRDKIHDQTPA-------
A0A1Y3QTW7      --------------------------------MTEYNNQQQHLQNDENENGSG-------
R6XWY7          --------------------------------MTEYNNQQQHLQNDENENGSG-------
A0A4Y1X9Y9      --------------------------------MTEYNNQQQHLQNDENENGSG-------
A0A4Y1WM66      --------------------------------MTEYNNQQQHLQNDENENGSG-------
A0A174AVF1      --------------------------------MTEYNNQQQHLQNDENENGSG-------
A0A656Q4F4      --------------------------------MTEYNNQQQHLQNDENENGSG-------
A0A1Q6EIY0      --------------------------------MTE-QNINPHLLNGESENTNG-------
A0A5B5VN71      --------------------------------MTE-QNINPHLLNEESENTNG-------
E4M8L3          --------------------------------MTE-QNINPHLLNEESENTNG-------
I3YQ50          --------------------------------MTE-QNINPHLLNEESENTNG-------
R5UEY8          --------------------------------MTE-QNINPHLLNEESENTNG-------
A0A1H4D866      --------------------------------MTE-QQINSPQQQGNDEMTGA-------
A0A5B3G4Y7      --------------------------------MAE-QQINSQIQTNNEELTNT-------
A0A374A9J5      --------------------------------MAE-QQINSQIQTNNEELTNT-------
A0A5B3GQN5      --------------------------------MAE-QQINSQIQTNNEELTNT-------
A0A1Q6E9S3      --------------------------------MAE-QQINSQIQTNNEELTNT-------
D4IJ36          --------------------------------MAE-QQINSQIQTNNEELTNT-------
A0A3E5HPT8      -----------------------------------------MALT-EE--EKS-------
C6IJ48          -----------------------------------------MALT-EE--EKS-------
Q8A3U2          -----------------------------------------MALT-EE--EKS-------
A0A3R6S1H6      -------------------------------------MKNEELIE-DG--TNA-------
A0A3R6SD81      -------------------------------------MKNEELIE-DG--TNA-------
A0A354WXN6      ------MVVCSIRLGGCSLLNCHIIQQITQSTVME-QQENNKNIE-QE--EQE-------
R5IP14          --------------------------------MAK-EQQEIYGQQVEESTDNG-------
A0A316SZX7      --------------------------------MSE-QNINQPQQNAPA--EEE-------
A0A1Y4AIY1      --------------------------------MKV-ENPSNGPRWNEA--NSG-------
F3ZRU7          --------------------------------MEQ-QNLDNKIQQEHT--EQE-------
A0A0J6CIR2      -----------------------------------------MNLR-RE--ENE-------
A0A3D8HG59      --------------------------------MEP-NQELENLQQ-QE--ENE-------
A0A3R6S408      --------------------------------MEP-NQELENLQQ-QE--ENE-------
A0A1C5Q1F3      -------------------MDLRDFGFNFNCHLNI-GCEMTNRKNTQS--DHT-------
R7A239          -------------------MDLRDFGFNFNCHLNI-GCEMTNRKNTQS--DHT-------
A0A3R6HIK7      --------------------------------MST-EYNPENNIRIEE--ESV-------
K5ZVW7          --------------------------------MST-EYNPENNIRTEE--EST-------
A0A1Y4D5Z0      ------------------------------MIDNR-ENTQRDYAQ-EN--ENT-------
A0A413VXJ7      --------------------------MSTEQNINK-ESKTSK-NS-KQ--EEE-------
I9RSN9          --------------------------MSTEQKINK-ESKASK-SS-EK--EEE-------
U6RJK5          --------------------------MSTEQKINK-ESKASK-SS-EK--EEE-------
A0A1Q6GA32      --------------------------MSTEQKINK-ESKASK-SS-EK--EEE-------
I9RPU6          --------------------------------MNT-EYKNND-VR-KQ--EPE-------
I8YFS5          --------------------------------MSI-ESQNSE-LR-EK--ESE-------
A0A4Q5F7I7      --------------------------------MSI-ESQNSE-LR-EK--ESE-------
I8Y597          --------------------------------MSI-ESQNSE-LR-EK--ESE-------
A0A1Q6GBF5      --------------------------------MNT-EQKNNN-NP-GQ--ESE-------
I8YFZ3          --------------------------------MSA-EYKNND-IR-KQ--ESE-------
A0A4V1YNX8      --------------------------------MNT-EYKNND-AR-KQ--ESE-------
A0A1Q6GDH2      --------------------------------MNT-EYKNTD-VR-KQ--EPE-------
U6RSB0          --------------------------------MNT-EYKNND-VR-KQ--EPE-------
I9GXM2          --------------------------------MNT-EYKNND-VR-KQ--ESE-------
I9SIK1          --------------------------------MNT-EYKNND-VR-KQ--ESE-------
A0A4Q5FNG1      --------------------------------MNT-EYKNND-VR-KQ--ESE-------
I9TP59          --------------------------------MNT-EYKNND-AR-KQ--ESE-------
R5S343          --------------------------------MKN-TEQDLFEFE-EE--KSG-------
A0A1M6K7I9      --------------------------------MNE-EQKVQSNMT-AQ--EEQ-------
A0A5M6A8C8      --------------------------MKSEQQMNE-EQKVQTNMA-VQ--EEQ-------
A0A4V1YPN7      --------------------------------MNT-EPQNNNEIR-DQ--ESE-------
A0A4Q5F874      --------------------------------MNT-ESQNNNDIR-EQ--DLE-------
A0A641LV22      --------------------------------MNT-ESQNNNDIR-EQ--DLE-------
A0A3R5ZMK1      --------------------------------MNT-EQETN--TR-VE--ESE-------
A0A3E4ZTK7      --------------------------------MNT-EQETN--TR-VE--ENE-------
A0A1Y3ZIA4      --------------------------------MNT-EQETN--TR-VE--ESE-------
K5Y1A4          --------------------------------MNT-EQETN--TR-VE--ESE-------
A0A4Q5CIT0      --------------------------------MNT-EQETN--IR-ME--ENE-------
A0A3R6K8X4      --------------------------------MNI-EQETN--IR-ME--ENE-------
A0A414GI87      --------------------------------MNT-EQETN--IR-ME--ENE-------
A0A415BDM7      --------------------------------MNT-EQETN--IR-ME--ENE-------
A0A412DM15      --------------------------------MNT-EQETN--IR-ME--ENE-------
A7AEU7          --------------------------------MNT-EQETN--IR-ME--ENE-------
A0A1Q6I3T6      --------------------------------MNT-EQETN--IR-ME--ENE-------
A0A414XX40      --------------------------------MNT-EQETN--IR-ME--ENE-------
A0A3R6BKI7      --------------------------------MNT-EQETN--TR-VE--ESE-------
A0A414LPI6      --------------------------------MNT-EQETN--TR-VE--ESE-------
A0A412M2W1      --------------------------------MNT-EQETN--TR-VE--ESE-------
K5ZX55          --------------------------------MNT-EQETN--TR-VE--ESE-------
A0A5F0U645      --------------------------------MNP-EQETNM-LR-EE--ENE-------
K5ZBN2          --------------------------------MNP-EQETNM-LR-EE--ENE-------
A0A0J6CKW3      --------------------------------MNP-EQETNM-LR-EE--ENE-------
A0A0F5IQM7      --------------------------------MNP-EQETNM-LR-EE--ENE-------
A0A496CDT3      --------------------------------MNP-EQETNM-LR-EE--ENE-------
S0GLB0          --------------------------------MNP-EQETNM-LR-EE--ENE-------
A0A3R6NLC1      --------------------------------MNP-EQETNM-LR-AE--ENE-------
A0A416WYC9      --------------------------------MNP-EQETNM-LR-AE--ENE-------
A0A0F5IT40      --------------------------------MNS-EQETIN-LR-RE--ENE-------
A0A496CX20      --------------------------------MNS-EQETIN-LR-RE--ENE-------
A0A5F0UBI0      --------------------------------MNS-EQETIN-LR-RE--ENE-------
S0GSI7          --------------------------------MNS-EQETIN-LR-RE--ENE-------
K5YB65          --------------------------------MNS-EQETIN-LR-RE--ENE-------
A0A0F5IWP9      --------------------------------MNS-EQETTY-LR-GE--ENE-------
A0A0F5IZT8      --------------------------------MNS-EQETTY-LR-GE--ENE-------
A0A417LKQ2      --------------------------------MNS-EQETTY-LR-EE--ENE-------
A0A416TME1      --------------------------------MNS-EQETTY-LR-EK--ENE-------
A0A416XPE8      --------------------------------MNS-EQETTY-LR-EK--ENE-------
A0A5C8KAD6      ------------------------------------------------------------
A0A5N1J695      ---------------------------------------MLQVNKDIPNSEES-------
A0A1H4ADG3      -------------------------------------MQTTTLDQLVPVKETK-------
A0A5B8VUR8      -------------------------------------MHTNTLDRLVPIKESK-------
A0A2A4G4B1      --------------------------------------MISSGSPLKHDDEME-------
A0A3N2M1H3      ---------------------------------------MDNTKTKPEGISGFSD-----
A0A4S2G8T2      ---------------------------------------MDNTKTKPEGISGFSD-----
A0A212K7W5      --------------------------------------------MKRNTEEDF-------
F5IU11          --------------------------------------------MKKNTEEDF-------
A0A3N2N6F7      -----------------MQNNTQ--------QPLSQQMPVYQAAPVVSEEEDS-------
A0A4P7VVU7      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------
A0A2V1ILM4      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------
A0A3N2L0E8      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------
A0A3N2LFC5      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------
A0A553LCN8      -----------------------------------MEYTQENKEKTAGESGFN-------
K0XJ09          -----------------------------------MELIQETKNDKKNEGG---------
R5EUZ0          -----------------------------------MELIQETKNDKKNEGG---------
W0EQS0          -----------------------------------MELIQETKNEKKNEGG---------
A0A1Y3WE15      -----------------------------------MELIQETKNEKKNEGG---------
A0A1Y4GUK3      -----------------------------------MELIQENKNEKKNEGG---------
A0A352Z1R7      ---------------------------------MTSNVSIPPSQPLLRSGEN--------
A0A0A2F501      ---------------------------------MKQEENSRSAQGALAEQDSF-------
R5B7P0          ------------------------------------MENNINTDNNTRQQEET-------
R5B0L5          -------------------------------------MEEPTEHTPQQLSTTQ-------
A0A374THP7      -------------------------------------------MLRRNQADDF-------
A0A3R5XWG1      -------------------------------------------MLRRNQGDDF-------
A0A5P0Y910      -------------------------------------------MLRRNQGDDF-------
A0A5P0XQC0      -------------------------------------------MLRRNQGDDF-------
A0A414YFM3      -------------------------------------------MLRRNQGDDF-------
A0A5P0VXP6      -------------------------------------------MLRRNQGDDF-------
A0A5P0W892      -------------------------------------------MLRRNQGDDF-------
A0A0A2EVS5      --------------------------------------MDEKVTTYKRNVEEY-------
A0A1T4NAJ7      --------------------------------------MDEKVTTYKRNVEEY-------
A0A255T941      -------------------------------------METNNNNQTNEQNDDF-------
A0A3N2KCL3      -----------------------------------MAETIKSEARKSVNAGSA-------
A0A4P7VSV0      -----------------------------------MAETIKSEARKSVNAGSA-------
A0A2V1IJY1      -----------------------------------MAETIKSEARKSVNAGSA-------
A0A4P7VXK7      -----------------------------------MAETIKSEVRKSVNAGSA-------
A0A1Y4CHN5      ------------------------------------MADNISANNQVKQSEDF-------
A0A1M6I2S6      --------------------------------------MIEKKTAVGKPADDF-------
A0A1Y3V692      --------------------------------------MIEKKTAVGKPADDF-------
F3PXM2          --------------------------------------MIENKNAVGKPADDF-------
A0A3E4ZNL4      --------------------------------------MMEKRINAGKPVDDF-------
A0A174AHH7      --------------------------------------MIKNRTNAGKPADNF-------
A0A174JCE8      --------------------------------------MIKNRTNAGKPADNF-------
A0A3E4JMC4      --------------------------------------MIKNRTNAGKPADNF-------
A0A412SND6      --------------------------------------MIKNRTNAGKPADNF-------
A0A414IEQ9      --------------------------------------MIKNRTNAGKPADNF-------
A0A415UKN5      --------------------------------------MIKNRTNAGKPADNF-------
A0A0M1W8D8      --------------------------------------MIKNRTNAGKPADNF-------
A0A3R6GKX5      --------------------------------------MIKNRTNTGKPTDDF-------
A7V4S1          --------------------------------------MIKNRTNTGKPTDDF-------
B0NU19          --------------------------------------MIKNRTNTGKPTDDF-------
D4V601          --------------------------------------MIKNRTNTGKPTDDF-------
A0A4Q0U3M9      --------------------------------------MIKNRTNTGKPTDDF-------
A0A4R4H1Q2      --------------------------------------MIKNRTNTGKPTDDF-------
A0A397WLT5      --------------------------------------MIKNRTNTGKPTDDF-------
A0A3R6GM96      --------------------------------------MIKNRTNTGKPTDDF-------
A0A015XH67      --------------------------------------MIKNRTNTGKPTDDF-------
A0A078RZN2      --------------------------------------MIKNRTNTGKPTDDF-------
A0A4R4I3T9      --------------------------------------MIKNRTNTGKPTDDF-------
A6L0K5          --------------------------------------MIKNRTNTGKPTDDF-------
A7ACT5          --------------------------------------MIKNRTNTGKPTDDF-------
A6KY94          --------------------------------------MIENRTSVGKSAEDF-------
A0A173UQR8      --------------------------------------MIENRTSVGKSAEDF-------
A0A3R6HK75      --------------------------------------MIENRTSVGKSAEDF-------
A0A412B7D1      --------------------------------------MIENRTSVGKSAEDF-------
A0A412VNY9      --------------------------------------MIENRTSVGKSAEDF-------
A0A414LTU9      --------------------------------------MIENRTSVGKSAEDF-------
I9Q4U4          --------------------------------------MIENRTSVGKSAEDF-------
A0A373ISF0      --------------------------------------MIEKKAAAGKPADDF-------
U6RF62          --------------------------------------MIEKKAAAGKPADDF-------
A0A662ZZD5      --------MDQRRFIPHFVGCANIQVTFRKGITLYFYNMTEKKTTASKPADDF-------
A0A395YYT3      --------------------------------------MTEKKTTASKPADDF-------
A0A642JYJ3      --------------------------------------MTEKKTTASKPADDF-------
A0A015UXN7      --------------------------------------MTEKKTTASKPADDF-------
A0A5M5W148      --------------------------------------MTEKKTTASKPADDF-------
A0A3A5TI83      --------------------------------------MTEKKTTASKPADDF-------
A0A415NEB6      --------------------------------------MTEKKTTASKPADDF-------
A7AJ60          --------------------------------------MTEKKTTASKPADDF-------
A0A016E4F9      --------------------------------------MIEKKTIVGKSTDDF-------
A0A4Q5CFJ7      --------------------------------------MIEKKTIVGKPTDDF-------
A0A108TH71      --------------------------------------MVEKKTPVGKPADDF-------
I8VXH0          --------------------------------------MVEKKTPVGKPADDF-------
A0A412S0N6      --------------------------------------MVEKKTPVGKPADDF-------
A0A412IIJ0      --------------------------------------MVEKKTPVGKPADDF-------
A0A0P0FM97      --------------------------------------MVEKKTPVGKPADDF-------
R6KTP3          --------------------------------------MVEKKTPVGKPADDF-------
A0A139LU87      --------------------------------------MVEKKTPVGNPADDF-------
A0A1C6B3Y5      --------------------------------------MVEKKTPVGKPADDF-------
E2NMQ4          --------------------------------------MVEKKTPVGKPADDF-------
A0A412YDB9      --------------------------------------MVEKKTPAGKPADDF-------
R7DY01          --------------------------------------MVEKKTPAGKPADDF-------
A0A414LGK8      --------------------------------------MVEKKTPAGKPADDF-------
A0A415IPQ4      --------------------------------------MVEKKTPAGKPADDF-------
A0A3E5BRW7      --------------------------------------MVEKK----KPADDF-------
K9DXS6          --------------------------------------MVEKK----KPADDF-------
A0A1M6KFV3      --------------------------------------MVEKK----KPADDF-------
A0A1Q6G7L3      --------------------------------------MVEKK----KPADDF-------
A0A413H235      --------------------------------------MVEKK----KPADDF-------
A0A1M5B2J8      -------------------------------------MATIQKKIQVHNTQDF-------
A0A255RCT5      -------------------------------------MATIQKKTQVQNTQDF-------
A0A1Y4GLF5      -------------------------------------MAINKDTTKNKQTDDF-------
A0A1H3XSC0      -------------------------------------MSINQK--RPTQTDDF-------
A6LE40          ------------------------------------MMTINPKNTKPGQQDDF-------
A0A4Y1VPX5      ------------------------------------MMTVNQKNIKPGQQDDF-------
B3JI46          ------------------------------------MMTVNQKNIKPGQQDDF-------
R6NN15          ------------------------------------MSETQQHTRPAAKADDF-------
A0A358R8U0      -------------------------------------MEMTQNTSPAEPMDDS-------
R6WSB6          -------------------------------------MEMTQNTSPAEPMDDS-------
A0A4Q5ENK6      -------------------------------------MATIQNKSTVQNTQDF-------
A0A401LPX7      -------------------------------------MATIQNKSTVQNMQDF-------
A0A3A5Z900      -------------------------------------MATIQNKSTVQNTQDF-------
A0A3R6EGW5      -------------------------------------MATIQNKSTVQNTQDF-------
A0A285TGL6      -------------------------------------MATIQNKSTVQNTQDF-------
A0A3A5RFX4      -------------------------------------MATIQNKSTVQNTQDF-------
A0A1Q6IUW9      -------------------------------------MATIQNKSTVQNTQDF-------
A0A3R6NPG7      -------------------------------------MATIQNKSTVQNTQDF-------
A0A413XDP6      -------------------------------------MATIQNKSTVQNTQDF-------
K6AP24          -------------------------------------MATIQNKSTVQNTQDF-------
A0A662ZYI7      -------------------------------------MATIQNKSTVQNTQDF-------
A0A078RYI7      -------------------------------------MATIQNKSTVQNTQDF-------
C7XEQ8          -------------------------------------MATIQNKSTVQNTQDF-------
D7INX6          -------------------------------------MATIQNKSTVQNTQDF-------
K5ZG55          -------------------------------------MATIQNKSTVQNTQDF-------
A0A3N2N9B8      --------------------------MAELLDLSSAPASPSATTRKKTAASNT-------
A0A3N2NMI0      --------------------------------MAENNATAPAQRRKKTPESTP-------
A0A359I8H7      -------------------------------------MSDNINVTQESEAAEE-------
A0A3N2KA63      -------------------------------------MSDNINVTQESEAAEE-------
A0A4Q0IMT7      -------------------------------------MSDNINVTQESEAAEE-------
A0A3B9FAU3      -------------------------------MATNNSLESEKNYSATAENNELENGG---
A0A3C1E5L7      -------------------------------MATNNSLESEKNYSATAENNELENGG---
A0A4Q0UAV1      --------------------------------------MPTKMQAAPKRPADS-------
A0A354SN68      --------------------------------MYTNMDNNENTSLSTEKVEDE-------
A0A3N2N595      ----------------------------------MAEVNKIQSNKKSGAAGA--------
A0A0A2DUD9      --------------------------------MIQNTTTVVEKPAAEGQQENF-------
A0A3P1ZBJ5      -------------------------------------MVENEVNAPQNEQTTG-------
R5FHS9          ---------------------------------MPNNQIQSQQPQQNQQSDDS-------
A0A413TW79      --------------------------------------MQNAPGRRPQQAEDF-------
A0A3E5E9M7      ------------------------------MIQNNQATMQNVLVRRPQQAEDF-------
A0A3E4SK73      ------------------------------MIQNNQATMQNVPGRRPQQAEDF-------
A0A415GGC6      ------------------------------MIQNNQATMQNVPGRRPQQAEDF-------
A0A413DBH9      ------------------------------MIQNNQATMQNVLVRRPQQAEDF-------
A0A495WI87      -------------------------------------MAAVQNNPKSKQSEEF-------
A0A354M4S6      -------------------------------------MAAVQNNPKSKQSEEF-------
R7DH52          -------------------------------------MAAVQNNPKSKQSEEF-------
A0A4Q5E7L5      -------------------------------------MTINQKNTKPGQQNDF-------
A0A4P8LP09      -------------------------------------MAVNQKNTRPGQADDF-------
A0A4R4GZU7      -------------------------------------MAVNQKNTRPGQADDF-------
A0A016CWA4      -------------------------------------MAVNQKNTRPGQADDF-------
A0A1C6H117      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A415TAH7      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A0M1W0V2      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A139KA16      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A174VQ92      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A1Q6HCG0      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A1Y4JYM9      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A3A5QW67      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A3A5RQE6      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A3A6BP07      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A3E5E153      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A3Q9IP20      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A412WV15      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A413ICP6      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A414KYB9      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A5B3FWR2      -------------------------------------MAVNQKNTKPGQPDDF-------
E5WX00          -------------------------------------MAVNQKNTKPGQPDDF-------
K0X3P3          -------------------------------------MAVNQKNTKPGQPDDF-------
A0A3A5Z014      -------------------------------------MTINQKNIKPGQQDDF-------
A0A1M4YZ07      -------------------------------------MSINQKNTKPGQPDDF-------
A0A078S3Q8      -------------------------------------MAINQKNIKPGQQDDF-------
A0A069SJV7      -------------------------------------MAINQKNIKPGQQDDF-------
A0A3E5DXI5      -------------------------------------MAINQKNIKPGQQDDF-------
A0A3E5EM98      -------------------------------------MAINQKNIKPGQQDDF-------
A0A3E5F453      -------------------------------------MAINQKNIKPGQQDDF-------
I9T3G6          -------------------------------------MAINQKNIKPGQQDDF-------
A0A4Q5E5M7      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A0P0FQW1      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A5M5C0W6      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A642LZ22      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A5M5YM86      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A642LE65      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A5M5Y0P8      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A642NJ89      -------------------------------------MTVNQKNIKPGQQDDF-------
C3RFN5          -------------------------------------MAINQKNIKPGQQDDF-------
A0A3E4SYU0      -------------------------------------MAINQKNTKPGQPDDF-------
A6LGY1          -------------------------------------MAINQKNIKPGQQDDF-------
K5ZSH4          -------------------------------------MAINQKNIKPGQQDDF-------
A0A078T2W6      -------------------------------------MAINQKNIKPGQQDDF-------
A0A3R6EAF7      -------------------------------------MAINQKNTKPGQPDDF-------
A0A5C6L2P1      -------------------------------------MTVNQKNIKPGQQDAF-------
A0A412MJT7      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3E4WKT5      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3A5YY33      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A078TAH2      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A1E9CFZ7      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A373FYU5      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3A5TZ72      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3A5XBP2      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3A6MEG9      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3E4JP35      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3E4KP40      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3E4NX82      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3E4XFU8      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A412RG70      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A412TD37      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A413GAA4      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A414M7I4      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A496BTA0      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A496D2V6      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A4Q5EN83      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A4Q5G1P5      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A5C6KCA6      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A5M5AHM5      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A641WNS6      -------------------------------------MTVNQKNIKPGQQDDF-------
E5UZA2          -------------------------------------MTVNQKNIKPGQQDDF-------
A0A069SMG6      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A1Y4PQK7      --------------------------------------MTIQNNTKPGQADDF-------
A0A1Y4IH41      --------------------------------------MAIQNNTKPGEADDF-------
A0A3A6AAP4      --------------------------------------MAIQNNTKPGQADDF-------
A0A1Y4DYA7      --------------------------------------MNENNTKSDLFLQES-------
A0A1Y3X4I9      -------------------------------------MSTLSDKETELFLDELEKSSSSG
A0A1Y4FNK8      -------------------------------------MATQNNPARPKQADDL-------
A0A355FD59      ------------------------------------MALSQNNNVKQKQPEDF-------
A0A359CEZ9      ------------------------------------MALSQNNNVKQKQPEDF-------
A0A353Q7B4      ------------------------------------MALSQNNNVKQKQPEDF-------
F8X3A5          ------------------------------------MTSVQHNKTERKQTEDL-------
A0A1M3KVR9      ------------------------------------MTPVQHNKTEQKQTEDL-------
A0A4Y9IJS3      ------------------------------------MTSVQHNKTEQKQTEDL-------
A0A4Q5WS95      -----------------------------------------MINRPDQKSTPF-------
A0A501VZX6      ---------------------------------------------MPSSENNI-------
A0A399SH26      --------------------------------------MSSSINNAPNNEENL-------
A0A501W1A9      -----------------------------------------MDKNKSTKEDNL-------
A0A0E3ZGV6      -----------------------------------------MDKNKVNAEDNL-------
A0A1I2N4S1      -----------------------------------------MDKNKTNSEDNL-------
A0A2T5YE44      -----------------------------------------MDKNKTNSEDNL-------
A0A1V9FHD0      ----------------------------------------MQTHKKTGNEMNI-------
A0A4V4H170      ----------------------------------------MQTNKKTGNEMNI-------
A0A1V9F098      ----------------------------------------MQTNKKTGNEMNI-------
A0A4R2VU64      ----------------------------------------MQTNKKTGSEMNI-------
A0A4S8HY23      ----------------------------------------MITNKKTGNEMNF-------
A0A1V9F383      --------------------------------------MQPNIN--TKNEKNI-------
G8TRZ6          --------------------------------------MQTNINSKSKSEKNI-------
A0A543WA52      ---------------------------------------------MSTEDENL-------
A0A1M5BA90      --------------------------------------MEPKRHAT-EKEKNA-------
A0A512B879      --------------------------------------MEAKRPIILKKEKGV-------
A0A559PPI3      ----------------------------------------MSYNNKSAKNENL-------
A0A1T5CS78      ----------------------------------------MKYNSNTGKEDNL-------
A0A0Q9Z8F1      ----------------------------------------MKYNSKTGKEDNL-------
A0A2N0U0M7      ----------------------------------------MKYNSKTGKEDNL-------
                                                                            

A0A1T5MMH4      IDFNKLKV----I----VRNNLVWIALIFLVIN-LTAYLI-IRYT-QDRYESFSEIKLDV
A0A2W4R1L8      IDFSKLRT----I----IRNNRLWILAIFVVIN-LLTYLLFIRYS-PDLYESHSEIKLDI
A0A2E5CV79      ----MELM----G----ILRFHYKLILTITLFG-IMIFTY-RTYTIHPVYRSTSSIIIKE
A0A2D4ZVH1      IDLIKVFN----I----LLLHKWALIGITVLFT-VVAIIF-AQLQ-TPIFQSTGTLIVSE
A0A0K8QSK7      SMIKPFLL----K----LLGKWYWFVLSVVLFL-AAAWLL-TRYS-MPVYQSSSSLLILE
A0A1V6CN82      FNYKRLVS----E----LISHWYLFVLFMGIGL-AGAWLY-NRYT-TTMYSARASIMILE
A0A1M4XZ45      IDLKKIIF----K----LLHNWYWFVLSIIVAL-SLAFLY-NRYT-TPVYEIKASMLVEE
A0A399D319      IDLKKIIF----R----FLRNWYWFAFVVAITL-GMAFLY-NRYT-TPIYEISSSLLVEE
A0A1M6GR99      LNIQDIFK----L----FFKNIWIVISCIIVAL-GIAYFY-NWYS-IPTFKVSATLLLKD
A0A1M6TTV4      LDFDKIKQ----V----FVKNVIWMLLILLLIN-ASTVLY-VRYT-KPIYSSESILKLDI
A0A4Q8RX32      DDFNVIFR----K----LAKYWKVFPISILFFV-SLGVIY-NKLA-EPIYEIGAKVVVHE
K0X1U5          IDIVALWR----A----ACRKWYLFAGSVVVCV-ALVVCY-LKIA-KPVYEVSADILVNE
R5EXK3          IDIVALWR----A----ACRKWYLFVGSIVVCV-ALVVCY-LKIA-KPVYEVSADILVNE
A0A401UAP7      IDFSKLKS----I----LLKNTVWILLLFILCN-LSAYLY-IRYT-KNVYEAEAEIKLEV
A0A1W2GF52      FDFEKFRQ----V----FASGWPWVLGILITTM-SLSFLY-MRYT-KPIYSAESILKLDI
A0A2G5L7B8      IDFDKLNQ----V----FIKNLPWIILILILFN-AGTFLY-LRYT-KPIYSSESILKLDI
A0A523GAC0      IDIEKLHT----V----LGKSWLWIMLIVLSTN-LTAYLV-IRWT-KPLFESYSDIKLNV
L8JW09          IDLDKALT----V----LRKSIPWILLIFIVTN-LSAYLY-IRWT-KPLYESESELKLDV
A0A5C7MX19      ----------------------LWIIVLTIITI-IISLVY-LRYA-PKIYESNATMLFST
A0A364XUP5      IDINKLRV----T----IWDNILWILLIFVVTN-TAAYLV-IRYS-KDIYQSVSELKLDI
A0A1M5RLA9      LDLNKLKT----T----LKRNWLWLIILFLVIN-SVAYLK-VRYT-KNLYESSSELKLDI
A0A385SFR9      LDLNKLKI----I----FKRNWLWLVVLFLVIN-SIAYLK-VRYT-KNVYESSSELKLDI
A0A5M4A9J4      IDFKKYFF----L----FLSNWYWFVLAVFFTI-GAAWVY-HRFT-NPLYAVSASLLINE
A0A5M4B1C7      IDFRKYFS----I----YRSYWYVFALTAGIAL-ITAWFY-HKLT-NPQYAVSASLLVNE
A0A0D3LFR6      IDFDKLFS----V----LKKSLPIIVVIFLVCN-MGAYLY-IRYT-KPLFQSNSELQLTE
M7N6D4          IDFDKLYN----V----MKKSLPIIIVIFLVCN-LSAYLY-LRYT-KPLYRSDSELQLGV
A0A1Q3ZMZ7      -----------------------------------MGYIY-LRYT-KSVYESSAIIQIQD
A0A2D8JJW3      FSIYDFLY----F----LKRNYIYILIITLFCF-LVGCFL-TLRI-KPIYSSYAEIEIVK
A0A2W2AFF7      LNVHKLIG----I----VMSHWVWFAVSLFLTL-ILSFVL-LRYS-TPAYKINATVLIND
A0A2N5YXE2      FDPRTFFT----I----FKKNFWLILIIFVVSL-AAGYAY-FRYT-RPVYKTTTVLQIKN
A0A2W1NDY9      IDIDILKT----V----FKKNWIWLLLCVIIGV-SIAFVY-LRYT-KPIYESRAIIQRSL
A0A5C8AQR5      YNPHILSS----V----LRRNWYWPLAFIFLFF-CFAFLY-LRYT-KAIYSSNTLIQIEN
A0A1G0CI31      YNPLIAAT----I----VKRYWWWTLLFVTCFT-AIAFVY-LRYT-KPIYDSSMVIQLGE
A0A556N0M0      YNPIIVNV----V----LRRYWWWVLLLILFFL-GVAFFY-LRYT-KPVYDSTMVIQLVE
F2IKD6          YNPIIAQV----I----LRRYWWWVLLLIIFFM-SVAFFY-LRYT-KPVYDSTTLIQLVE
A0A1I7BM74      FDLDIIRN----V----LKKNFLFALLIIAFFG-ALSFLY-LRYT-KPVYQSQMVIQIDN
A0A2G2FJ17      FDTDILRI----V----IRKNWIWLMLIATILL-SSAFLY-LRYT-KPVYESKMLIQISN
A0A077ENE7      INLLDILK----Y----LLHHWKWFVLSILIFG-GYYYYQ-YSKT-PFVYNSSEIVMVKT
T0NN57          INVLDLLK----Y----LLHHWKWFALSILIFG-GYFYYQ-YSKS-PFVYSRSEVVMIKT
X5K347          INVLDLLK----Y----LLHHWKWFALSILIFG-GYFYYQ-YSKS-PFVYSRSEVVMIKT
A0A2I0QZ80      FDTNILKI----V----IKRNWYWCVLIFSLFI-VLGFLY-LRYT-KPVYESRMLIQINS
A0A3E1F1A3      LDFKVLKI----V----IKRNWYWCVLISLILG-ILAFSY-VRYT-KPIYESKMLIQINS
A0A2U2XBJ3      FDLKVLKI----V----IKRNWYWCALISILLV-VSAFIY-VRYT-KPVYESSMLIQLNS
A0A4Q4KU94      FDLKVLKI----V----IKRNWYWCAIISILFF-VFAFIY-VRYT-KPVYESKMLIQLNS
A0A2U1FKU2      FSVEEFLF----S----LLSSWKWIVGSVVACA-LIAYIY-VQNQ-SPVYHAQATVLIKS
A0A0A2F954      FSLEEFFL----G----LLTSWKWIVASVLACL-LIAYIY-IQRQ-SPIYHAQATVLIKS
A0A0A2FW91      FSLEEFFL----G----LLTSWKWIVASVLACL-LIAYIY-IQRQ-SPIYHAQATVLIKS
A0A2D2N2N1      FSLEEFFL----S----LLTSWKWIVASVLACL-LIAYIY-IQRQ-SPIYHAQATVLIKS
Q7MWZ2          FSLEEFFL----S----LLTSWKWIVASVLACL-LIAYIY-IQRQ-SPIYHAQATVLIKS
T2NDT6          FSLEEFFL----S----LLTSWKWIVASVLACL-LIAYIY-IQRQ-SPIYHAQATVLIKS
W1R7P9          FSLEEFFL----S----LLTSWKWIVASVLACL-LIAYIY-IQRQ-SPIYHAQATVLIKS
A0A1R4AFZ0      FSLEEFFL----S----LLTSWKWIVASVLACL-LIAYIY-IQRQ-SPIYHAQATVLIKS
A0A1R4DVZ7      FSLEEFFL----S----LLTSWKWIVASVLACL-LIAYIY-IQRQ-SPIYHAQATVLIKS
A0A5M4B212      RNYRKYLF----L----LLSHWYWFAIAIVLTS-IGTWLY-YRYA-HPTYAVSATMLIHE
A0A1T5K9D4      INLVDIFF----Y----LLNHWYWFVLCIGLAV-AFTSYR-YAKT-PFSYRSNATIIIKN
A0A3D1KEX9      MDIFSILRICVAV----FLRNWKWFLLSVVACL-LFALLF-VKKQ-PRVYSRQSTLLIEN
A0A358Y7S2      FNPLILEE----I----LKRHWRAPIFYSTIFL-IFAYLY-IRYS-VPIYQTKALVQVVE
A0A1X7J248      VDFFKLKT----I----LKKNLPWAILLIIIAV-FVAFLY-VRYT-NVKFQSYAELKLNK
E4TQD2          VDFYKLKT----I----LKKNLPWAILLIAIAV-FVAFIY-VRYT-NVKFQSYAELKLNK
A0A2J6HHN3      FDFKLFLY----I----AKRNLKRIILFFIVLF-LFLFLY-LRYT-QPIYESSTIVQLNS
A0A1Y3WMT8      VDVLALWR----A----ARKRWYLFAGSVFICV-VLVACY-LKIA-KPQYAISADILVNE
A0A1Y4GQU1      VDVVALWR----A----ICRKWYLFVGSVVVCV-ALVACY-LKIA-KPQYEVLADILVNE
A0A1V5W8T5      FDVSKLIH----I----LRQNFIFYIIFGLIAG-ISAFTY-LRYT-PPIFDAYTVIQINE
A0A2T8HKA9      INVLDLLK----Y----LFVHWKWFLLSVLFFG-GYYYYQ-YSKT-PFVYSKAAILMIKT
A0A3B8INU3      IDTEKIAS----V----LRRSIVWVVLIIVGAV-ASAYLV-VRYT-KPLYESVSDIKLNF
A0A414ZBF2      TVMADMIG----V----LAHHRKWFILSVAVCL-LVGFIY-VRST-PKTFSRTATILVKD
A0A1Q3Q573      FNLGLLIY----I----LNKSILWIILIVAITV-FASFIY-LRYT-PRIYEATTKMILQL
A0A662BAY3      YEIKKILK----R----LLSYWYWFLICIILAV-SIAYVY-NRYA-TPIYEITSSLLLEV
A0A4U3L369      FDIKKVIG----N----IIANWYYFVLGLVLML-VLAFLY-VRYT-EPVYQVNAGIMVED
A0A357YNR3      VDVLSILM----K----YLIHWKWFLVSIFICI-FLAVVY-VYFT-LPKYMIQTSILFND
A0A5E8AX52      LDVEKLLQ----V----VRSSILYVVAIFAVAG-TASYAF-LRYT-KPVYESESQLKLNI
F4KK08          FSLRDILM----I----LKANWLFILLSFLVCL-ALGFLY-IKSS-SHQYSRSASLLIKS
A0A496LCF9      DNPSFNILEWIMR----FIKYWYLFVISVLIFM-AVAYYQ-NRSF-VPTYNSTLRMLLKQ
A0A5P2G2A9      IDFEKILA----D----IIDHWKWFVIGVVLMI-ILGLLY-IQHS-APRYNVNATVMVDD
A0A419VXB7      QNIKDFLF----K----LLYHWKWFVLTVVVGV-GIAFVF-NRYT-PATYRVKSLLFIKD
C3J7R8          ITLSDIGL----I----LRSNWYWFAITLCVAI-GGASAY-LLHT-PNVYKREASILVKD
A0A0B0BTJ4      ITLRDIFD----F----IVFNWYWFALSAIAFA-GIGIVY-ALSR-PDVYRSSAMVLIDE
A0A3B9CNN6      ITLRDIFD----F----IVFNWYWFALSAIAFA-GIGIVY-ALSR-PDVYRSSAMVLIDE
R5X290          ITLRDIFD----F----IVFNWYWFALSAIAFA-GIGIVY-ALSR-PDVYRSSAMVLIDE
A0A1Q6E6I7      ITLRDIFD----F----IVFNWYWFALSAIAFA-GIGIVY-ALSR-PDVYRSSAMVLIDE
A0A1G8BVM8      TAIADLLG----I----LWRNRFWFALSIIIAV-SIAVFY-VRST-PKTYSRTATILIKD
A0A2G2F510      YDPLILRT----I----LKRYWWWPLTFILLFS-ALAFTY-LRYT-KPVYESAMILQLSE
A0A316JZ08      YDPLILRT----I----VRRYWLWVLGFVGIFV-VLAYFY-LRYT-KPVYESSLMLQISN
A0A1I1FXP9      INSDKLLS----I----LNKSLWWIIMFVVVAT-LGAYTY-VRYT-RPTYEAYSVLKLDI
A0A3N4H5N3      IDLSVVFK----S----LVKHWYLFIICVIIFL-GLAFLY-LRIA-TPVYEISGSVIIKE
A0A2P8EAX2      IDLFKSVR----L----LLPYWPYIIASILLFV-GLSFLY-LKSA-TPFYEITSSVLIRE
A0A4V2F6N9      IDLMRSVK----V----VLPFWPYILASILLFV-GLSFLY-LKSA-TPYYEITSSVLIRE
A0A3B9FXJ0      VDLQLLLL----F----TWKNRYIILLIMMLSL-LAGYMV-NKYS-VPRYSAKSVVQFKE
R5GSU5          IDWLSIVRACTGT----LRRQWRWFVFSIIVCG-CLAFLY-ERKQ-PRVYQRQAVIEIEG
A0A2A3UE91      FDIGVIAF----L----FMKSRIYIVLFFVISF-SLAFLY-LRYS-QPIYESRAIIQIND
A0A0A2G557      ISLSDIFY----L----LRQNWYYFIACLLIAL-ICGYVY-IKST-PNSYERTASVLVNT
A0A2N2WFW8      FDFKLFLF----I----ARRNLKFILVFFALLF-ALIFMY-LRYT-LPVYEASSVVQINS
A0A1F3IU95      FDFKLFLN----I----TRKSLIYIIVFSALLF-TAVYVY-LRYT-QPVYESACIVQINT
A0A3D0VUF6      FDFKLFLN----I----TRKSLIYIIVFSALLF-TAVYVY-LRYT-QPVYESACIVQINT
A0A1T4PT95      ISLSDIFY----L----LQQNWYYFIFWLIIAL-AGGYIY-IKST-PNSYEKTASVLINT
A0A4P5TMD1      FNPGLLMI----I----TRKSLIWCILIVLLTV-STSILY-LRYT-TPLYEVTAQIMIKQ
A0A651GU15      FELGLFLY----I----ARKSLKWIALLAVFTF-TFAYLY-LRYN-APVYQASTIIQLSK
A0A3Q9FR88      IDFDKLEF----V----IKKKFIWVILILMMAG-ICAFLY-IRWT-PRIYEASTLNQIKL
A0A553GEX3      IDFDKLEF----V----IKKKFIWVILILMMAG-MCAFLY-IRWT-PRIYEASTLNQIKL
A0A150ADJ9      IDFDKLEY----V----VKKNIVWVLLLISLTT-ICAYLY-IRWS-PRIYEATTLNQIKL
A0A1B1FWQ4      IDFDKLEF----V----VKKNIIWVILLLILSG-VAAYLY-IRWT-PEIYQANTLNQVKL
A0A1S1Z228      IDFDKLEY----V----VKKNIIWVILLLMLSG-IAAYLY-IRWT-PEIYQAHTLNQVKL
A0A2A4PYG9      FDLGVFIG----I----LKKQFKWIVLFFLLAG-IGAFLY-LRYT-PLLFEASALLQMTS
A0A1F3K695      FDLGLFLF----V----FRKSILLIGIFLFLIV-AVMYAY-LRYT-PPLYRASSVIQIND
A0A353KZR1      FDLGLFLF----V----FRKSILLIGIFLFLIV-AVMYAY-LRYT-PPLYRASSVIQIND
A0A2N2WYB5      FDFAIFMQ----I----LKKSLWVSIVLILLSF-FAAFLY-LRYT-QPLYSTQTIIQINE
A0A1F3K4G0      FDLAIFLQ----I----VRKNYWAPILFVAVSF-VASFLY-LRYT-QPVYQTQSIIQINE
A0A356H8Y3      FDLAIFLQ----I----VRKNYWAPILFVAVSF-VASFLY-LRYT-QPVYQTQSIIQINE
A0A351HSA6      FDLAIFLQ----I----VRKNYWAPILFVAVSF-VASFLY-LRYT-QPVYQTQSIIQINE
A0A1F3Q014      FELGLFIF----I----ARKSFFWIILFFILAF-LGASAY-LRYT-TPIFESSSVLQIET
A0A2A4YXP3      SDPILFFH----L----LKRNLLLFAVIIICCL-LVSLVY-LRYT-APVYEAKLVYQVNS
A0A2D5KD44      FDLGLFLY----I----IKKNLLWVMLTIGMSI-LGSFLY-IRYT-APVYRASADIQIEK
A0A1F3R158      LDIILLLQ----I----FKKNLLLFIAIIITTS-IVAFIY-LRYT-VPLYQSQLVLQVGS
A0A2M8ADX2      LDIILLLQ----I----FKRNLFLFAAIILACA-VISFIY-LRYT-IPLYQSQLVLQVGS
A0A1J5B2H0      IDPKLFLF----L----VKRNLLLFAILFIMAI-AGSYIY-LRYT-PPIYETHSIIQLSS
A0A1V5N756      FDLKLLLS----I----VKKNIPYVLIIFAFFF-TLAFLY-LRYT-YPKYETSGTIQIYT
A0A1F3SJM1      YDPLILRT----I----LRRYWWWPLTFVFIFG-LLAFSY-LRYT-KPIYESSMILQLSD
A0A2G2EB96      YDPLILRT----V----LKRYWWWAALLVMAFA-SFAYIY-LRYT-KPTFESSMVLQLGD
A0A2G6PRA9      YDPLILRT----V----LRRYWWWAALLVLTFA-ACAWVY-LRYT-KPTYESSMVLQLGD
A1ZKR2          LDLEKVWE----I----FRKSIIWMLLLPLFTI-SIGHLW-LRYT-KPVYKSSSTLKLAI
A0A1Q3GX01      IDLEKIWE----I----LKKSILWMLLLPLLTL-SVAHIW-LRYT-KPIYESSSNLKLAI
A0A349DQI4      IDLEKIWE----I----LKKSILWMLILPLLTL-SVAHIW-LRYT-KPVYESSSSLKLAI
A0A2N3IIZ0      IDFAKILY----I----LRKNWYWLIVFPLLSV-SLAYLY-LRYT-KPIFQSTANLKMEF
A0A497D5Z2      MDVRRLVI----S----VLRNWYWFILAVVVAL-AIAFLY-NRYT-TPLYKICSSILIEE
A0A662B170      MDVRRLAI----S----VLRNWYWFILAVVVAL-AIAFVY-NRYT-TPLYKICSSILIEE
A0A2A5FYT6      FDFGLLLY----I----TQRNIFWIIAILIVAG-TAAYFY-IRYT-PPIYESIGIIQVRT
A0A2E6SYP1      FDLGLALL----I----IRRNLFLTILLILMGA-GFAFFV-NRYT-TPTYYASSVVKISE
A0A2E5RLE8      FDLGLAIL----I----IRKNLISILFSISIGF-CVAFFI-NRYT-TPQYSASSIVKISE
A0A2E7TQF6      FDLGLAIL----I----IRKNLISILFSISIGF-CVAFFI-NRYT-TPQYSASSIVKISE
A0A2E6GVY9      FDLSLAIL----I----IRKNLLFIVLSIFLGF-CIAFFI-NRYT-TPQYYSSSIVKISE
A0A350JJ90      FDLGLLLM----I----TSKSLIWIVSIILLLG-GLAFTY-VYYT-QPKYESTSIIQIIN
A0A3M1CDV2      LDIGLLID----I----TLKSKWWYVLFFSIAG-ISVFLY-LRYS-ERIYSSQSIIQIVN
A0A522EYA6      FEIGLFIF----L----IKKSFLWIILFFSVSF-AAAFIF-LRYT-PEVFESRTILQVNN
A0A4P5U6G4      FNPGLLFI----I----IKKSFIWCVLIVLITM-SSSLLY-LRYT-PPLYEVGSTLMIKP
A0A2E2TFD1      FEIGLFIH----L----IQKSFIWILLFVSLAF-GGAYLY-LRYY-QPMYQSTSILQLKE
A0A2E4ELE6      FEIGLFVH----L----AQKSLLFVLAFFVIAF-ISSSLY-LRYT-QPIYSSSSILQLKE
A0A2E3XZI5      FELGLFLY----L----INKIKWVLITILIIFL-LGSRIY-LRYK-PEIYKTETRLQLAV
A0A2M7NLQ9      FDVSKLIR----V----VKKKLIYVIFLLIICV-VASWIV-LRYT-KRVYSSSSTLKLEM
I4AFR0          FDVSKLIR----V----VKKNIIYVILLLIICV-AASWVV-LRYT-HRIYNSSSTLKLEM
A0A2N2Y3E5      FDIPLFLL----V----FRKSLLYFTIIAVLCG-AGAYAY-LRYT-QPLFQASAIIQLKD
A0A2D9D7T6      YNPLILGE----I----LRKHWFAPILFIVFFS-TVAFFY-LRYT-KPIFQSKAVIQIVE
A0A1F3PPL5      FDVRIFTY----I----IKKSMFLVAIIMGISI-VGAFLY-LRYT-PPLYQSITVLQISN
A0A357QK06      FDVRIFTY----I----IKKSMFLVAIIMGISI-VGAFLY-LRYT-PPLYQSITVLQISN
A0A662AEA4      FDLQIFLL----I----LKKNVWLTFLFIILSL-FGTFIF-LRYT-PPVYKSVSIIQINN
A0A0S2HYK8      FDIITFKR----I----LYRSVWIGLFIILLAL-GAGFLK-IRYT-APLYEAKSVIQIQE
A0A2N5ZWN6      FDITTFKR----I----FIRSFWMGIIIMMLVI-GGAFLK-IRYT-SPVFEAKSVLQIQE
A0A0F2NS19      LDIILLLK----V----FKKTFIYFVGIIAICV-TLSLIY-LRYT-VPIYQSKLVLQVGS
A0A2A5H8X6      LDIILLLK----V----FKKTFIYFVGIIAICV-TLSLIY-LRYT-VPIYQSKLVLQVGS
A0A2H0GAU8      LDIILLLK----I----FKRNLFLFIAIITICV-VVSFVY-LRYT-IPIYQSQLVLQVGS
A0A2M8FTK1      LDIILLLK----I----FKRNLFLFIAIITICV-VVSFVY-LRYT-IPIYQSQLVLQVGS
A0A2A5B3B0      SDPILFFH----L----LKQNLLSFAIIIAVCL-MGAFIY-LRYT-TPIYESVLVYQVSS
A0A5C6RXM7      SDPILLLH----L----LRSHLKWFFVIILFCL-LSSYLY-LRYT-IPVYQSNLIFQVGS
A0A2E0FJ09      FEIGLFLY----L----TRQIWVWMLLIVIVCF-GLGFLY-IRYT-PPQYKAKALIQRTS
A0A1F3FZ62      FDLGLLFK----I----IQKTILPIFILFIISS-TIAFLY-LRYT-HPVFEASSVIQLSS
A0A1F3K211      FDLGLLFK----I----IQKTILPIFILFIISS-TIAFLY-LRYT-HPVFEASSVIQLSS
A0A1F3KLL5      FDLPIFLM----I----IRKSIWWIVIIFILAL-FSAFAF-LRYT-PPIYQSNSILQINE
A0A359D1M1      FDLPIFLM----I----IRKSIWWIVIIFILAL-FSAFAF-LRYT-PPIYQSNSILQINE
A0A2E7CT70      FEIGLFLY----L----LKKSRFTIILILLSAF-SLGFLY-LRYT-PKTYQTSATLQINI
A0A2D5V560      FELGLFLY----L----LNKIKWYAITLIILCI-TSAFIY-IRYT-PKTYQTSSIIQVAV
A0A2D7K5A8      FELGLFLY----L----LNKIKWYSIIIIIISI-SLAFLY-LRYT-PKTYQTGALIQVAV
A0A2E1XQ82      FELGLFLY----L----LNKIKWYAIIILIISI-SLAFLY-LRYT-PKTYETGALIQVAV
A0A1V6I2U9      FDARTFLI----I----FKKNVWVVILLILISL-GAGFAY-HRYS-TPRYKTSTIIQVKN
A0A1F3C1M2      FDIGLFVY----I----VKKSLILIGLLIGIAA-VSVFAY-LRYT-LPTYKSSSIIQINT
A0A1F3DS87      FDFALFIY----I----IKKSAILIGLLIGIAI-FSVFAY-LRYT-LPTYKSSSIIQINT
A0A2H0B957      FDFNISLQ----V----FKKSIILSVLVFILAA-VGAFVY-LRYT-QLIYKSVSIIQLKN
A0A1F3CFW6      FDVNIFLQ----V----FKRSIILSIIIFFAAI-VGVYVY-LRYT-LPIYKSSSIIQLKN
A0A2M7E2T8      FDVNIFLQ----V----FKRSIILSIIIFFAAI-VGVYVY-LRYT-LPIYKSSSIIQLKN
A0A2M7NC69      FDVNIFLQ----V----FKRSIILSIIIFFAAI-VGVYVY-LRYT-LPIYKSSSIIQLKN
A0A5C8A5B4      IDLRAIFG----K----IRSRWWWFLITVPLAL-AVAIAY-VKT-TPKKFDVGAVMLLGN
A0A4Y9ITE2      IDIIELLR----F----YSTKWKAILISVIIFM-ILGGIY-AYT-KSPVYEVQANVLITD
A0A5M8NYX7      GSLADIFF----H----YLNYWKWFVASLFVCL-LISFIY-LRY-TTREYSVSSRALIKD
A0A3D5KRY6      ----FIKA----T----LLKNWYWLAAFSFAGM-VGGYAY-NKV-VLPYYRISTTVLVHD
A0A1V5IPN7      EIKISDYL----R----ILLQYRYLIILIFVVVLAGTIIY-TLR-QPRIYSASGRILMEN
A0A0E3V905      NIRALLS-----K----YSKLWPWFILSTVLML-AIGHIY-ISN-KQPIYKIQASLLVQD
A0A553ETH6      IDLDKAQA----V----LKKNWIWIVIIFVISI-TSAYLV-IRW-TKPLYESTSELKLDV
A0A640Q161      TIDIAHYL----G----IIKRYAFRIVSLAIAFTILVALL-VMR-MTPMFTSTTTILVEA
A0A640QU49      TIDVAHYL----G----IIKRYAFRIVSLAIAFTILVTLL-VMR-MTPLYTSTATILVEA
A0A1Q3PII2      WTANPLWK----T----VRYHWYWFAISPLLSL-LLAWAF-LRY-QTPHYTIKASLLVRD
A0A351BXT2      DNFKIYLN----I----LRMNLIPMTIITLLCI-LLTIVY-VMY-AKDIYKSSATIKINR
A0A2K8Z965      NLRNLIS-----R----YIKRWPWFVVSIGLML-AGAYIY-LLD-KQPVYKIQASLLVQD
A0A418M8U8      RVSDLLP-----K----FTRNWPWILFSVCVFL-VAAYTY-LAY-KQPVYKIQASLLIQD
I2GTA4          RVSDLLP-----K----FTRNWPWILFSVCVFL-VAAYTY-LAY-KQPIYKTQASLLIQD
A0A2K8ZAJ2      YNLGTLLI----R----YVRNWPWFMLSILLAQ-AAAYIY-LLY-QPLVYNVQASVLIKD
A0A368JPA3      DGQGTLK-----D----YLKHWKWFLISLITLI-VAGFVY-IWF-TEPIYRVQASLLVKD
A0A5N1JI29      DAKGTLK-----D----YLKHWKWFLISLIALI-VAGFVY-IWF-TEPIYRVQASLLVKD
A0A3P1BT12      DVPGTLK-----D----YLKHWKWFLISLITMI-VAGFVY-IWF-TEPIYRIQASLLVKD
A0A3P1CI15      DGKGTLK-----D----YLKHWKWILISLIAML-VAGFVY-IWF-TEPIYRIQASLLVKE
A0A4R8CUK1      SDGRGAWQ----D----YLKQWEWFLLSLITML-VAGFVY-IGF-TEPVYRIQASVLVQE
A0A3D0MYJ7      NDIRFYFF----S----ILKYKYIILITTIVGF-LVAFFF-ARS-LPNIYQSKVQINVEK
A0A662AH13      NSLKDYIN----L----IKLNLIPILLITITGL-IVSIIF-ALM-AKDIYTATVAMKIQK
A0A5C7QA01      IDLKELFF----S----LIAQWKLIALCVFLSL-VCALLY-LRV-TPNTYSVDALIQVED
A0A3D3LS70      DNLHLFLN----L----VKSNWILILIVFIISA-VFTGLY-VFR-AKDIYKSSTSLLIQK
A0A1G1TM36      -------------------------MVGVALAL-LAAYAY-NQL-AQPTYEVQASILVEE
A0A1G7ZF38      WTKNPFWK----A----VRYRWYWFLISPLLSV-LLGFTF-LRY-KTPHYTITASLLVRD
C6VS52          WANHPLWK----A----IQFRWYWLVVSPIVSL-LLGTAF-LRY-KTPRYQVTASLMVRD
A0A0P7X1V8      IDLLQIFG----L----LWHNKWIIITLTLLGG-VSAYIY-AQS-QIPIFESNGSLQITE
A0A3B0C2S4      VNLWEVAQ----K----YLRYWPWFVLGILICL-GGAYAY-MRY-APIVYESSAKIKIID
L8JI02          INIKGIVL----Y----LLSKWHYFVFAAIFLL-PGAYLY-TKY-ATKVYLVKASILLKS
A6EBM4          VDLLKITM----V----LFSRWYIIASTTLICL-IAAYAY-LWY-TPKTYATTAILKFEE
A0A416GA42      LNPMDLLH----V----ALKKWYYYVGAVVCCL-LFAYIY-LHR-TAPMYQRMATVLIKD
A0A4R5DL69      HTLTQTIR----R----LISLWPWLILSQIFSL-LASFIY-LRY-STPRYEITSTILVKD
A0A1T3IYP5      INVLDLLK----Y----LLHHWKWFTLSILIFG-GFFYYQ-YSK-TPFIYNQSEVVMIKT
A0A1M4YED3      PQEENILS----ILQFRFAPYWPLFIILAIISG-VASYLY-LKY-TPPVYSAYSTMMIKD
A0A3P1Z8V4      TNILPVLL----KCWGIFRRYWYWFALSTVLSL-IAGYVY-QQM-QDRVYSGEAVILIDS
A0A2N3U785      -DLRGVLT----K----YLRYWYLFAATLLLSL-AGAYTY-LR-YATPQYLISSTLLIQD
A0A0E3ZG78      KDIRRILL----N----YLRYWYLFLIGAALGL-CGAFLY-LRYYTIPKYSVYSTVLIKD
A0A1I6BRK6      GDLKNIVL----Q----YTRYWYLFLLGAVLSI-SVAFFY-LRYYAVPQYIVSGTMLIKD
A0A243WAB1      KDIKRMVG----Q----YIRYWYLFLLGGMIGL-GITYFY-LRYYAVPQYHVYSTLLVKD
A0A126PFG0      LNLRAVLA----R----YRYHWSLFVAGVALAL-LGAYLY-TQL-VQPAYEVRASLLVEG
A0A3M1N7Z3      WDLRRVLI----V----LSREWWWPTLSVLFAA-FTAWAY-LRY-TEATYQTTAVVQVNL
A0A2H3NSN0      VDLNTIWH----T----IKRGKWIILGTCLAMI-AAFAGY-TFM-VAPEYEAAATVQVE-
A0A2P6C324      LDLGALWE----A----VKRSKWVILGTCVFVT-ALTAAV-TMM-MPQVYEAGAVVSVE-
A0A1M6XHU0      INFAEIWH----T----IRRGKWIILLTTLVVA-GVIGAY-TYT-LPPVYESSAIVFVDT
A0A5S9C8G0      INFAEIWH----T----IRRGKWIILLTTLVVA-GIIGAY-TYT-LPPVYESSAIVFVDT
G2SF81          INFAEIWH----T----IRRGKWIILLTTLVVA-GIIGAY-TYT-LPPVYESSAIVFVDT
A0A5S9EYW1      INFAEIWH----T----IRRGKWIILLTTLVVA-GAIGAY-TYT-LPPVYESSAIVFVDT
D0MHQ9          INFAEIWH----T----IRRGKWIILLTMLVVA-GAIGAY-TYT-LPPVYESSAIVFVDT
A0A4D7K1D4      MDWEKLAS----I----SRKSIPFIILIFALTI-SAAIFY-VRY-IPPLFESSSELKLDV
A0A3C1ITV0      FQLSDMIS----W----TLCHKKFFAISIVICV-ALGLIY-AQR-AQRIYQRSASVMLRS
R7HN19          FQLSDMIS----W----TLCHKKFFAISIVICV-ALGLIY-AQR-AQRIYQRSASVMLRS
A0A060RD97      LTARQVVE----L----VLANWYWFAVSLLVAL-LLGGYL-YVK-SPLVFKRQASIMLKD
A0A0D3L8Q3      INFKEIIL----K----YLRYWYLFLLGTIICF-GLAYLY-LRY-TTPQYLITTSILIKS
A0A5B6TJH8      NDIRNTFI----Q----YSRYWYLFLLGALLSV-GAAFMY-LRYHTSVQYKVASRLLIKE
A0A519U664      KDFKRIIS----Q----YSRYWYLFVLGASIGL-GIAYLY-LRFYAIPQYVVSSTMLIKD
A0A519UDD1      FDARRILL----Q----YTRYWYLFLIGAILGV-TAAFVH-LHYYAVPQYTVYSTMLIKD
A0A519MA34      KDFRRMIH----Q----YTRYWYLFVLGAALGL-GAAYFY-LRYYAIPQYVVSSTMLIKD
A0A519UCX0      RDFKRVLQ----Q----YSRFWYLFVLGAILGS-GAAYLY-LRFYAIPQYVVSSTLMIKD
R7PCR1          INFQQIIG----ICIVILQKHWMWFLTSVVLFV-VLAFVY-SRT-QPQVYQRTAVLEIED
A0A350IHV0      LSLTEIWA----M----IWNNKWWYVLSLVVCI-FMAGFV-IYR-TAPKYTRTAKVIVDD
A0A1G9E2A9      IDWPKLLS----I----VNRSIVWVLLFVALGV-LAAWIS-LRY-IKPVYESASLLKLEV
A0A098LL25      FDFAKLLV----I----ANKSLVWVILLVVLSI-TGAFLY-VRY-TKPVYESSSILKLDL
A0A2T2YJE8      IDFIMLLS----I----IRKSLIWVSLLIVLGL-IGAFLF-LRY-TKPLFKSSSTLKIDE
A0A127B287      IDLVTLWH----V----VRRSIPWVILLVLLGL-TGSYLF-LRY-TKKVYESSSVIKLEE
A0A3M9N829      IDFVTLLD----V----VKRSILWVVLLILLGG-AGAYLY-LRY-TKKVYESSSTIKLDE
A0A0P0CSF9      IDFVTLLH----V----AKRSIPWIILLVLLGI-GGSYLY-LRY-TKKVYESSSTIKLDE
A0A5M8QQB8      IDFVTLLH----V----VKRSIPWVLLLILLGA-GGSYLY-LRY-TKKVYESSSTLKLDE
A0A3M9MNC3      IDFVTLLH----V----VRRSIPWVLLLVLLGV-SASYVY-LRY-TKKVYESSSTIKLDE
A0A5B6TAX2      IDFVTLLH----V----VRRSIPWVLLLVLLGG-SASYLY-LRY-TKKVYESSSTIKLDE
A0A5N1IQ33      LDLATLLM----V----TRRSLPWMVFLILLGV-TAAWLY-LRY-TPPIYQSSSTLKIDQ
A0A512AYT3      VDFVILLA----V----ARKSLIWVVLLIMLGL-AASYLF-LRY-TKPVYKSSSIIKIDE
A0A5M6CYN7      VDFVTLLA----V----ARKSLVWVILLILLGL-TASYLF-LRY-TKPIYKSSSIIKIDE
A0A369QP10      IDFIMLLS----L----VRKSLIWVALLIVLGL-IGSFLF-LRY-TKPLYKSSSTLKIDE
A0A126PDF2      LDLSTLAL----V----ARRSLLWLLLLLALGG-SAAWLY-LRY-TKPVYKSTSLLKIDQ
A0A2Z3GKA1      LDLSTLAL----V----ARRSLLWLLLLLALGG-SAAWLY-LRY-TKPVYKSTSLLKIDQ
A0A502GZP7      LDLSTLAL----V----ARRSLLWVLLLLVLGG-SASWLY-LRY-TKPVYKSTSLLKIDQ
A0A519SBU8      FDIGTLVM----V----ARRSLVWVALLLALGF-TASWLF-LRY-TKPVYKSASLLKLDE
A0A4Q3JNZ3      LDLNTLVM----V----ARRSLVWVALLLALGF-TSSWLF-LRY-TKPVYKAASLLKLDE
A0A519Q9V3      LDLNTLVL----V----ARQSLVWVVLLLALGF-TGAWLF-LRY-TKPIYKAASILKLDE
A0A0M3RW20      LDLSTLVM----V----VRKSLPWMLLFILLGL-LTSWTY-LRY-TKPVYKSSSILKIDE
A0A495VFX4      LDVSTLVM----V----VRKSLPWMILFILLGL-LTSWTY-LRY-TRPLYKSSSILKIDE
A0A1S9B3W0      LDLPLLLS----V----TRRSLPWMILLILLGL-GASWTY-LRY-TKPIYQSSSTIKIDE
A0A1W1VRL3      LDITTLLQ----V----ARKSLPWIALLIALGL-TSSWLF-LRY-TKPVYQSSSVLKIDE
A0A1M6R305      LDFDTLLM----V----VRRSLIWLLLLIGLGI-TGSWLF-LRY-TKPVYKSSSLLKIDE
A0A4Z0PHK3      IDITTLLL----V----ARRSLLWIVLLIALGL-SASWLL-LRY-TKPVYKSSSLLKIDE
A0A2M9B9H9      LDLTTLLL----V----ARRSILWIILLIALGL-SASWLL-LRY-TKPVYKSSSLLKIDE
A0A4Z0QCY9      LDIATLLL----V----ARRSLLWIVLLIALGL-SASWLL-LRY-TKPVYKSSSLLKIDE
A0A418R9X5      LDLTTLLM----V----ARRSLPWMVLLIMIGL-TASWLF-LRY-TPPVYRASSTLKIDE
A0A428JSJ3      LDLSTLLM----V----ARKSLPWMLLLIALGV-TASWLF-LRY-TPPLYKASSTLKIDE
A0A428KI59      LDLTTLLM----V----ARKSLPWMLLLIALGV-TASWLF-LRY-TPPLYKASSTLKIDE
W8F1I6          LDLTTLLM----V----ARKSLPWMLLLIVLGV-TASWLF-LRY-TPPLYKAASTLKIDE
A0A246FQC0      LDLTTLLM----V----VRKSLPWMVLLIALGL-TASWLF-LRY-TPPLYKSTSALKIDE
A0A372E5P8      LDLTTLLT----V----ARRSLPWIILLVALGL-TAAWLF-LRY-TPPLYKSSSTLKIDE
A0A1H3EMW1      LDLTTLLA----V----ARKSLPWMVLLIGLGL-TAAWLF-LRY-TPPLYKSTSTLKIDE
A0A1H9ZSN3      LDLTTLLT----V----ARRSLPWMVLLVVLGL-TASWLF-LRY-TPPLYKSTSTLKIDE
A0A5N1J2M4      FDLVTLVQ----V----TRKSLVWVLLLIMLGL-FGAYMV-IRY-TPKLYDSTSLIKIDE
A0A519S476      -------M----V----ARRSLIWVVLLLALGF-TSSWLF-LRY-TKPVYQSASLLKLDE
A0A4Q3JRW8      LDLNTLVM----V----ARRSLVWMLLLLALGF-TASWLI-LRY-TKPIYKAASVIKLDE
A0A519M923      LDLNTLVL----V----ARRSLVWVVLLLALGF-TASWLF-LRY-TKPVYRAASLLKLDE
A0A4Z0ENW1      FDLSTLVL----V----ARRSLLWVIVLLALGI-TASWLY-LRY-TKPIYEATSILKIDD
A0A519UDB4      FDISTLVL----A----VRRSLPWAALLILLGL-TSSWLY-LRY-TKPIYRASSILKIDE
A0A3S0QKV1      LDLPLLLS----V----TRRSLPWMLLLLLLGL-AASWTY-LRY-TKPVYQSSSTIKIDE
A0A328BL48      LDLPLLLS----V----ARRSLPWMILLVLIGL-AASWSY-LRY-TKPLYRSSSTIKIDE
A0A5R8WLY4      LDLPLLLS----V----ARRSLPWMILLVLIGL-AASWSY-LRY-TKPLYRSSSTIKIDE
A0A1I5WSL8      LDISTLVL----V----ARRSLLWLILLIALGL-TASWLY-LRY-TKPVYKSQSLLKIDE
A0A0U3JVM7      LDIATLVL----V----ARRSLLWMLLLVGLGV-TASWLY-LRY-TKPVYKSASLLKIDE
A0A1G1SSV2      LDITTLVL----V----ARRSLLWMLLLIMLGT-TASWLY-LRY-TKPVYKSASLLKIDE
A0A1G1SXV7      LDITTLVL----V----ARRSLLWMLLLITLGL-TASWLY-LRY-TKPVYKSASLLKIDE
A0A0W8EDI5      FDVATLLM----V----TRRSLPWMVLLIALGL-TAAWLY-LRY-TQPVYQSASTLKIDQ
A0A3B7RBP8      FDISTLLM----V----VRRSLPWMILLVLLGV-TAAWLY-LRY-TQPIYQSSSTLKIDQ
A0A3R9P8H7      IDFTTLLT----V----ARKSLPWMLLLIALGL-TAAWLF-LRY-TPPLYQSSSTLKIDE
A0A238WIA7      LDLTTLIM----V----ARKSLPWVLLLVMLGL-LTSWLF-LRY-TRPVYQSSSVLKIDE
A0A212UCJ7      LDLTTLLM----V----ARKSLPWVLLLISLGL-LASWLF-LRY-TSPVYQSSSTLKIDE
A0A4Z0MQE1      LDLTTLVM----V----ARKSLPWVLLLVILGL-LSSWLF-LRY-TSPVYQSTSLLKIDE
A0A4Z0PCF4      LDLTTLVM----V----ARKSLPWVLLLVILGL-LSSWLF-LRY-TSPVYQSSSVLKIDE
A0A5D6VDG1      IDTTTLLM----V----ARRSLPWMMLLILLGL-AAAWTF-LRY-TKPLYKSSSTLKIDE
A0A243WHR7      LDLVTLLL----V----ARRSLIWVVLLIVLGL-TGSWLY-LRY-TKPVYQSLSILKIDE
A0A5B8A0P6      FDITTLLT----V----ARKSLPWIVLLIALGL-TGSWLF-LRY-TKPVYKSSSLLKIDE
A0A076HRT9      LDFDTLLM----V----VRRSLLWLLLLIGLGL-TGSWLF-LRY-TKPVYKSSSLLKIDE
A0A4Z0PVM7      LDIATLLL----V----ARRSLLWIILLIALGL-SASWLM-LRY-TKPVFKSSSLLKIDE
A0A1M6DHW8      LDIATLLL----V----ARRSLIWIVLLIALGL-TASWLF-LRY-TKPIYKSTSLLKIDE
A0A4Q5LC61      FDIATLLL----V----ARRSLIWIVLLIALGL-TASWLF-LRY-TKPVYKSTSLLKIDE
A0A2A8CVM9      IDVAEILD----M----LRRGKWIIAATTIVVV-ALVGAY-TYT-VDPVYEAKSIVKIDL
A0A3C0ZQC7      -TFQDYVQ----I----VLRGKWMILASFLLVL-AGTAVF-TFT-TSPVYESTATVLVDT
A0A2E3R1D0      IDLRALLD----I----LLRGKWIILGAVLALT-IPVMVY-SML-SPSKYRSYAILLVDK
A0A2T2USC0      ITLQEIIG----M----LWGGKWVILATFVVVV-ALGAAY-TFT-QTPIYESSNLVLVEK
A0A2T2V0F3      ITLQELVG----M----LWGGKWVILATFAVVL-ALGAAY-TFS-QTPIYETSSLVLVEK
A0A2T2S682      -RLRALLS----T----LWGGKWILLTVFVLVV-GTVAVY-TYT-RTPQYKTSTLLLVDL
D5H561          GQIEELLD----L----LRRRKWLIVLVCLATV-AGAALY-TYT-QVPVYRTSSLVLVEK
A0A2H3NWA9      -QLREMAG----L----LWAHKWIILGVFVVVM-AAAGVY-TYT-LPNQYQTSSLLLIKP
A0A2A8CVB6      -QLHELLG----T----LWRGKWIILGVLIVVL-AAGTAY-TLS-IPTTYRTSSLLLVDK
A0A2P6C1S6      -QLHDLIQ----T----LWEGKWIILGVVTAVV-LAAAAY-MYT-IPTTYRTSSLLLVDR
A0A2T2UTM4      -QLHDLIQ----M----LWDRKWIILGIVAVAV-LSAAVY-TYT-IPATYRTSSLLLVDR
R5RVP0          LNLADLWS----M----IWDNKWWYVLSVAICL-CFSVFY-LYR-TASSYTRTAKVMIDD
R6A0L2          MQLIPLLK----LCYHQFINHWAWFALSAVVCG-CIGWYY-QQC-QPRVYQRQAVMLIED
R7LG80          MQIIPLLK----LCINQLLRNWYWFLLSIVICL-GLGWIY-RQS-QPSVFKQQSVILIEE
A0A2L2WX98      PLLRLCLG----Q----LKAHWVWFLFSVIACA-ALGFLY-LQC-QPRIYQRQAVILLED
A0A285T4L1      INLVDLFV----Y----LLSKWKWFVLSVLLFG-GLAWYH-YAT-SPLVFFRNVTVIIKD
G5GD56          PLFKMCWA----L----FLANLKWFVLSVILCL-VLGYLY-QAR-QSRVYQRQAVILFED
R5KD55          ISIRDILI----S----CASHWRWYVATVVVAL-AVAVLY-IKK-TQPVYKRDASIMVLE
A0A174QNT3      VTLRDLLE----L----FLNNWYWFIASILFCV-GGAWLY-LSA-VSPVYQRTAVMLVKS
A0A4S2FGS1      ITLRDIVE----L----FLNNWYWFAASAVACV-AMAWIY-LSA-TPPLYQRTAVMLVKG
R9I0H0          ITLRDIVE----L----FLNNWYWFAASAVACV-AMAWIY-LSA-TPPLYQRTAVMLVKG
K5BUT9          INLRDVVE----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKD
A0A174FPA3      INLRDVVE----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKD
R6S9Y6          INLRDVVE----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKD
A0A642LIH6      INLRDVVE----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKD
C9KX15          INLRDVVE----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKD
R6DAG6          INLRDIVE----L----IIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKT
A0A3L8AAP1      INLRDIVE----L----LIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKT
A0A4S2AYX2      INLRDIVE----L----LIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKT
A0A4Y9H477      INLRDIVE----L----LIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKT
A0A0E2M2Y7      FSIEEYLL----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKS
A0A0K2J6Z0      FSIEEYLL----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKS
B2RKZ8          FSIEEYLL----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKS
A0A212GC82      FSIEEYLL----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKS
A0A254MU12      FSIEEYLL----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKS
R6CQ93          INLVDLFV----Y----LLSKWKWFVLSILFFG-GLAWYY-YAQ-SPLVFFRSVTVIIKD
A0A3D1NQW3      FSVHDLIQ----T----VIANWYWFVISVFVCV-GCGYIY-ILR-TPKIYSRTANILVKD
B0MT10          FSVHDLIQ----T----VIANWYWFVISVFVCV-GCGYIY-ILR-TPKIYSRTANILVKD
R7JGW9          FSVHDLIQ----T----VIANWYWFVISVFVCV-GCGYIY-ILR-TPKIYSRTANILVKD
A0A414Q925      TVIADMLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
A0A415PUS9      TVIADMLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
A0A108TCU0      TVIADMLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
A0A413BA42      TVIADMLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
S3Y344          TVIADMLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
A0A4Q5G8Y8      TVIADMLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
A0A412TGL3      TVIADMLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
A0A413VJ33      TVIADMLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
A0A414L0W6      TMIADMLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
A0A412DP39      TVIADVLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
A0A413ZSE8      TVIADMLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
B0NP84          TVIADMLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
R6AK43          TVIADMLS----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
A0A412N2D9      TVIADMLS----A----VYRNRKWFILSVVVCV-LIGFLY-LKS-SPEIFLRTATVLVKD
A0A1Y4JYS9      TVIADMLS----A----VYRNRKWFILSVVVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
R6LHA4          TVIADMLS----A----VYRNRKWFILSVVVCV-LIGFLY-LKS-SPKIFLRTATVLVKD
A0A3D2BF46      FSIHDLIQ----M----VIGNWFWFLLSTVVCL-SCALFY-IYT-APKVYNRTATILIKD
A0A4Y1WUN1      FSIHDLIQ----M----VIGNWFWFLLSTVVCL-SCALFY-IYT-APKVYNRTATILIKD
A0A4Y1XL94      FSIHDLIQ----M----VIGNWFWFLLSTVVCL-SCALFY-IYT-APKVYNRTATILIKD
A0A358R538      VTLHDILR----M----VAANWYWFVISAAVCL-GAAYYY-LAS-TPRIYSRTATILVKD
A0A1Y4AAB8      FSLHDLIQ----M----ILANWYWFAISVIVCL-GAGYLY-LAR-TPKVYSRKATILVKD
A0A1Y3WWY9      INLHDIIR----M----ILMNWYWFVLSVLVCL-GVAYYY-LAK-TPKIYSRTATILVKD
A0A1Y4U5L4      INLHDIIR----M----ILMNWYWFVLSVLVCL-GVAYYY-LAK-TPKIYSRTATILVKD
A0A1Y3VCJ1      IDLHDIIR----M----VIANWYWFILSILVCV-GAAYYY-LAK-TPKIYTRSATILIKD
A0A1Y3QTW7      LTLHDLLQ----M----VLANWYWFALSVLICL-GMAYYY-LAS-TPKIYSRTATILVKD
R6XWY7          LTLHDLLQ----M----VLANWYWFALSVLICL-GMAYYY-LAS-TPKIYSRTATILVKD
A0A4Y1X9Y9      LTLHDLLQ----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKD
A0A4Y1WM66      LTLHDLLQ----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKD
A0A174AVF1      LTLHDLLQ----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKD
A0A656Q4F4      LTLHDLLQ----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKD
A0A1Q6EIY0      ITLHDLIQ----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKD
A0A5B5VN71      ITLHDLIQ----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKD
E4M8L3          ITLHDLIQ----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKD
I3YQ50          ITLHDLIQ----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKD
R5UEY8          ITLHDLIQ----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKD
A0A1H4D866      VTLHDIIR----M----VIANWYWFVLSALVCL-SLAYYY-LAS-TPKIYSRTATILVKD
A0A5B3G4Y7      ITLHDIIR----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKD
A0A374A9J5      ITLHDIIR----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKD
A0A5B3GQN5      ITLHDIIR----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKD
A0A1Q6E9S3      ITLHDIIR----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKD
D4IJ36          ITLHDIIR----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKD
A0A3E5HPT8      INIVDLFI----Y----LIAHWKWFVLSILLFG-GYFWYS-YCE-TPFVYSRTAIVMIKT
C6IJ48          INIVDLFI----Y----LIAHWKWFVLSILLFG-GYFWYS-YCE-TPFVYSRTAIVMIKT
Q8A3U2          INIVDLFI----Y----LIAHWKWFVLSILLFG-GYFWYS-YCE-TPFVYSRTAIVMIKT
A0A3R6S1H6      LNLIDLWY----M----FKRYWYWFVLSVMVFL-GGAVYY-VKS-TAKIYTCVASVLIKN
A0A3R6SD81      LNLIDLWY----M----FKRYWYWFVLSVMVFL-GGAVYY-VKS-TAKIYTCVASVLIKN
A0A354WXN6      LNILDLVK----I----AWANWYWFVISIVLCL-SIAFVY-LKW-APKVYTRTASVLIKD
R5IP14          LSLRDILE----I----GLANWKWFALSVIVCL-SIAYVY-VQT-LPYIYTRSASVIIKD
A0A316SZX7      INLRDILD----L----LISQWKWFALSICICL-GIAFLY-LKQ-ATPIYTRTASVMIKD
A0A1Y4AIY1      VTLGDIFQ----I----VKAKWYWFALSIGICL-GIAYIY-LLQ-APKVYTRSASVLIKE
F3ZRU7          IDLVEIGT----M----LMRHWLWYIVAVALAL-VLGFLY-IKS-TPKTYERHASVLIKD
A0A0J6CIR2      LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKD
A0A3D8HG59      LNLGDIIQ----I----VRANWYWFALSVVVCM-SAAFVY-LQW-APKQYTRTASVLIKD
A0A3R6S408      LNLGDIIQ----I----VRANWYWFALSVVVCM-SAAFVY-LQW-APKQYTRTASVLIKD
A0A1C5Q1F3      LHVGDWLH----I----ALANWKWFVLSLVVCM-GASFWY-IKR-SPDIYSRSASVLIKD
R7A239          LHVGDWLH----I----ALANWKWFVLSLVVCM-GASFWY-IKR-SPDIYSRSASVLIKD
A0A3R6HIK7      LNLWDLFQ----I----FKANWYWFVLSVILCV-GAGYLY-LLQ-APRVYTRTASVLVKE
K5ZVW7          LNLWDLFQ----I----FKANWYWFVLSVILCV-GAGYLY-LLQ-APRVYTRTASVLVKE
A0A1Y4D5Z0      LNLWDLLQ----I----LKANWYWFVLSVVACL-GLAYLY-LKQ-APLVYTRSASVLIKE
A0A413VXJ7      ISIADILQ----L----IWSNRYWFALSIILCI-GIAFFY-IQS-TSKVYSRKATVLIRD
I9RSN9          INIADILQ----L----IWSNRYWFILSIFLCV-GIAFFY-LQS-SSKIYSRKASVLIRD
U6RJK5          INIADILQ----L----IWSNRYWFILSIFLCV-GIAFFY-LQS-SSKIYSRKASVLIRD
A0A1Q6GA32      INIADILQ----L----IWSNRYWFILSIFLCV-GIAFFY-LQS-SSKIYSRKASVLIRD
I9RPU6          INITDILH----L----IWVNWYWFVLSVLVCG-GIAFFY-LKS-SSKVYSRKASVLIRD
I8YFS5          ISIVDIFH----L----VIANWYWFVLSILICA-GIAFFY-LKS-SSKVYSRKASVLIRD
A0A4Q5F7I7      ISIVDIFH----L----VIANWYWFVLSILICA-GIAFFY-LKS-SSKVYSRKASVLIRD
I8Y597          ISIVDIFH----L----VIANWYWFVLSILICA-GIAFFY-LKS-SSKVYSRKASVLIRD
A0A1Q6GBF5      INITDIFR----F----VLANWYWFVLSVLVCT-GIAYFY-VKS-SSKIYSRKASVLIRD
I8YFZ3          INITDIFH----L----ILVNWYWFVLSVLVCG-GVAFFY-LKS-SSKVYSRKASVLIRD
A0A4V1YNX8      INISDIFH----L----VLANWYWFVLSVLVCG-GVAFFY-LKS-SSKVYSRMASVLIRD
A0A1Q6GDH2      INITDILH----L----IWVNWYWFVLSVLVCG-GIAFFY-LKS-SSKVYSRKASVLIRD
U6RSB0          INITDILH----L----IWVNWYWFVLSVLVCG-GIAFFY-LKS-SSKVYSRKASVLIRD
I9GXM2          INISDIFY----L----VLANWYWFILSVLVCG-GVAFFY-LKS-SSKVYSRKASVLIRD
I9SIK1          INISDIFH----L----ILANWYWFVLSVLVCG-GVAFFY-LKS-SSKIYSRKASVLIRD
A0A4Q5FNG1      INISDIFH----L----ILANWYWFVLSVLVCG-GVACFY-LKS-SSKIYSRKASVLIRD
I9TP59          INISDIFH----L----VLANWYWFVLSVLVCG-GVAFFY-LKS-SSKVYSRMASVLIRD
R5S343          LTLRDMIG----I----VWMHKWWFTASLVVCI-ILASGY-LMW-MPNVYTRTASVLIKD
A0A1M6K7I9      INIADLLL----I----LRNNWKWFAASIFVCM-ALAFVY-LKS-TPKTYSRKATVLIRD
A0A5M6A8C8      INIVDLLL----I----LRNNWKWFAASIFVCM-ALAFVY-LKS-TPKTYSRKATVLIRD
A0A4V1YPN7      ISIVDIFH----L----VLANWHWFTLSILVCV-GIAFFY-LKS-SSKVYSRKASVLIRD
A0A4Q5F874      INLIDIFR----L----IFVNWYWFVLSVLICI-GFAFFY-LKS-SSKVYSRKASVLIRD
A0A641LV22      INLIDIFR----L----IFVNWYWFVLSVLICI-GFAFFY-LKS-SSKVYSRKASVLIRD
A0A3R5ZMK1      LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKD
A0A3E4ZTK7      LNLEDILQ----V----VLANWHWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKD
A0A1Y3ZIA4      LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKD
K5Y1A4          LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKD
A0A4Q5CIT0      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKD
A0A3R6K8X4      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKD
A0A414GI87      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKD
A0A415BDM7      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKD
A0A412DM15      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKD
A7AEU7          LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKD
A0A1Q6I3T6      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKD
A0A414XX40      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKD
A0A3R6BKI7      LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKD
A0A414LPI6      LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKD
A0A412M2W1      LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKD
K5ZX55          LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKD
A0A5F0U645      LNLIDMYR----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKD
K5ZBN2          LNLIDMYR----V----VRANWYWFLLSVAVCC-AVAALY-LGW-APKIYQRTATVLIKD
A0A0J6CKW3      LNLIDMYR----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKD
A0A0F5IQM7      LNLIDMYR----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKD
A0A496CDT3      LNLIDIYR----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKD
S0GLB0          LNLIDMYR----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKD
A0A3R6NLC1      LNLIDIYR----V----VRANWYWYLLSVVVCC-AIAVLY-LGW-APKIYQRTATVLIKD
A0A416WYC9      LNLIDIYR----V----VRANWYWYLLSVVVCC-AIAVLY-LGW-APKIYQRTATVLIKD
A0A0F5IT40      LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKD
A0A496CX20      LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKD
A0A5F0UBI0      LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKD
S0GSI7          LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKD
K5YB65          LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKD
A0A0F5IWP9      LNLKDLFH----I----VLANWYWFLLSVLICC-GAAFLY-LKW-APKVYTRTASVLIKD
A0A0F5IZT8      LNLKDLFH----I----VLANWYWFLLSVLICC-GAAFLY-LKW-APKVYTRTASVLIKD
A0A417LKQ2      LNLRDLFN----I----VRANWYWFLLSVLLCS-GAAFLY-LKW-APKVYTRTASVLIKD
A0A416TME1      LNLNDLFH----I----VLANWYWFLLSTLFCC-GVAFLY-LKW-APKVYTRTASVLIKD
A0A416XPE8      LNLNDLFH----I----VLANWYWFLLSTLFCC-GVAFLY-LKW-APKVYTRTASVLIKD
A0A5C8KAD6      M-FLDLVY----K----FTPYWPLFLTLLVISC-MAGWAY-LNYYATPVYEASASLLIKD
A0A5N1J695      M-FSSLMF----R----FLPYWPLFAGLLVVSL-FGAWGY-LRYLSVPTYEVSASLLIKD
A0A1H4ADG3      FDFTKIFH----R----IRANW-YYCVICAIVM-VGLAGI-YLYVANPTYKAMATVLIKD
A0A5B8VUR8      FDFTKVIQ----R----IRANW-LYAVLSAILM-VVLAVI-YLYVTSPTYKAMATVLIKD
A0A2A4G4B1      IDLQELLG----F----VLSQWKKMVLGGLIGA-LLAFGY-L-KTVNPKFRVETSVLLKS
A0A3N2M1H3      FSIKDYIQ----A----CKSRWQWILLSLIICV-GAGVLY-I-LCQQPEYQRTEEVLIKD
A0A4S2G8T2      FSIKDYIQ----A----CKSRWQWILLSLIICV-GAGVLY-I-LCQQPEYQRTEEVLIKD
A0A212K7W5      IQIQDLWK----M----SVEKWHWFAISLTICL-IFAFLY-I-AITSPVYTRMAAVLIKD
F5IU11          IRIQDLWK----M----SVEKWHWFVISLGICL-ISASLY-I-AITPPVYTRMAAVLIKD
A0A3N2N6F7      INISDFLS----L----CVRCWKWFAFSVAACL-IIGALY-V-LTSPKIYTRTAQVVVQD
A0A4P7VVU7      FNLHDFFI----L----CLNKWKWFVISIIIFL-GLGVLY-I-MSTPETYTRTASVMINE
A0A2V1ILM4      FNLHDFFI----L----CLNKWKWFVISIIIFL-GLGVLY-I-MSTPETYTRTASVMINE
A0A3N2L0E8      FNLHDFFI----L----CLNKWKWFVISIIIFL-GLGVLY-I-MSTPETYTRTASVMINE
A0A3N2LFC5      FNLHDFFI----L----CLNKWKWFVISIIIFL-GLGVLY-I-MSTPETYTRTASVMINE
A0A553LCN8      ITLRDVVE----L----IIANWYWFAISVIVCV-SAAYLY-T-RTLVPVYQRQAVMLVKT
K0XJ09          VTLRDIVE----L----VFDNWYWIVLSVVICM-SVAWFY-L-AMQTPLYKRSAVMLVKS
R5EUZ0          VTLRDIVE----L----VFDNWYWIVLSVVICM-SVAWFY-L-AMQTPLYKRSAVMLVKS
W0EQS0          ITLRDIVE----L----IFDNWYWIVLSIAVCV-SVAWLY-L-AMQTPLYKRTAVMLVKS
A0A1Y3WE15      ITLRDIVE----L----IFDNWYWIVLSVAVCV-LVAWLY-L-AKQTPLYKRSAVMLVKA
A0A1Y4GUK3      ITLRDIVE----L----IFDNWYWIVLSVAVCV-SVAWFY-L-AMQTPLYKRSAVMLVKA
A0A352Z1R7      AHIYDYLS----V----ILRRRKLFTLAFCAVF-FSVVLY-T-YLMKPIYEASSTLHIKK
A0A0A2F501      LSLRDLWA----M----CWARKFWFVLSLGLFL-GGAILY-I-LITPPVYKRTATLLIKD
R5B7P0          VQIGQLVR----R----CLSRWYWFALSLAVCL-ALGALY-I-LRSTPTYNTSADIQIKS
R5B0L5          VKISDVIF----I----TLKRWPWILLSLAICV-GCAVLY-V-LRTPSMYTRSASIVIKS
A0A374THP7      IRLQDLFY----L----CLAKWRWFILSLAVTL-GIATYY-I-LTTPNVYQRTASLMIKD
A0A3R5XWG1      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYY-L-LSTPNVYQRTASLLIKD
A0A5P0Y910      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYY-L-LSTPNVYQRTASLLIKD
A0A5P0XQC0      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYY-L-LSTPNVYQRTASLLIKD
A0A414YFM3      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYY-L-LSTPNVYQRTASLLIKD
A0A5P0VXP6      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYY-L-LSTPNVYQRTASLLIKD
A0A5P0W892      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYY-L-LSTPNVYQRTASLLIKD
A0A0A2EVS5      FSLKEIFR----L----CLIRWKWILLSLLITV-GAATAY-L-MITPVEYKRSASILIKE
A0A1T4NAJ7      FSLKEIFR----L----CLIRWKWILLSLLITV-GAATAY-L-MITPVEYKRSASILIKE
A0A255T941      LRLQDLWG----L----CLPRWRWFVLSVLICA-SAAVLY-L-LRTPNIYTRTASILIKE
A0A3N2KCL3      VPLTDILY----R----TLHHWPWVLLSLVVCV-GAAVVY-L-LCTPKVYTTTASIMIKD
A0A4P7VSV0      VPLTDILY----R----TLHHWPWVLLSLVVCV-GAAVVY-L-LCTPKVYTTTASIMIKD
A0A2V1IJY1      VPLTDILY----R----TLHHWPWVLLSLVVCV-GAAVVY-L-LCTPKVYTTTASIMIKD
A0A4P7VXK7      VPLTDILY----R----TLHHWPWVLLSLVVCV-GAAVVY-L-LCTPKVYTTTASIMIKD
A0A1Y4CHN5      ISIQDFLY----M----CLSKWYWFAISLVVLI-ALALIY-I-MRTPPEYTRSASMLIKE
A0A1M6I2S6      IRIQDLWG----M----FVPRWHWFALSLFAAL-AIAAFY-L-LSTPNIYTRTAAILVKD
A0A1Y3V692      IRIQDLWG----M----FVPRWHWFALSLFAAL-AVAAFY-L-LSTPNIYTRTAAILVKD
F3PXM2          IRIQDLGS----M----FVPRWRWFALSLAVAL-SAAALY-L-LRTPAIYTRHAAILVKD
A0A3E4ZNL4      IRIQDLWG----I----FVPKWYWFAISLFITL-VCASLY-L-LSTPNIYTRTAAVLIKD
A0A174AHH7      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLY-L-LSTPNIYTRTAVILIKD
A0A174JCE8      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLY-L-LSTPNIYTRTAVILIKD
A0A3E4JMC4      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLY-L-LSTPNIYTRTAVILIKD
A0A412SND6      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLY-L-LSTPNIYTRTAVILIKD
A0A414IEQ9      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLY-L-LSTPNIYTRTAVILIKD
A0A415UKN5      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLY-L-LSTPNIYTRTAVILIKD
A0A0M1W8D8      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLY-L-LSTPNIYTRTAVILIKD
A0A3R6GKX5      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
A7V4S1          IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
B0NU19          IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
D4V601          IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
A0A4Q0U3M9      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
A0A4R4H1Q2      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
A0A397WLT5      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
A0A3R6GM96      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
A0A015XH67      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
A0A078RZN2      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
A0A4R4I3T9      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
A6L0K5          IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
A7ACT5          IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLY-L-LSTPNVYTRTAAILIKD
A6KY94          IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLY-L-LSTPNVYTRTAAILVKD
A0A173UQR8      IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLY-L-LSTPNVYTRTAAILVKD
A0A3R6HK75      IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLY-L-LSTPNVYTRTAAILVKD
A0A412B7D1      IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLY-L-LSTPNVYTRTAAILVKD
A0A412VNY9      IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLY-L-LSTPNVYTRTAAILVKD
A0A414LTU9      IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLY-L-LSTPNVYTRTAAILVKD
I9Q4U4          IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLY-L-LSTPNVYTRTAAILVKD
A0A373ISF0      IRIQDLWG----L----FVPKWHWFVLSLFVTM-SVAVLR-L-MSTPSIYTRSAAILVKD
U6RF62          IRIQDLWG----L----FVPKWRWFVLSLFVTM-SVAVLR-L-MSTPSIYTRSAAILVKD
A0A662ZZD5      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALY-L-LGTPNIYTRTAAILVKD
A0A395YYT3      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALY-L-LGTPNIYTRTAAILVKD
A0A642JYJ3      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALY-L-LGTPNIYTRTAAILVKD
A0A015UXN7      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALY-L-LGTPNIYTRTAAILVKD
A0A5M5W148      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALY-L-LGTPNIYTRTAAILVKD
A0A3A5TI83      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALY-L-LGTPNIYTRTAAILVKD
A0A415NEB6      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALY-L-LGTPNIYTRTAAILVKD
A7AJ60          IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALY-L-LGTPNIYTRTAAILVKD
A0A016E4F9      IRIQDLWG----M----FVPRWHWFVLSLFAAL-AVATFY-L-LSTPNIYTRTAAILVKD
A0A4Q5CFJ7      IRIQDLWG----M----FVPRWHWFALSLFAAL-AVATFY-L-LSTPNIYTRTAAILVKD
A0A108TH71      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLY-L-LSTPPIYTRTAAILVKD
I8VXH0          IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLY-L-LSTPPIYTRTAAILVKD
A0A412S0N6      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLY-L-LSTPPIYTRTAAILVKD
A0A412IIJ0      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLY-L-LSTPPIYTRTAAILVKD
A0A0P0FM97      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLY-L-LSTPPIYTRTAAILVKD
R6KTP3          IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLY-L-LSTPPIYTRTAAILVKD
A0A139LU87      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLY-L-LSTPPIYTRTAAILVKD
A0A1C6B3Y5      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLY-L-LSTPPIYTRTAAILVKD
E2NMQ4          IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLY-L-LSTPPIYTRTAAILVKD
A0A412YDB9      IRIQDLWS----M----FVPKWYWFAVCLFITL-AIAVLY-L-LSTPPIYTRTAAILVKD
R7DY01          IRIQDLWS----M----FVPKWYWFAVCLFITL-AIAVLY-L-LSTPPIYTRTAAILVKD
A0A414LGK8      IRIQDLWS----M----FVPKWYWFAVCLFITL-AIAVLY-L-LSTPPIYTRTAAILVKD
A0A415IPQ4      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLY-L-LSTPPIYTRTAAILVKD
A0A3E5BRW7      IRIQDLWG----M----FVPKWHWFAGSLLITL-AIAVLY-L-LSTPPIYTRTAAILVKD
K9DXS6          IRIQDLWG----M----FVPKWHWFAGSLLITL-AIAVLY-L-LSTPPIYTRTAAILVKD
A0A1M6KFV3      IRIQDLWG----M----FVPKWYWFAGSLFVTL-TIAALY-L-LSTPPIYTRTAAILVKD
A0A1Q6G7L3      IRIQDLWG----M----FVPKWYWFAGSLFVTL-TIAALY-L-LSTPPIYTRTAAILVKD
A0A413H235      IRIQDLWG----M----FVPKWYWFAGSLFVTL-TIAALY-L-LSTPPIYTRTAAILVKD
A0A1M5B2J8      IRIQDLLY----L----CLAKWHWFVLSLAVCL-GVAIAY-L-LRTPPVYTRSASILIKD
A0A255RCT5      IRIQDLLY----M----CLAKWYWFVLSLAVCL-GVAIAY-L-LRTPPVYTRSASILIKD
A0A1Y4GLF5      LRIQDLFY----L----CLAKWKWFVISLVVTC-GIAVLY-L-LRTPSVYTRTASVLIKE
A0A1H3XSC0      IRVQDLLY----L----CLSKWKWFVLSLAVTV-GIAVFY-L-LRTPPVYTQTASVLIKD
A6LE40          LRIQDLLF----L----CLAKWQWFVLSLVVTV-GAATVH-L-LRTPAVYTRTASVLIKE
A0A4Y1VPX5      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
B3JI46          LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
R6NN15          IRIQDLYY----L----CLAKWRWFVLSLVICL-GIAFIY-L-LKTPPVYTRTASLLIKE
A0A358R8U0      IQIKDLLY----L----CLAKWKWFILSLLVTL-SLAFLY-L-LKTPSVYTRSATLLIKE
R6WSB6          IQIKDLLY----L----CLAKWKWFILSLLVTL-SLAFLY-L-LKTPSVYTRSATLLIKE
A0A4Q5ENK6      ITIQDLFY----L----CLNKWHWFVISLVLCL-GGATFY-L-LKTPSVYVRTASILIKD
A0A401LPX7      ITIQDLFY----L----CLNKWHWFVISLVLCL-GGATFY-L-LRTPSVYVRTASILIKD
A0A3A5Z900      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
A0A3R6EGW5      ITIQDLFY----L----CLDKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
A0A285TGL6      ITIQDLFY----L----CLDKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
A0A3A5RFX4      ITIQDLFY----L----CLDKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
A0A1Q6IUW9      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
A0A3R6NPG7      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
A0A413XDP6      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
K6AP24          ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
A0A662ZYI7      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
A0A078RYI7      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
C7XEQ8          ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
D7INX6          ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
K5ZG55          ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFY-L-LRTPSVYVRTASILIKD
A0A3N2N9B8      LPISDILF----L----TLRKWPWIILSLTICV-GAALTY-I-LRTPTVYTRAAQIMIKD
A0A3N2NMI0      VPIVDIIF----L----TLRKWPWILLSLIVCV-GAAMIY-I-LRTPDVYTRATEIMIKE
A0A359I8H7      FSLKDFLA----R----CLSKWRWFAVSIVLFC-CLGVLY-V-LRQQPVYSRSMELLIKD
A0A3N2KA63      FSLKDFLA----R----CLSKWRWFAVSIVLFC-CLGVLY-V-LRQQPVYSRSMELLIKD
A0A4Q0IMT7      FSLKDFLA----R----CLSKWRWFAVSIVLFC-CLGVLY-V-LRQQPVYSRSMELLIKD
A0A3B9FAU3      FNLRMLLD----I----VLGNWFWILQSVILFG-AAGWYY-L-KITPNTYQRTALVVIKE
A0A3C1E5L7      FNLRMLLD----I----VLGNWFWILLSVILFG-AAGWYY-L-KITPNTYQRTALVVIKE
A0A4Q0UAV1      INIKELLY----Y----FLSKWYWFVISVAVCV-AFASYK-L-MSTRPTYVRTITVMFKT
A0A354SN68      FVLKDFLF----A----CLAQWKLFALSVAVCV-GATMLY-L-SSKSPVYMRRASVLMKE
A0A3N2N595      VPLSDIIY----R----TLHYWPLVLLSLFICV-GAAVMY-L-LCTPKIYTTSASILIKD
A0A0A2DUD9      FSLQDLWR----L----VCIRWYVIAISILLAL-GVAVLY-I-LRTPPVYKRTASVMIKA
A0A3P1ZBJ5      VDIQDILY----L----CLSKWYWFLLSLILSL-ALGVLI-I-LRTTPVYNRYTTIMIKE
R5FHS9          VVITDFLY----L----CLRKWWWFAIALIIAF-GVAIAY-I-LRTPPVYTRTESVVISN
A0A413TW79      IRLQDLMY----L----CLVRWRWFVISLVVTL-GIATYY-L-LSTPGVYQRTASILIKE
A0A3E5E9M7      IRLQDLMY----L----CLVRWRWFVISLVVTL-GIATYY-L-LSTPSVYQRTASILIKE
A0A3E4SK73      IRLQDLMY----L----CLVRWRWFVISLVVTL-GIATYY-L-LSTPSVYQRTAFILIKE
A0A415GGC6      IRLQDLMY----L----CLVRWRWFVISLVVTL-GIATYY-L-LSTPSVYQRTASILIKE
A0A413DBH9      IRLQDLMY----L----CLVRWRWFVISLVVTL-GIATYY-L-LSTPSVYQRTASILIKE
A0A495WI87      MRIQDLLY----L----CASNWYWFALSLMITL-GAAFLY-I-KVTPPVYTRSASILIKE
A0A354M4S6      MRIQDLLY----L----CASNWYWFALSLMITL-GAAFLY-I-KVTPPVYTRSASILIKE
R7DH52          MRIQDLLY----L----CASNWYWFALSLMITL-GAAFLY-I-KVTPPVYTRSASILIKE
A0A4Q5E7L5      LRIQDLLY----L----CLARWKWFVLSLAVTL-GIATFY-I-LRTPQVYTRTASVLIKE
A0A4P8LP09      LRIQDLLY----L----CLAKWKWFVLSLVVTT-GVAAVY-L-LRTPAVYTRTASVLIKE
A0A4R4GZU7      LRIQDLLY----L----CLAKWKWFVLSLVVTT-GVAAVY-L-LRTPAVYTRTASVLIKE
A0A016CWA4      LRIQDLLY----L----CLAKWKWFVLSLVVTT-GVAAVY-L-LRTPAVYTRTASVLIKE
A0A1C6H117      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A415TAH7      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A0M1W0V2      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A139KA16      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A174VQ92      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A1Q6HCG0      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A1Y4JYM9      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A3A5QW67      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A3A5RQE6      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A3A6BP07      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A3E5E153      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A3Q9IP20      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A412WV15      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A413ICP6      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A414KYB9      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A5B3FWR2      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
E5WX00          LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
K0X3P3          LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVY-L-LCTPAVYTRTASVLIKE
A0A3A5Z014      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVH-L-LRTPAVYTRTASVLIKE
A0A1M4YZ07      LRIQDLLY----L----CLARWQWFVLSLVVTV-GAATVH-L-LRTPAVYTRTASVLVKE
A0A078S3Q8      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVH-L-LRTPAVYTRTASVLVKE
A0A069SJV7      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVH-L-LRTPAVYTRTASVLVKE
A0A3E5DXI5      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVH-L-LRTPAVYTRTASVLVKE
A0A3E5EM98      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVH-L-LRTPAVYTRTASVLVKE
A0A3E5F453      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVH-L-LRTPAVYTRTASVLVKE
I9T3G6          LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVH-L-LRTPAVYTRTASVLVKE
A0A4Q5E5M7      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAY-L-LRTPTIYTRTASVLIKE
A0A0P0FQW1      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAY-L-LRTPTIYTRTASVLIKE
A0A5M5C0W6      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAY-L-LRTPTIYTRTASVLIKE
A0A642LZ22      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAY-L-LRTPTIYTRTASVLIKE
A0A5M5YM86      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAY-L-LRTPTIYTRTASVLIKE
A0A642LE65      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAY-L-LRTPTIYTRTASVLIKE
A0A5M5Y0P8      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAY-L-LRTPTIYTRTASVLIKE
A0A642NJ89      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAY-L-LRTPTIYTRTASVLIKE
C3RFN5          LRIQDLLY----L----CLARWKWFVLSLVVTI-GVATVY-L-LRTPAVYTRTASVLIKE
A0A3E4SYU0      LRIQDLLY----L----CLARWKWFVLSLVVTI-GVATVY-L-LRTPAVYTRTASVLIKE
A6LGY1          LRIQDLLY----L----CLARWKWFVLSLVVTI-GVATVY-L-LRTPAVYTRTASVLIKE
K5ZSH4          LRIQDLLY----L----CLARWKWFVLSLVATI-GVATVY-L-LRTPAVYTRTASVLIKE
A0A078T2W6      LRIQDLLY----L----CLARWKWFVLSLMVTI-GVATVY-L-LRTPAVYTRTASVLIKE
A0A3R6EAF7      LRIQDLLY----L----CLARWKWFVLSLVVTI-GVATVY-L-LRTPAVYTRTASVLIKE
A0A5C6L2P1      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A412MJT7      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A3E4WKT5      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A3A5YY33      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A078TAH2      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A1E9CFZ7      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A373FYU5      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A3A5TZ72      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A3A5XBP2      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A3A6MEG9      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A3E4JP35      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A3E4KP40      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A3E4NX82      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A3E4XFU8      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A412RG70      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A412TD37      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A413GAA4      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A414M7I4      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A496BTA0      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A496D2V6      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A4Q5EN83      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A4Q5G1P5      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A5C6KCA6      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A5M5AHM5      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A641WNS6      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
E5UZA2          LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRTPAVYTRTASVLIKE
A0A069SMG6      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAY-L-LRPPAVYTRTASVLIKE
A0A1Y4PQK7      LRIQDLFY----L----CAAKWKWFVLSLLVAF-GIGYYY-L-LKTPPVYTRTAELLVKR
A0A1Y4IH41      LSIQDLFY----L----CAAKWQWFVLSLLVAF-GIGYYY-L-LKTPPVYTRTAELLVKR
A0A3A6AAP4      LRIQDLFY----L----CAAKWQWFVLSLLVAF-GIGYYY-L-LKTPPVYTRTAELLVKR
A0A1Y4DYA7      LNLKDLLF----S----LLKKWYWFVISILISI-TIAIFY-I-MCTPPIYTRSASLLIKE
A0A1Y3X4I9      INFKDLMY----L----CLAKWYWFVISLVVLL-GFTALH-L-LTTPPVYTRSASLLIKE
A0A1Y4FNK8      IRIQDLFY----L----CLNKWYWFVISLAVTI-GVAVVY-L-LTTPPVYTRSASLLIKE
A0A355FD59      IRIQDLFY----L----CLAKWRWFVLSLFVTL-GIAVLY-L-LTTPAVYTRSASLLIKE
A0A359CEZ9      IRIQDLFY----L----CLAKWRWFVLSLFVTL-GIAVLY-L-LTTPAVYTRSASLLIKE
A0A353Q7B4      IRIQDLFY----L----CLAKWRWFVLSLFVTL-GIAVLY-L-LTTPAVYTRSASLLIKE
F8X3A5          IRLQDLLY----L----CLFRWRWFVISLFITL-SIATFY-I-LTTPPIYIRSASILIKE
A0A1M3KVR9      IRLQDLLY----L----CLFRWRWFVISLFITI-SIATFY-I-LTTPPIYIRSASILIKE
A0A4Y9IJS3      IRLQDLLY----L----CLFRWRWFVISLFITI-SIATFY-I-LTTPPIYIRSASILIKE
A0A4Q5WS95      --VEAFVY----R----YLPYWPLFAILAIFFT-ALSVGY-LRYAT-PVYEANATILIKD
A0A501VZX6      --FSSLLY----K----YLPYWPLFALLLLISC-LGTWGY-LRYFAIPSYETSASLIIKD
A0A399SH26      --LTVLLR----K----FLPYWPVFIGLAILSM-ALAWVY-LRY-ATPVYEIAATLIIKD
A0A501W1A9      --FGAIVF----R----FLPFWPLFVVLIGVCL-AGAWAY-LHYVATPTYSTSASLIVKD
A0A0E3ZGV6      --VASLVY----K----FLPFWPLFVVLFILSV-AGAWAY-LKFYATPTYAITASLIIRD
A0A1I2N4S1      --AVALLY----K----FLPFWPLFLVLLLLGM-AGAWAY-IKYYTIPSYAVTASLLIKD
A0A2T5YE44      --AVALLY----K----FLPFWPLFLVLLVLGM-AGAWAY-IKYYTIPSYAVSASLLIKD
A0A1V9FHD0      --ISLALN----W----YLPYWPLFLILIVLGS-AGALVY-LNFFATPVYETYATVMVKD
A0A4V4H170      --VSVAIN----W----YLPYWPLFLILIVLGL-AGAWAY-LKYFSTPVYETYATIMVKD
A0A1V9F098      --ISVVTN----W----YLPYWPMFLVLLILGL-AGAWAY-LKFYSIPVYETYATIMVKD
A0A4R2VU64      --ISVVTN----W----YLPYWPMFLILLVLGL-AIAWAY-LRYFSIPVYETYATIMVKD
A0A4S8HY23      --VSVAIN----W----YLPYWPLFLMLIVFAL-AGAWAY-LTYYATPVYETYATIMVKD
A0A1V9F383      --GSLIVN----W----YLPYWPLFLILIIVGV-GSAWAY-LHFIAVPVYETNATVMVKD
G8TRZ6          --GSLIIN----W----YLPYWPLFLILTVVGL-AAAWAY-INFVAVKQYESYATVMVKD
A0A543WA52      --FKLILS----R----FLPFWPLFAILIFFGL-LGAWSY-LKWAT-PIYGVSATLIIKD
A0A1M5BA90      --VEAFMY----R----YLPYWPLFALLLILAG-TAAYMY-LHYIAKPVYQISANILIKD
A0A512B879      --VERFIY----S----YLPYWPLFALLLVVFL-VAGSFY-L-YLTKPIYEISADILIKD
A0A559PPI3      --FSSMMD----L----FFPFWPLLAVILVVVL-FLAWGY-KNYAT-PIYEVSATLIIKD
A0A1T5CS78      --FRYIIK----T----FFPFWPLFLVLVVVCV-LGAWGY-LKYVT-PIYEASASIMIKD
A0A0Q9Z8F1      --FRYIIK----T----FFPFWPLFLVLVVVCI-LAAWGY-LKYAT-PIYEASASIMIKD
A0A2N0U0M7      --FRYIIK----T----FFPFWPLFLVLIVVCI-LAAWGY-LKYAT-PIYEASASIMIKD
                                                                 :          

A0A1T5MMH4      K-DE--------------ASELGISI-LAGKDQQNTDLISGEIEMIR-SRLFLDQVLDSL
A0A2W4R1L8      R-NE--------------ATELGINR-LV--EDQNLNIMSGEIEIIQ-SKLFLARVLDSL
A0A2E5CV79      K-PG--------------------TSMIMQYGSRDRSDMSNEIEVLR-SRRLAKDVVKLF
A0A2D4ZVH1      S-KNRYSYAGAGI----ENLLTSTYGIGVGST------IANELQIMK-SRKLSYDLAERI
A0A0K8QSK7      R-SGGSPFSQTES----AISSQAFEGFGIMGQNNN---IYNQIEVLK-SWPIIEEAVQEL
A0A1V6CN82      E--GSTTFWRQAG----GFSGEALRGFG--TSYQG---IQNQMIIMK-SQPVVAKAIREL
A0A1M4XZ45      G-KASSPLSGAMG----GAQQSIFQGLGGMNSMQN---IYNQMVVLS-STPIISRTLNEL
A0A399D319      E-KAGSPLASGAG----GSSEGIFQGLGMMNSMRN---IYNQMVILN-STPIVSRTLNEL
A0A1M6GR99      N-SG-------------SSSSSGESRYINSELLSRSQNIQNELEIIK-SFPNISQTVRNL
A0A1M6TTV4      K-SE--------------AGILGIQNPMDQDIKG----LSGEIEILK-SRLFASQVVNAV
A0A4Q8RX32      R-QR--------------NIADPTSFLPGSELFSGRNTFHNSLLTLQ-ARPLLEKVLNKL
K0X1U5          D-EKKGGGGLSSL----MGGISG--GGFSLDGMIGGGSVNDEILVIS-SHSLIREMVQRL
R5EXK3          D-EKKGGGGLSSL----MGDIAG--GGFSLDGMIGGGSVNDEILVIS-SHSLIREMVQRL
A0A401UAP7      N-NE--------------ANEFGITKIMEDQNLNL---ISGEIELIQ-SNLFLSRVIDSL
A0A1W2GF52      K-ND--------------ANLLGLQNPLEQDIKG----IAGEIEILR-SRLFFSKVVDAI
A0A2G5L7B8      K-SD--------------AGILGIQNPMEQDIKG----LSGEIEILK-SRLFASQVVDAV
A0A523GAC0      K-KD--------------ANFLGFLEINEEQNLNN---ISGEIELIK-SKLFFDKVIKTL
L8JW09          K-SD--------------ASELGLLGLSENKNLNI---ISGEIELIK-SKLFFSKVIETV
A0A5C7MX19      E-KK--------------AQILGVEKIAVEQDNAA---INREIQLFK-SRLLVERIVDSL
A0A364XUP5      K-NE--------------ATELGIAT-ITSDEPQNADLISGEIEIIR-SKLFLNIVLDSI
A0A1M5RLA9      K-NE--------------ATEFGIKP-TVED--PNFNLLSGEIELIE-SRLFLGRVLDSS
A0A385SFR9      K-KE--------------ATEFGIKP-TVED--PNLNLLSGEIELIE-SRLFLGRVLDSS
A0A5M4A9J4      D-KGSNPLEGSGG----SGSLNASDVFQGFGLFQGKQNLENQIQILQ-SWTLVSKAVNEM
A0A5M4B1C7      S-KGNNPLDGSSS----GTSFNASDVFQGFDLFQGKQNLENQRQILK-SWTIISDAVDKL
A0A0D3LFR6      N-KP--------------AASFGFVD-SD---KATMEGMSSEIELIK-SKLFLNKVLSAL
M7N6D4          N-KQ--------------ADFLGYRS-LDSDPNQNMNGMSEEIELIK-SKLFLTRVLKAV
A0A1Q3ZMZ7      N-DQ-------------GKEVLELENINSKKS------LSSNIELLK-SPVLFENAIKKL
A0A2D8JJW3      D-DN--------------SGIAKMPGFEAFSDDKK---LEDKIRNIG-LRPIAQATIDKL
A0A2W2AFF7      D-QK------AGN----MDGKQLLEDLGFLSGKGN---VDNEVEIFK-SRSLMESVVRDM
A0A2N5YXE2      E-NK-------------TNQILGINAGVMETD------LAPVIELVR-SNEFLKTVVASL
A0A2W1NDY9      K-DE-------------GQRILEFKDFNTENN------LSADVELLR-SPFLMEKVLMNL
A0A5C8AQR5      K-DQ-------------AKDVLNMENINSKSN------VSSEIELLK-SQFLFEKAIDKL
A0A1G0CI31      K-DQ-------------GKEIVEIENINTKDN------IASEIELLR-SELLFGMAVERL
A0A556N0M0      K-DQ-------------AKELLELDNINKIDD------ISSEIELLR-SQLLFEMAISKM
F2IKD6          K-DQ-------------GKQLLEIDNINKRID------ISTEIELLR-SQLLFDMTIARM
A0A1I7BM74      E-DQ-------------GANVLDLKNVNNDGN------ISKEIELLR-SQFLFEEALKRL
A0A2G2FJ17      E-DQ-------------GADVLDFKNIKEDAS------ISREIELLR-SEYLFEKALDRL
A0A077ENE7      P-SN-------------TPTTARITRSFGANTIS----VKDEILQLK-SKELMRLVVDKV
T0NN57          A-SN-------------TPTTARITRSSVASSVS----VKDEILQLK-SKELLRQAIDRT
X5K347          A-SN-------------TPTTARITRSSVASSVS----VKDEILQLK-SKELLRQAIDRT
A0A2I0QZ80      E-NQ-------------GADLLDLSDVRTEGS------IAKEIELLR-SQLLFKKAIKQL
A0A3E1F1A3      E-NQ-------------GADVLGFAEARSDGS------IAKEIELLR-SQMLFEKAVQNL
A0A2U2XBJ3      E-NQ-------------GADVLDFKDIRKEGT------IAKEIELLR-SQLLFEKAVADL
A0A4Q4KU94      E-NQ-------------GADLLDFKDARKDGS------IAKEIELLR-SQLLFEKAIDDL
A0A2U1FKU2      A-EK------NGV----SGGLSQFQDLGLLMGNSE---VENELLVFK-AKRLTAIVVDKL
A0A0A2F954      A-EK------SGA----TSGLQQFQELGLMTGNSE---VENEILLLK-SKRLTAVVVDKL
A0A0A2FW91      A-EK------SGA----TSGLQQFQELGLMTGNSE---VENEILLLK-SKRLTAVVVDKL
A0A2D2N2N1      A-EK------SGA----TSGLQQFQELGLMIGNSE---VENEILMLK-SKRLTAIVVDKL
Q7MWZ2          A-EK------SGA----TSGLQQFQELGLMIGNSE---VENEILMLK-SKRLTAIVVDKL
T2NDT6          A-EK------SGA----TSGLQQFQELGLMIGNSE---VENEILMLK-SKRLTAIVVDKL
W1R7P9          A-EK------SGA----TSGLQQFQELGLMIGNSE---VENEILMLK-SKRLTAIVVDKL
A0A1R4AFZ0      A-EK------SGA----TSGLQQFQELGLMIGNSE---VENEILMLK-SKRLTAIVVDKL
A0A1R4DVZ7      A-EK------SGA----TSGLQQFQELGLMIGNSE---VENEILMLK-SKRLTAIVVDKL
A0A5M4B212      Q-QNQSPLTTPTD----SEANVFQGFGLFQGTQN----TENQIQILK-SWTQIRKTLEHF
A0A1T5K9D4      P-SNTRATTKLDN----YSNLINSVS------------MSNEMLQLK-SKTLMAEVVKDL
A0A3D1KEX9      N-DNNGKYANNSA----LNALKQLNGVQVTDN------LKNEIFILQ-SRRLMEMVVERM
A0A358Y7S2      E-NK--------T-----RDILGKDALNVEKALN----LNQEVELLR-SELLINKVIEKL
A0A1X7J248      R-SE--------------ASVFGFNP--LSEESSNLNTLSGEVELIR-SKLFLKQVINKL
E4TQD2          R-SE--------------ASVFGFNP--LKEENSNLNTLSGEVELIR-SKLFLKQVIDKL
A0A2J6HHN3      D-DK--------------GQMLFETKNLYDED------IYRKIEVMR-SPVFIRRVVSRL
A0A1Y3WMT8      D-DKQGGGGALSS----LVGDVTGGG-FSLDGMIGGGSVNDEILVIS-SHTIIREMVQRL
A0A1Y4GQU1      D-EKKGSSGSLSS----LMSGVSGGG-FSLDGMIGGGSVNDEILVIS-SHTIIREMVQRL
A0A1V5W8T5      E-QN--------------EDLLKIDN--IYGQTS----ITNLIELIR-SREFLKRTLHKL
A0A2T8HKA9      P-QNTNVTARFTR-----SSMMNTVS------------VASEILQLK-SKELMRHTIATI
A0A3B8INU3      K-SE--------------ATLFGFSN---FNENPNLNYLSGEIELLK-SRLFFSQVISAL
A0A414ZBF2      E-QGGGNMGESAA----FRDVFSLGN----------SKVDNEMGFFK-SKRLMMEVTRQL
A0A1Q3Q573      E-KS--------------TQILGIDNLVFEKDPTE---INREMQVLK-STMLLGKIADKL
A0A662BAY3      G-NSNSPLTNKNA----NEDNVFQGFGITDSDRN----IFNQLIVLT-STPILNRTLEEL
A0A4U3L369      Q-SG--GSSGSSS----LSASSGIFQ-DLGGAFSMASTVNNEEEILL-TRSLMYRVVKDL
A0A357YNR3      D-QK--------------GGASEVTTFREMGIVSRRNNADNEVEILK-KTMIVEKVVRDL
A0A5E8AX52      Q-NE--------------AVILGVQNPLENSGVNS---LSGEIELLK-SNLFFSRVVEAI
F4KK08          E-TS--------I----NSAIERLAQ-FTGDKHSYSDDVSNQIIILG-TERVVSETVRRL
A0A496LCF9      E-SG--------S----LSYMQNMTQNFGVVDKTN---IENQILLLR-SQDLIARTIDSL
A0A5P2G2A9      D-QKGGMSGMLGS----SSSGSNSSFGDLSSLLNVKSSVDNELLILQ-TRDLMHKVVVDM
A0A419VXB7      K-ES---------------SGVDLQNIFSSSPLKSDVKLSNHIEILK-SFSLNYEVLENL
C3J7R8          K-MD--------A----SNVLSELFESSALTSLGGRSAVENELFILK-TDFLIDQVIERL
A0A0B0BTJ4      Q-YN------RSS----NSDLTGFMPGRMMYRTNSG--VEDELLIMG-SRSIMERVVAEL
A0A3B9CNN6      Q-YN------RSS----NSDLTGFMPGRMMYRTNSG--VEDELLIMG-SRSIMERVVAEL
R5X290          Q-YN------RSS----NSDLTGFMPGRMMYRTNSG--VEDELLIMG-SRSIMERVVAEL
A0A1Q6E6I7      Q-YN------RSS----NSDLTGFMPGRMMYRTNSG--VEDELLIMG-SRSIMERVVAEL
A0A1G8BVM8      D-KK-----GGGG----ISEAAAFQDMFSMGSNS----VYNEMGILK-SRQLMLQVVEQL
A0A2G2F510      K-DT--------A-----KEVLDFQN-LGSRDNQ----LSGVVELLR-SELLFKRAVKSL
A0A316JZ08      Q-DK--------A-----ADVIDFEN-INTLDDD----ISAVVELLR-SELLFERAVDKL
A0A1I1FXP9      K-QQ--------A-----SGLLSRVY-SATGEEMQSSNLSGEIELIT-SFMLYNKVIDKM
A0A3N4H5N3      G-DR--------P-----TTVAESSVLNELDNLKTSIKLENEIEKLK-SKSLMNEAVISN
A0A2P8EAX2      G-ER--------A-----GNLTESPILSDLENIKTTVKLDNEIEKLR-SKSLLNEAVISK
A0A4V2F6N9      G-ER--------A-----GNLTESPILSDLENIKTTVKLDNEIEKLR-SKSLLNEAVISK
A0A3B9FXJ0      F-DP--------------SSSLDFADILRPGNVDR---LNEEMTVIT-SKSYKYNALQEL
R5GSU5          A-DGSSGSRRMPS----NMNALLELN-GITAGDQ----LQNEIFILQ-SHRLIERVVTRL
A0A2A3UE91      A-NQ--------A-----DDILKLNS-LSNNGNV----LAEAIEQIR-SKVFLKRVVEKL
A0A0A2G557      K-SD-----ISGP----LADIMKISG-TDIGGIKGNDKIENEIIIFR-TERLLSRVIDEL
A0A2N2WFW8      D-DK--------A-----QKLFESKN-FYDED------IYRKIEIMR-SPVFMERVIEKL
A0A1F3IU95      D-DK--------A-----EKLFDNKT-YYEDD------IYRKIEIMR-SPVFMQRVVSNL
A0A3D0VUF6      D-DK--------A-----EKLFDNKT-YYEDD------IYRKIEIMR-SPVFMQRVVSNL
A0A1T4PT95      E-SN-----MSGP----LADIMKISG--AELGFKGTDKIENEIIIFR-THNMLSQVVNRL
A0A4P5TMD1      V-NTSSSLGIGVT----SGGVNSADQ---MDHNE----LQKNIQIMK-SNVILDRVIDQL
A0A651GU15      S-DN--------A-----TKILQVNK--IYEEKT----LSAELELLR-SKLLLQETVKRL
A0A3Q9FR88      T-SS------SQD----FAEKFGIMN-NSLNDGK----LESEMALIT-SGVTYNRVIDSL
A0A553GEX3      T-SS------SQD----FAEKFGIMN-NSLNDGK----LESEMALIT-SGVTYNRVIDSL
A0A150ADJ9      T-SS------SQE----FAEKLGLMS-NSLNDGK----LESEMALIT-SGVTYNRILDSL
A0A1B1FWQ4      T-SS------SQE----FAEKFGITN-SSLEEGK----LESEMALIT-SGVMYERIVDSL
A0A1S1Z228      T-SS------SQE----FAEKFGIAN-SSLEEGK----LESEMALIT-SGVMYERITDSL
A0A2A4PYG9      Q-NT--------A-----QKVLNVEN--IYEQ-D----VAGEIELIR-SRAFLSNALSRI
A0A1F3K695      Q-NQ--------A-----DKLLNLES--VYENTN----LAHVVELIR-SKEFLKRAFEKL
A0A353KZR1      Q-NQ--------A-----DKLLNLES--VYENTN----LAHVVELIR-SKEFLKRAFEKL
A0A2N2WYB5      N-DR--------T-----TRLLNIED--VYQNDD----ISKVIELLR-SKEFLKRAFSNL
A0A1F3K4G0      T-NN--------T-----TKVLKIED--VYQDND----ILKVIELLR-SKEFLKRTFLKL
A0A356H8Y3      T-NN--------T-----TKVLKIED--VYQDND----ILKVIELLR-SKEFLKRTFLKL
A0A351HSA6      T-NN--------T-----TKVLKIED--VYQDND----ILKVIELLR-SKEFLKRTFLKL
A0A1F3Q014      T-NQ--------A-----SKLLNVGN-ITEPDNG----LAEGIELLK-SKVFLKRVLSQL
A0A2A4YXP3      L-NT--------A-----SSVLNVGG-GFKESNS----LAKDVEILR-SKLLFKRALRKI
A0A2D5KD44      S-NQ--------A-----NRLLDVED--YYESND----ISSEIELLK-SPLLMEATLEKL
A0A1F3R158      K-NT--------A-----DQVLKVDN--FEEKED----VEKDVELLK-SKFLLKRALSKL
A0A2M8ADX2      K-NT--------A-----DQVLKVDN--FQEQED----VAKDVELLK-SKFLLKRSLLKL
A0A1J5B2H0      D-NE--------A-----QKIFQTNNINVEEDNN----LAKQIELMR-SSLFLNRVISKL
A0A1V5N756      E-EE--------V-----RQVFGKKT-----QVD----LAKKVELLN-SSMFLSRVFSKL
A0A1F3SJM1      K-DE--------A-----KDVLNIDN-LNVRGDQ----LSSVVELLR-SELLFERAIAHL
A0A2G2EB96      Q-DS--------A-----KDVLDIEN-INSRDNE----ISSVVELLR-SELLFERALNKL
A0A2G6PRA9      K-DN--------A-----KDVLNIEN-INSREND----MSGVVELLR-SELLFEKALNKL
A1ZKR2          K-DE--------G-----VGMLGIKG-LIPGGSYSGGNLVGEIEFIR-SQIIFNDVINAM
A0A1Q3GX01      K-DE--------G-----VQMLGIKQ-LITNNN-SNGNLIGEIEFIR-SQIIFNAVINTM
A0A349DQI4      K-DE--------G-----VQMLGIKQ-LITSNS-INGNLIGEVEFIR-SQIIFNSVIDAM
A0A2N3IIZ0      K-DE--------------SAGLDL-R-IGLNQENPIDNIAGELEVIR-SPLIYEEVLKNI
A0A497D5Z2      K-NTGSPLSGNMN----NGDVFQGFS-LMGSDYN----LFNQMAVLK-SKPLIRRVVDEL
A0A662B170      K-NTGSPLSGNMN----NGDVFQGFS-LMGSDYN----LFNQMAVLK-SKPLIRRVVDEL
A0A2A5FYT6      D-NT--------A-----SQILEATP-AYLRQD-----ISGDIEFLR-SKEFFKNILNTL
A0A2E6SYP1      K-ND--------V-----NQMMNFEN-IYETN------LVAEMSRLK-SKKMLSEALADL
A0A2E5RLE8      K-ND--------V-----NQMMNFEN-IYETN------LVAELSRLK-SKKMLSEALNTL
A0A2E7TQF6      K-ND--------V-----NQMMNFEN-IYETN------LVAELSRLK-SKKMLSEALNTL
A0A2E6GVY9      K-ND--------V-----NQMMNFEN-IYETN------LVAELSRLK-SKKMLSEALKTL
A0A350JJ90      E-NQ--------A-----NRILNV-G-DIYEDAD----ISKDIELLR-SPEFFKRVIANL
A0A3M1CDV2      S-DA--------------HQILQLNP-ANTEGNNK---VAEAIEQIR-SKTFLERIINNL
A0A522EYA6      D-NQ--------A-----SRILNVDN-FNEAQND----IAKSIELLR-AKVFFKRVLATL
A0A4P5U6G4      E-NT--------------SKAIGLDN-IGLEASRGNADLQRDIQVMK-SNLIMDRVLDKL
A0A2E2TFD1      S-NQ--------A-----SQLLEIDF-GKNQNED----MMSDLEVIR-SKEFLKTIFKKL
A0A2E4ELE6      Q-NR--------A-----TQVLDLE--RMNEKAD----ISADIEIIR-SKEFLKTIFAKL
A0A2E3XZI5      K-DE--------P-----LEFMQMNP-LSSNSTN----LKSELAIIK-SQKSILRLIKKL
A0A2M7NLQ9      K-GT--------------SELLGR-G-IFSSDENVTNFLVGEIELIL-SRSVYEEAVKRL
I4AFR0          K-GT--------------SELLGK-G-IFASDENAINFLSGEIELIL-SRSVYEEAVKKL
A0A2N2Y3E5      E-AD--------K----TNKILNI-Q-NIYDEFN----PNQTIELIR-SKEFIKRVIKSL
A0A2D9D7T6      E-DR--------V-----KEVLGK-D-AFTDRESADGGLSKYIELLK-SEFIFEKAVERL
A0A1F3PPL5      N-NN--------A-----DKVLEI-E-NLREENT----IAQTIELLR-SQEFLKRVFSKL
A0A357QK06      N-NN--------A-----DKVLEI-E-NLREENT----IAQTIELLR-SQEFLKRVFSKL
A0A662AEA4      E-GS--------K----AQKILNI-E-DIYEKKD----ISNVIELLR-SKEFLKRVFKKL
A0A0S2HYK8      D-KK--------T-----SQVFQLDD-LYEDNKK----LNKTIALIR-SKEFLKRTFAKL
A0A2N5ZWN6      D-NK--------N-----TQVFQLDN-LYEDNKK----LSKTIALIR-SKEFLKRTFSKL
A0A0F2NS19      E-NT--------A-----NKVLQV-D-NFSKTED----VAKDVELLR-SKLLLKRALSKL
A0A2A5H8X6      E-NT--------A-----NKVLQV-D-NFSKTED----VAKDVELLR-SKLLLKRALSKL
A0A2H0GAU8      E-NT--------A-----NKVLQV-D-NFSQKED----IAKDVELLK-SKLLFKRALSKL
A0A2M8FTK1      E-NT--------A-----NKVLQV-D-NFSQKED----IAKDVELLK-SKLLFKRALSKL
A0A2A5B3B0      L-NT--------A-----SKVLEV-R-EFQETNS----LSKDVEILK-SKLLFKRALKRI
A0A5C6RXM7      L-NT--------A-----NQVLNV-D-NFHENNT----IDKDIEILR-SKLLFRRAISRL
A0A2E0FJ09      Q-DN--------A-----RRILNVKN-PLQEDET----LTGDVELLR-SPLLMEKTVASL
A0A1F3FZ62      S-NS--------A-----NKVLQTAN-IYDGEND----ISKTVELLK-SKVFLKRVFSKL
A0A1F3K211      S-NS--------A-----NKVLQTAN-IYDGEND----ISKTVELLK-SKVFLKRVFSKL
A0A1F3KLL5      Q-NQ--------T-----AEILGFKN-NFIKPSE----LPAVMELIR-SNEFLKRVFVKL
A0A359D1M1      Q-NQ--------T-----AEILGFKN-NFIKPSE----LPAVMELIR-SNEFLKRVFVKL
A0A2E7CT70      K-DK--------A-----DELLEI-Y-SFQQKTN----INSEVELLK-SQIIIDKAIKKL
A0A2D5V560      K-EQ--------P-----NGFSDL-Y-SYNINTN----LNSEIALMN-SEKAIEKVIRDI
A0A2D7K5A8      K-EQ--------P-----NGFSDL-Y-TYNINTN----LNSEIALMK-SQKAIDRVIEDL
A0A2E1XQ82      K-EQ--------P-----NGFSDL-Y-TYNINTN----LKSEIALMK-SQKAIDRLVEDL
A0A1V6I2U9      E-NK--------T-----NQILGI-S-SNLMEKD----LAPVIELIR-SNEFLKTVVEVL
A0A1F3C1M2      K-NQ--------T-----NQLLNI-E-NVSDNNE----LAQIIELIR-STEFLKRTFNKL
A0A1F3DS87      K-NQ--------T-----NQLLNI-E-NVSDNNE----LAQIIELIR-STEFLKRTFNKL
A0A2H0B957      E-NT--------N----ANKILNL-T-NAVEEIN----SIQTIELIR-SKEFLKKTFNKL
A0A1F3CFW6      E-GT--------T----ANKVLNL-T-TAVEEIN----SMQVIELIR-SKEFLKRTFNKL
A0A2M7E2T8      E-GT--------T----ANKVLNL-T-TAVEEIN----SMQIIELIR-SKEFLKRTFNKL
A0A2M7NC69      E-GT--------T----ANKVLNL-T-TAVEEIN----SMQIIELIR-SKEFLKRTFNKL
A0A5C8A5B4      KKRTGFSENSEFI------------KGTSYLSNS--VDLEDNLAVLT-SNKIMTSTLQRL
A0A4Y9ITE2      N-DTKSDFLRSFS-------MADM------FGGK--SSVDDEIAIMY-SHSLFSEIVKKF
A0A5M8NYX7      E-QKGRTAMDMNT-------FSDL-G---FMPKI--GSFDNEIEVLQ-SKTLMKEVVDSL
A0A3D5KRY6      E---SKTTDLNNI-------YRQL-S---TIQGG--PAIQDEVGVLQ-SYNLSLQTVKYF
A0A1V5IPN7      Q-------SSGAD-------ILLLTN---QGGGK--NSINNQIELMR-SKPILNAAYEIM
A0A0E3V905      Q---QKGSEQSSS-------LKEL-G---VFAHK--QVVENEIEILR-SFTLMNRVADKL
A0A553ETH6      E-------ANASE-------LGLV-N---FGENNNINVISGEIELIQ-SRLFFNKVIDNI
A0A640Q161      D------KANVVS-------IEEV-Y---GLDTKRKDYMQTQYEILQ-SRQIAERTVESL
A0A640QU49      E------KANVVS-------IEEV-Y---GLDTKRKDYMQTQFEILR-SRQIAQRTVESM
A0A1Q3PII2      D-SRGSDFNESAL-------LEEL-G---LPNAT--SSVENEIEILR-SRTLLSQVVADL
A0A351BXT2      P---QGSVLSSSL-------IPEF-Q---DFITD--RYISNEIEVLK-SYKIREMVAENL
A0A2K8Z965      Q---QKGSEQNNT-------LKEL-G---VFTPK--QVVENEIEVLR-SFTLMNRVVEKL
A0A418M8U8      E---KKGNERDQP-------LKEL-D---AYVPK--KVVENETEILR-SYTLMNRVVDKL
I2GTA4          E---KKGNERDQP-------LKEL-D---AYVPK--KVVENETEILR-SYTLMNRVVDKL
A0A2K8ZAJ2      E---RKGISEQSA-------MKET-N---IFTQT--KLVENEIEILR-SYSLMDRVVTNL
A0A368JPA3      E-PPKSGVSSDGI-------LKDL-T---TYSPG--KVIENEIEILK-SSSLMKKVVDSL
A0A5N1JI29      E-PPKSGVSGDGI-------LKDL-T---AYSPG--KVIENEIEILK-SNSLMKKVVDSL
A0A3P1BT12      D---QKSPSDNGV-------LKEL-N---IYSPS--KVVENEIEILK-SNSLMKKVVDSL
A0A3P1CI15      G---KDNVADEGL-------LKQL-H---IYSPN--KVVENEIEILK-SNSLMKKVVDSL
A0A4R8CUK1      E-PRIGA--DESI-------PADP-D---NRNQQ--TVVDNELEILT-SNSLMKKVIDTL
A0A3D0MYJ7      --------KQQSI-------LTGL-S---VPEGSAGSDIQSQIAIMK-GYYVREIVAKSI
A0A662AH13      --PSSGGILDAPL-------LPEF-S---SFGDD--RFIANEIEILK-SYRLRTMVANAL
A0A5C7QA01      S-KGASS----AL-------LGDLSS---MIEQK--SPAQAEIEILR-SRLVLGEVIGQL
A0A3D3LS70      ---PQGSLLTSNM-------IPGF-S---DYASD--RSISNEIEILK-SQTIRSLTATAL
A0A1G1TM36      G-NKQPG--ERSA-------LQEL-D---FANGN--NVLESEMEILR-SRRLMQQVVQTL
A0A1G7ZF38      D-SRGSDFHETAL-------LEEL-G---LPDAT--SSVENEIEILK-SRTLLSQIISDL
C6VS52          D-SRGSDLHETAL-------LEEL-G---LPDAA--GSVENEIEILK-SRTLLGQVVDDL
A0A0P7X1V8      A---GNRYSMAGS------DLSNLMVSNFGIGMG--SSIENEIHVLQ-SRTFTGELAQRI
A0A3B0C2S4      E-AKEMDITVDPMALL-------------SGNPG--INLDNEIQVLK-SYRILGQVVEAL
L8JI02          E-RKNDLGGKEFL------------RGMGLFTSD--TELEDEIGILK-SYGMVSNAIRSL
A6EBM4          Q-KTALSDIADAL----------------NTNTA--TNMQSESFAIE-SRHLLLNAIKRL
A0A416GA42      K-ESGTRTPSEAE------IFKEV-G---FMNLS--GNVENEILIFK-SLHLAEQVVRRL
A0A4R5DL69      D-TKGTDLGEAAI-------LENL-G---LAPGK--SNVDNEVEILK-SRTLIESVVSDL
A0A1T3IYP5      PSNTPTTARITRS----------------SVANV--VSVKDEIIQLK-SKELMRLVVDKV
A0A1M4YED3      E-KRGVNES----------KMEESLD---FYQSN--KVVENEIVVLS-SKGLMEKVISNL
A0A3P1Z8V4      S-SDSSHGGMRSRSKNSLNTLMQL-N---GINVG--DNLENELFILS-SLRLMKQVVATL
A0A2N3U785      N-NKGASVYENSF-------FSEL-G---IFQTN--QSINDEIELLK-SISLMQRVVKDL
A0A0E3ZG78      D-KSDSHLSNESA-------FSDL-E---IFQAT--KNINNEIEVLQ-SESLMKRVASEL
A0A1I6BRK6      D-KSGQSLSNADA-------LSDL-N---TFKAT--RNVDNEIEVLK-SKGLMERVIREL
A0A243WAB1      D-KSGQSVSNAEA-------LSDL-T---MLKSA--RNIDNEIEVLR-SESLMEKVVSEL
A0A126PFG0      E-KKTPAEKSALQELD-------------LVTTP--KVVESEMEILK-SRKLMLSVVRDL
A0A3M1N7Z3      A-QAVGGFQTQNTAGS-------------FFPPE--VLTEAYLELWS-RYDLIAQVVQQL
A0A2H3NSN0      -----KPNQAQTV----------------RFDIQ--PELSSEIGILTNSGSLAMRVITEL
A0A2P6C324      REAAPARMMVGL-------------------NEQ--RDLSSEIGLLKNSGELARRVVSTI
A0A1M6XHU0      RGSGNAPVSVAAF----------------TPIER--RALSNELGILKNSAELATRVAKAI
A0A5S9C8G0      RGGGNAPVSVAAF----------------TPIER--RALSNELGILRNSAELATRVAEAI
G2SF81          RGSGNAPVSVAAF----------------TPIER--RALSNELGILRNSAELATRVAEAI
A0A5S9EYW1      RGGENAPVSVAAF----------------TPIER--RALSNELGILRNSAELATRVAEAI
D0MHQ9          RGGGNAPVSVAAF----------------TPIER--RALSNELGILRNSAELATRVAEAI
A0A4D7K1D4      K-DETSVLTFGVD------------P---QKNNM--NALSGEMELLR-SKVFFSRLIDSL
A0A3C1ITV0      D-NKGQAQISELA------AFADL-G---IGSTG--IDVYNELQAFQ-SPLLMQDVVNQL
R7HN19          D-NKGQAQISELA------AFADL-G---IGSTG--IDVYNELQAFQ-SPLLMQDVVNQL
A0A060RD97      K---SGSGQGEAA------IFADLGL---LSSTS--SLVDNEIFILR-SASLMRTVVQKL
A0A0D3L8Q3      D-QQSGGLTESA-------VFNDI-P---GFKSH--TNIDNEIRLLK-SQSLMHRVFNEL
A0A5B6TJH8      N-QRGQGISGAG-------TFSDL-D---MFNST--KVVDNEILILD-SKTLMERVVQDL
A0A519U664      D-KGGQGLSNAD-------ALSDL-T---TFKST--RSIDNEIEVLR-SASIMERVAKEL
A0A519UDD1      D-KSGQSLSSADN----TGVLNDL-S---TFKST--RNIDNETEVIK-SKSLMNRVAKEL
A0A519MA34      E-KGGQGLSNAD-------ALSDL-T---TFKTT--RSVDNEIEVLK-SASIMERVAKEL
A0A519UCX0      D-KSTQGLSSAD-------ALSDL-T---TFKST--RSIDNEMEVLK-SVSIMERVAKEL
R7PCR1          N-NDSGSMGRAGRGANMLLELNGV-------SVG--NSLQDETFILQ-SYRLMERVVSRL
A0A350IHV0      S-NENSAMKELAS------FTNAMSL---RRNSG--ANVYNEMESFT-SPDIMSVVVDRL
A0A1G9E2A9      K-RNANVL------------FGRNSD---LGSQV--ENITGEIEFIK-SRLVYNRVIDSM
A0A098LL25      K-SEAGVLGLNK--------FNDENM---PGNKL--STISGEIEFLK-SRYLYEKIVDRM
A0A2T2YJE8      Q-SEAGRLGLGGT-----------IE---NQQTL--SNLSGEIEIIK-SNFTFERLQQKL
A0A127B287      Q-TEAKVLELPGA------------G---MESDL--GKLQGEVDLIK-SDLVYDRLKKSM
A0A3M9N829      Q-SEAGVLGL----------ESNGLP---IEAGA--GKLQGEVDLIK-SDIVYERLKKTM
A0A0P0CSF9      Q-SQAGVLGL----------QNSGLK---VESGI--GQLQGEVDLIK-SNIVFERLKKTM
A0A5M8QQB8      Q-SEAGVLGL----------ENNGLK---VESGI--GKLQGEVDLIK-SNIVFERLKETM
A0A3M9MNC3      Q-SEAGVLGL----------ENNGLK---VESGI--GKLQGEVDLIK-SNIVYERLKKTM
A0A5B6TAX2      Q-SEAGVLGL----------ENNGLT---VESGV--GKLQGEVDLIK-SNIVYERLKKTM
A0A5N1IQ33      K-SQSGVLGLESA--------GKAVD---ARQSS--KNLAGEVELIK-SSVIYQRLRDSL
A0A512AYT3      Q-SQAGALGLGGP-------MGDAAS---SQQSM--ASLSGEVELIK-SDLIYENLKRRL
A0A5M6CYN7      Q-SQAGALGLGGP-------LSD-------QQAI--SSLSGEIELIK-SDLIYENLKRRL
A0A369QP10      Q-SEAGRLGLDG-----------TIE---NQQNL--SNLSGEIEIIK-SNLTYERLQQKL
A0A126PDF2      R-SEAGVVGLGGQ-------LAAA-D---PR-AS--SKLAGEVQLIK-SEIIYKELRDSL
A0A2Z3GKA1      R-SEAGVVGLGGQ-------LAAA-D---PR-AS--SKLAGEVQLIK-SEIIYKELRDSL
A0A502GZP7      R-SEAGVVGLGGQ-------IAAA-G---PSVGA--SKLAGEVQLIK-SEIIYKQLRDSL
A0A519SBU8      H-SEAAKVGLGGL-------ADA------DARNG--AQLAGEVELIK-SNLTYKNLKERL
A0A4Q3JNZ3      H-SEADKFGIGGI-------KG--------EP-G--NQLAGEVELIK-SNLTYQHLKERL
A0A519Q9V3      R-SEAANLGLGAA-------KGG------DSP-S--NQLAGEIELIK-SNLTYQHLKERL
A0A0M3RW20      K-QEAGTLGLGGG-------LAGP-E---GPLSM--NNLSGEVELIK-SNLIYRQLRDSL
A0A495VFX4      K-QEAGTLGLTGK-------LAVA-E---GPLSM--NNLSGEVEFIK-SNLIYRQLRDSL
A0A1S9B3W0      K-TEAGQLGLLP---------PGAAD---PRQSM--SQLAGEVELIK-SDLIYTRLRDSL
A0A1W1VRL3      K-TEAGLLGLGA---------GGSVE---KRRPG--ANLEGEVELIK-SNLIYRRLKDSL
A0A1M6R305      K-TEAGALGLGGA-------LGEGVA---GRQSI--SKLSGEVELIK-SNIIYRRLKDSL
A0A4Z0PHK3      K-TEAGALGLDGP-------LGQAV----GASSL--NKLSGEVELIK-SNIIYERLKDSL
A0A2M9B9H9      K-TEAGILGLDGP-------VGQAV----GSSNV--NKLSGEVELIK-SNIIYQRLKDSL
A0A4Z0QCY9      K-TEAGVLGLDGA-------LGQAV----GASSL--NKLSGEVELIK-SNIIYQRLKDSL
A0A418R9X5      K-SEAGVL-LGG--------IGQAAE---QKQTL--NKLSGEVELIK-SDIIYRRLKDSL
A0A428JSJ3      K-SEAGLL-LGD--------VGQAAE---QKQNL--NKLSGEVELIK-SDIIYRRLKDSL
A0A428KI59      K-SEAGVL-LGD--------IGQAAE---QKQTL--NKLSGEIELIK-SDIIYRRLKDSL
W8F1I6          K-SEAGVL-LGD--------IGQAAE---QKQTL--NKLSGEIELIK-SDIIYRRLKDSL
A0A246FQC0      K-SEAGVLGLGA--------LGGAID---QKKNL--NSLSGEIEVIK-SDIIYQRLKDSL
A0A372E5P8      K-TEAGVLGLGG--------LGGAVE---QKQSL--TKLSGEVELIK-SDIIYSRLNDSL
A0A1H3EMW1      K-TEAGVLGLGG--------LGAAVE---QKQSL--NKLSGEIELIK-SDIIYRRLNDSL
A0A1H9ZSN3      K-TEAGVLGLGS--------LGGAVE---QKQSL--TKLSGEIELIK-SDIIYSRLNDSL
A0A5N1J2M4      K-KEAGLLGLK---------LGESDK---QRVGT--NQLSGEIELLK-SNLIYEKVRQSM
A0A519S476      K-SEAANLGL-A--------SVKALD---NTQPA--NQLAGEVELIK-SKLTYQALKERL
A0A4Q3JRW8      R-SEAANLGFGA--------AVKGEE---GANTT--NQLAGEIELIK-SNLTYKNLKDRL
A0A519M923      R-SEAANLGLGG--------AAKGAD---DGRPG--AQLAGEVELIK-SNLTYQHLKERL
A0A4Z0ENW1      R-SDASALGLG---------MAMGGG---DNNQA--SQLAGEVELIK-SGLTYKRLKQTV
A0A519UDB4      R-SNANDLGLG---------ELTGRG---NDNNS--SQLSGEVELIK-SNLTYKRLKQVV
A0A3S0QKV1      K-RQDAELNLPGL---------VANP----QQNV--NKLAGEVELIK-SDLIYSRLRDSL
A0A328BL48      K-QQAGDLGLLAA---------GAQA---GQQGM--SKLSGEVELIQ-SDLIYTRLRDSL
A0A5R8WLY4      K-QQAGDLGLLSA---------GAQP---GQQGI--SKLSAEVALIQ-SDLIYTRLRDSL
A0A1I5WSL8      R-NEGSALGLAGQ-------MAPAAA---DKGRG--GKLAGEVEVIK-SNIIYRRLKDSL
A0A0U3JVM7      R-NEGSALGLAGQ------AAAPAVM---DKGR---TKLAGEVELIK-SNIIYRRLKDSL
A0A1G1SSV2      R-NEGSALGLGGQ-------GAPAVV---PNGR---TKLAGEVELIK-SNIIYQRLKDSL
A0A1G1SXV7      R-NEGSALGLGGQ-------GASAAL---PNGR---AKLAGEVELIK-SNIIYQRLKDSL
A0A0W8EDI5      K-TQSAVLGLGG--------VGGSAE---AQQNA--KNLAGEVELIK-SNLIYRKLQDSL
A0A3B7RBP8      K-TQTAVLGLGA--------VGGAAE---AQQNS--KNLAGEVELIK-SNIIYRKLQDSL
A0A3R9P8H7      K-TEAGVLGLGG--------LGGAVE---QKQNL--NKLSGEIELIK-SDIIYRRLKDSL
A0A238WIA7      K-TEAGVLGLEG--------LGKMVE---QKQTV--TQLSGEMELIN-SDLIYRRLRDSL
A0A212UCJ7      K-TEAGVLGLEG--------LGKMVE---QKQTM--TQLSGEIELIK-SDLIYRRLRDSL
A0A4Z0MQE1      K-TEAGVLGLEG--------LGK-------APST--SQLSGEIELIK-SNLIYRRLRDSL
A0A4Z0PCF4      K-TEAGVLGLEG--------LGKMVE---QKQTI--AQLSGEIELIK-SDLIYRRLRDSL
A0A5D6VDG1      K-EDAGALGLG---------LGAGAE---ARQNM--NNLSGEIELIK-SNLIYRQLKDSL
A0A243WHR7      K-TEAGALGLGGA-------LTGDI-----RQSG--NKLSGEIELIK-SNIIYEHLKDSL
A0A5B8A0P6      R-TEAGALGL-GA-------LGQG-D---GRQNI--NKLSGEVELIK-SNIIYRRLKESL
A0A076HRT9      K-TEAGTLGLGGA-------M-KEAE---GRQSL--NKLSGEVELIK-SNIIYRRLRDSL
A0A4Z0PVM7      K-TEAGALGLDGP-------LAQAVG---S-SSL--NKLSGEVELIK-SNIIYQRLKDSL
A0A1M6DHW8      K-TEAGALGLSGT-------MGKGIE---ERQSI--NKLSGEVELIK-SNIIYRRLKDSL
A0A4Q5LC61      K-TEAGALGLAGP-------LGKGIE---EQQTL--NKLSGEVELIK-SNIIYRRLKDSL
A0A2A8CVM9      G-AQSGP------------------GGMGAFGQQ--RDLASEVGVLQYSAELASRVVAEL
A0A3C0ZQC7      K-GQQ-SQMPLFD------VTGI--------GAV--KNIKNELEILK--SRSLAEAVAVR
A0A2E3R1D0      T-DTDLADVLPEA------MP------SGFWRQE--RNLSNELLVLD-QSMPLAEAVAAR
A0A2T2USC0      Q-QRQVSSILGEQ------GSSF----SPFGSQ---NNLANEVLVAN-QSEAITRNVATR
A0A2T2V0F3      Q-GEGVSSILSES------G-SM----NPFGSR---RNLANEVLVAN-QSEAITRNVAVR
A0A2T2S682      G-QSR-SAVPSLT------GGRSS-GASALGGQR--RSLSNQILVIN-QSEALAQEVAVR
D5H561          G-QQS-GTESAIG------AQAQA-QGSGLLPSS--SSLRNELMFLR-NSQALRERVAER
A0A2H3NWA9      D-SPS-TLVS--T------RGRM----VPGLAGN--RSLSNQLFVLR-QSRELAQRVADR
A0A2A8CVB6      Q-SQSGGVVAQLS------SRGL----SPYSAES--RTLQNELFVLQ-QSMTIPNRVADS
A0A2P6C1S6      N-QQS-SVLSGLG------RGRT----SPFLQQD--QTLQNELLILR-QSRTIANRVARQ
A0A2T2UTM4      E-GQT-SVLSGLG------RGRR----SPFGQRD--QTLQNELLILR-QSRTIARRVAKR
R5RVP0          T-NENSA-LRDLASFTGGVRYRSM--------NG--SNVYNEIEAIS-SPDIMQTVVKRL
R6A0L2          SNGSSTGGLRRTSKNSGMNTLLEL-N---GVSVG--DNLKNEIFIIS-SKRLMSRVVDKL
R7LG80          ADSDPRSRMVK----GNMSGLLEL-N---GISVG--DNLKNEIFILS-SKRLMTRVVDKL
A0A2L2WX98      TDGRSAMGRKASS------SMNTL-LELNGISVG--DNLKNEVFILS-SQRIMERVVDSL
A0A285T4L1      PSNKTST------------AGLDRYD---NYINK--VNVANEILQFR-SKRLMREVVQRL
G5GD56          NESGSGGGMSRSARNNGLNTLMQL-N---GISVG--DNLKNEMFILT-SERLMTRVVDSL
R5KD55          RNDKPTVLNQLLN------DYVDF-G---FFADN--TNVNNVIAAIK-SPDVMSEVVDRL
A0A174QNT3      D-NQNSQ--NDLS------AMLEL-S---GIPGG--SSVENEVYILR-SYQLLNDVVQRL
A0A4S2FGS1      D-SQNSQ--NDIS------AMLDL-N---GIPGG--SSVENEVYILR-SYQLLNDVVQRL
R9I0H0          D-SQNSQ--NDIS------AMWEV-S---GGLGG--SGVENEVYILR-SYQILNDVVQRL
K5BUT9          K-EKSA---SDMS------AMLEV-S---GGITG--TSVDNEIYILR-SHQLLREVVNRL
A0A174FPA3      K-EKSA---SDMS------AMLEV-S---GGITG--TSVDNEIYILR-SHQLLREVVNRL
R6S9Y6          K-EKSA---SDMS------AMLEV-S---GGITG--TSVDNEIYILR-SHQLLREVVNRL
A0A642LIH6      K-EKSA---SDMS------AMLEV-S---GGITG--TSVDNEIYILR-SHQLLREVVNRL
C9KX15          K-EKSA---SDMS------AMLEV-S---GGITG--TSVDNEIYILR-SHQLLREVVNRL
R6DAG6          G-GKNAN--SDIS------AMLEL-Q---GGITG--SGVENEMFILR-SHQLVREVVNRL
A0A3L8AAP1      G-GKTAN--SDIS------AMLEL-Q---GGITG--SGVENEMFILR-SHQLVREVVNRL
A0A4S2AYX2      G-GKNAN--SDIS------AMLEL-Q---GGITG--SGVENEMFILR-SHQLVREVVNRL
A0A4Y9H477      G-GKTAN--SDIS------AMLEL-Q---GGITG--SGVENEMFILR-SHQLVREVVNRL
A0A0E2M2Y7      A-EKSGA-PRSMK------QFEEI-G---LFMDN--SEVENEILVLK-SKRLTAIVVDKL
A0A0K2J6Z0      A-EKSGA-PRSMK------QFEEI-G---LFMDN--SEVENEILVLK-SKRLTAIVVDKL
B2RKZ8          A-EKSGA-PRSMK------QFEEI-G---LFMDN--SEVENEILVLK-SKRLTAIVVDKL
A0A212GC82      A-EKSGA-PRSMK------QFEEI-G---LFMDN--SEVENEILVLK-SKRLTAIVVDKL
A0A254MU12      A-EKSGA-PRSMK------QFEEI-G---LFMDN--SEVENEILVLK-SKRLTAIVVDKL
R6CQ93          Q--------SNKT------STAGL-DRYDNYINK--VNVANEILQFR-SKRLMREVVQRL
A0A3D1NQW3      S-RKGGD--TDLA------TLSDL-A---GLSQR--RNVDNEIYILQ-SRRLMTEVVKQL
B0MT10          S-RKGGD--TDLA------TLSDL-A---GLSQR--RNVDNEIYILQ-SRRLMTEVVKQL
R7JGW9          S-RKGGD--TDLA------TLSDL-A---GLSQR--RNVDNEIYILQ-SRRLMTEVVKQL
A0A414Q925      E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVETL
A0A415PUS9      E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVEIL
A0A108TCU0      E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVETL
A0A413BA42      E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVETL
S3Y344          E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVEIL
A0A4Q5G8Y8      E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVEIL
A0A412TGL3      E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVETL
A0A413VJ33      E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVEIL
A0A414L0W6      E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVETL
A0A412DP39      E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVETL
A0A413ZSE8      E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVEIL
B0NP84          E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVEIL
R6AK43          E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVEIL
A0A412N2D9      E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVETL
A0A1Y4JYS9      E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVETL
R6LHA4          E-QKGGG-VNGAA------AFQDL-----FSLGG--STVDNEVGIFK-SKRLMRTVVETL
A0A3D2BF46      G-KKGSE--TDIA------AFGDL-L---GATAR--RNVDNEIIVLK-SRNLMTEVVRRL
A0A4Y1WUN1      G-KKGSE--TDIA------AFGDL-L---GATAR--RNVDNEIIVLK-SRNLMTEVVRRL
A0A4Y1XL94      G-KKGSE--TDIA------AFGDL-L---GATAR--RNVDNEIIVLK-SRNLMTEVVRRL
A0A358R538      S-RKGGD--TDLA------AFSDL-A---GFQNR--RSVDNEVFILQ-SRRLMAEVVRRL
A0A1Y4AAB8      D-RKGAN--MDIS------AFSDI-S---GFQSR--NSVDNEIYILQ-SRRLMQEVVRTL
A0A1Y3WWY9      S-RKGGA--PELS------AFSDL-A---SFQTQ--RSVDNEIYILQ-SRRLMSEVVRRL
A0A1Y4U5L4      S-RKGGA--PELS------AFSDL-A---SFQTQ--RSVDNEIYILQ-SRRLMSEVVRRL
A0A1Y3VCJ1      S-RKGGD--VELS------AFSDL-S---GYQSR--KSIDNELFILQ-SRKLMTEVVRRL
A0A1Y3QTW7      S-RKGGD--MELG------AFSDL-V---GFQNR--RNVDNEVYILQ-SHRLMSEVVKRL
R6XWY7          S-RKGGD--MELG------AFSDL-V---GFQNR--RNVDNEVYILQ-SHRLMSEVVKRL
A0A4Y1X9Y9      S-RKGGD--MELG------VFSDL-V---GFQNR--RNVDNEVYILQ-SHRLMSEVVKRL
A0A4Y1WM66      S-RKGGD--MELG------AFSDL-V---GFQNR--RNVDNEVYILQ-SHRLMSEVVKRL
A0A174AVF1      S-RKGGD--MELG------AFSDL-V---GFQNR--RNVDNEVYILQ-SHRLMSEVVKRL
A0A656Q4F4      S-RKGGD--MELG------AFSDL-V---GFQNR--RNVDNEVYILQ-SHRLMSEVVKRL
A0A1Q6EIY0      S-RKGGD--TDLG------AFSDL-V---GFQNR--RNVDNEVYILQ-SHRLMSEVVKRL
A0A5B5VN71      S-RKGGD--TDLG------AFSDL-V---GFQNR--RNVDNEVYILQ-SHRLMSEVVKRL
E4M8L3          S-RKGGD--TDLG------AFSDL-V---GFQNR--RNVDNEVYILQ-SHRLMSEVVKRL
I3YQ50          S-RKGGD--TDLG------AFSDL-V---GFQNR--RNVDNEVYILQ-SHRLMSEVVKRL
R5UEY8          S-RKGGD--TDLG------AFSDL-V---GFQNR--RNVDNEVYILQ-SHRLMSEVVKRL
A0A1H4D866      S-RKGGD--LELT------AFSDL-A---GFQNR--RSVDNEVFILQ-SRRLMTEVVKRL
A0A5B3G4Y7      S-RKGGD--VDLT------AFSDL-A---GFQNR--RNVDNEVFILQ-SRRLMTNVVKQL
A0A374A9J5      S-RKGGD--VDLT------AFSDL-A---GFQNR--RNVDNEVFILQ-SRRLMTNVVKQL
A0A5B3GQN5      S-RKGGD--VDLT------AFSDL-A---GFQNR--RNVDNEVFILQ-SRRLMTNVVKQL
A0A1Q6E9S3      S-RKGGD--VDLT------AFSDL-A---GFQNR--RNVDNEVFILQ-SRRLMTNVVKQL
D4IJ36          S-RKGGD--VDLT------AFSDL-A---GFQNR--RNVDNEVFILQ-SRRLMTNVVKQL
A0A3E5HPT8      P-------ANSRS------AMQLNNA---DFIGQ--VNVASEILQFK-SKELMRKVIDRL
C6IJ48          P-------ANSRS------AMQLNNA---DFIGQ--VNVASEILQFK-SKELMRKVIDRL
Q8A3U2          P-------ANSRS------AMQLNNA---DFIGQ--VNVASEILQFK-SKELMRKVIDRL
A0A3R6S1H6      D-SKGTSLASEAA------AFEDL-N---VLNTK--SSVDNEVLVFQ-SRNLMIEVVRRL
A0A3R6SD81      D-SKGTSLASEAA------AFEDL-N---VLNTK--SSVDNEVLVFQ-SRNLMIEVVRRL
A0A354WXN6      D-KKGGG-FSEAN------AFGDL-G---ITMGS--RNVDNEVLVFK-ANRLMEMVVKRL
R5IP14          N-KSGG--FSESA------MFKDL-GSMDMINVR--SSAETEMLIFQ-SYRLMQDVVSQL
A0A316SZX7      D-RRGGA-ITESA------AFQEL-G---AFNIK--SNVDNEILLFE-SKRLMEEVVRLL
A0A1Y4AIY1      D-RRSSR-SMSAY------GFSDLNN---MLGIQ--RNVDNEVIVFK-TYRLMEKVARRL
F3ZRU7          DKASGGANMQGVA------ALTDL-A---DFGLK--SSVDNEILIFQ-SNSLLREVSTRL
A0A0J6CIR2      N-SKG-GGLSESA------AFEEL-N---MFNVK--SNVDNEVLVFK-SKRLMSVVAERL
A0A3D8HG59      D-TKGSGAMSEAS------AFSDL-G---MFSMK--SSVDNEVLVFQ-SRQLMQNVVKRL
A0A3R6S408      D-TKGSGAMSEAS------AFSDL-G---MFSMK--SSVDNEVLVFQ-SRQLMQNVVKRL
A0A1C5Q1F3      E-TRGAQLPNAAS------AFSEM-D---LLNIQ--STVDNEVLIFK-SKRLMIEVARKL
R7A239          E-TRGAQLPNAAS------AFSEM-D---LLNIQ--STVDNEVLIFK-SKRLMIEVARKL
A0A3R6HIK7      E-QRKSR-AATTY------GFTDL-D---MFGLQ--RNVDNEVIVFK-AYRLMEMVARRL
K5ZVW7          E-QRKSR-AATTY------GFTDL-D---MFGLQ--RNVDNEVIVFK-AYRLMEMVARRL
A0A1Y4D5Z0      E-NRWGR-SRSLY------GFSDL-D---MLSLQ--RNVDNEVIVFK-TYRLMETVARRL
A0A413VXJ7      D-SKGGG-ISESS------AFADL-G---LFGGK--RNVDNEVLIFQ-SRHLMEEVARRL
I9RSN9          D-SKGGG-ISESS------AFADL-G---LFGGK--RNVDNEVLIFQ-SRHLMEEVARRL
U6RJK5          D-SKGGG-ISESS------AFADL-G---LFGGK--RNVDNEVLIFQ-SRHLMEEVARRL
A0A1Q6GA32      D-SKGGG-ISESS------AFADL-G---LFGGK--RNVDNEVLIFQ-SRHLMEEVARRL
I9RPU6          D-SKGGG-MSESA------AFSDL-S---LFGGK--RNVDNEVLVFQ-SRHLMEEVARRL
I8YFS5          D-SKGGS-ISEST------AFADI-S---FLGGK--RNVDNEVLVFQ-SRHLMEKVARRL
A0A4Q5F7I7      D-SKGGS-ISEST------AFADI-S---FLGGK--RNVDNEVLVFQ-SRHLMEKVARRL
I8Y597          D-SKGGS-ISEST------AFADI-S---FLGGK--RNVDNEVLVFQ-SRHLMEKVARRL
A0A1Q6GBF5      D-SKGGA-VSESS------AFADL-S---LFGGK--RNVDNEVLVFQ-SRHLIEEVARRL
I8YFZ3          D-SKGGG-MSESA------AFSDL-S---LFGGK--RNVDNEVLVFQ-SRHLMEEVAHRL
A0A4V1YNX8      D-SKGGA-MSESA------AFADL-S---LFGGK--RNVDNEVLVFQ-SRHLMEEVARRL
A0A1Q6GDH2      D-SKGGG-MSESA------AFSDL-S---LFGGK--RNVDNEVLVFQ-SRHLMEEVARRL
U6RSB0          D-SKGGG-MSESA------AFSDL-S---LFGGK--RNVDNEVLVFQ-SRHLMEEVARRL
I9GXM2          D-SKGGG-MSESA------AFSDL-S---LFGGK--RNVDNEVLVFQ-SRHLMEEVARRL
I9SIK1          D-SKGGG-MSESA------AFSDL-S---LLGGK--RNVDNEVLVFQ-SRHLMEEVARRL
A0A4Q5FNG1      D-SKGGG-MSESA------AFSDL-S---LLGGK--RNVDNEVLVFQ-SRHLMEEVARRL
I9TP59          D-SKGGG-MSESA------AFSDL-S---LLGGK--RNVDNEVLVFQ-SRHLMEEVARRL
R5S343          S-NKGGA-AGEGR------VFEEL-N---LFNVK--SNVDNEVQVFK-STRLMSSVVRKL
A0A1M6K7I9      D-KKGGG-MGESA------LFADL-N---LFGGA--RSVDNELLVFQ-SRSIMENVVRRL
A0A5M6A8C8      D-KKGGG-MGESA------LFADL-N---LFGGA--RSVDNELLVFQ-SRSIMENVVRRL
A0A4V1YPN7      D-SKGGS-ISESS------AFADI-S---LFGGK--RNVDNEVLVFQ-SRYLMEKVARRL
A0A4Q5F874      D-SKGGN-MSESS------AFADI-S---FFGGK--RNVDNEVLVFQ-SRNLMEKVARRL
A0A641LV22      D-SKGGN-MSESS------AFADI-S---FFGGK--RNVDNEVLVFQ-SRNLMEKVARRL
A0A3R5ZMK1      D-AKGGA-MSESA------AFEDL-G---LFGTK--RNVDNEVLVFK-SRRLMTEVARNL
A0A3E4ZTK7      D-AKGGA-LSESA------AFEDL-G---IFGTK--RNVDNEVLVFK-SRRLMTEVARNL
A0A1Y3ZIA4      D-AKGGA-MSESA------AFEDL-G---LFGTK--RNVDNEVLVFK-SRRLMTEVARNL
K5Y1A4          D-AKGGA-MSESA------AFEDL-G---LFGTK--RNVDNEVLVFK-SRRLMTEVARNL
A0A4Q5CIT0      D-AKGGA-MSESA------AFEDL-G---LFGSK--RNVDNEVLVFK-SRRLMTEVARNL
A0A3R6K8X4      D-AKGGA-MSESA------AFEDL-G---LFGTK--RNVDNEVLVFK-SRRLMTEVARNL
A0A414GI87      D-AKGGA-MSESA------AFEDL-G---LFGSK--RNVDNEVLVFK-SRRLMTEVARNL
A0A415BDM7      D-AKGGA-MSESA------AFEDL-G---LFGSK--RNVDNEVLVFK-SRRLMTEVARNL
A0A412DM15      D-AKGGA-MSESA------AFEDL-G---LFGSK--RNVDNEVLVFK-SRRLMTEVARNL
A7AEU7          D-AKGGA-MSESA------AFEDL-G---LFGSK--RNVDNEVLVFK-SRRLMTEVARNL
A0A1Q6I3T6      D-AKGGA-MSESA------AFEDL-G---LFGSK--RNVDNEVLVFK-SRRLMTEVARNL
A0A414XX40      D-AKGGA-MSESA------AFEDL-G---LFGSK--RNVDNEVLVFK-SRRLMTEVARNL
A0A3R6BKI7      D-AKGGA-MSESA------AFEDL-G---LFGTK--RNVDNEVLVFK-SRRLMTEVARNL
A0A414LPI6      D-AKGGA-MSESA------AFEDL-G---LFGTK--RNVDNEVLVFK-SRRLMTEVARNL
A0A412M2W1      D-AKGGA-MSESA------AFEDL-G---LFGTK--RNVDNEVLVFK-SRRLMTEVARNL
K5ZX55          D-AKGGA-MSESA------AFEDL-G---LFGTK--RNVDNEVLVFK-SRRLMTEVARNL
A0A5F0U645      D-TKGGGAASEAA------VFEDL-N---MFNMK--RSVDNELLVFK-SKQLMKSVVKRL
K5ZBN2          D-TKGGGAASEAA------VFEDL-N---MFNMK--RSVDNELLVFK-SKQLMKSVVKRL
A0A0J6CKW3      D-TKGGGAASEAA------VFEDL-N---MFNMK--RSVDNELLVFK-SKQLMKSVVKRL
A0A0F5IQM7      D-TKGGGAASEAA------VFEDL-N---MFNMK--RSVDNELLVFK-SKQLMKSVVKRL
A0A496CDT3      D-TKGGGAASEAA------VFEDL-N---MFNMK--RSVDNELLVFK-SKQLMKSVVKRL
S0GLB0          D-TKGGGAASEAA------VFEDL-N---MFNMK--RSVDNELLVFK-SKQLMKSVVKRL
A0A3R6NLC1      D-TKGGGAASEAA------VFEDL-N---MFNMK--RSVDNELLVFK-SKQLMKSVVKRL
A0A416WYC9      D-TKGGGAASEAA------VFEDL-N---MFNMK--RSVDNELLVFK-SKQLMKSVVKRL
A0A0F5IT40      N-SKGGG-LSESA------AFEEL-N---MFNVK--SNVDNEVLVFK-SKRLMSVVAERL
A0A496CX20      N-SKGGG-LSESA------AFEEL-N---MFNVK--SNVDNEVLVFK-SKRLMSVVAERL
A0A5F0UBI0      N-SKGGG-LSESA------AFEEL-N---MFNVK--SNVDNEVLVFK-SKRLMSVVAERL
S0GSI7          N-SKGGG-LSESA------AFEEL-N---MFNVK--SNVDNEVLVFK-SKRLMSVVAERL
K5YB65          N-SKGGG-LSESA------AFEEL-N---MFNVK--SNVDNEVLVFK-SKRLMSVVAERL
A0A0F5IWP9      N-TKGGG-LSESA------AFEEL-N---MFNVK--SNVDNEVLVFK-SKRLMSIVAERL
A0A0F5IZT8      N-TKGGG-LSESA------AFEEL-N---MFNVK--SNVDNEVLVFK-SKRLMSIVAERL
A0A417LKQ2      N-AKGGG-LSESA------AFEEL-N---MFNVK--SNVDNEVLVFK-SKRLMNIVAERL
A0A416TME1      N-TKGGG-LSESA------AFEEL-N---MFNVK--SNVDNEVLVFK-SKRLMNIVSERL
A0A416XPE8      N-TKGGG-LSESA------AFEEL-N---MFNVK--SNVDNEVLVFK-SKRLMNIVSERL
A0A5C8KAD6      E-KKGVNDSK---------MTESI-D---AFITS--KIVENEINVIH-SRTLMKQVVNKL
A0A5N1J695      E-KKGINDPR---------MMEAI-D---AFASS--KLVDNEIKVIQ-SRGLMNKVVDTL
A0A1H4ADG3      N-TGQNNSPQSNG----ISSLQSL-G---LFPGA--SNVDNERDILV-SYPLIHQVVSDL
A0A5B8VUR8      N-DGKSPAPQNNG----IGSLESL-G---LYPRS--STVDNEREILV-SYPLIHQVVTDL
A0A2A4G4B1      V-TNSI----PDE----LSVFDDLGM---VSGSA--STLEDEIQLFR-SRPLIKQMVEKH
A0A3N2M1H3      Q-EGGSGVP--DM----AGVFSSF-G---LVSSN--TSVYNELISLK-SPAVMYEVARRL
A0A4S2G8T2      Q-EGGSGVP--DM----AGVFSSF-G---LVSSN--TSVYNELISLK-SPAVMYEVARRL
A0A212K7W5      N-SAKGGML-SDN----INTFSDM-G---LFKSN--TNINNEILTFK-SPLLMQEVVQRM
F5IU11          N-SAKGGML-SDN----INTFSDM-G---LFKSN--TNINNEILTFK-SPLLMREVVQRM
A0A3N2N6F7      D-EAGSSSQ--SI----TSALSDM-G---LFTTS--TNVANELLAFQ-SPALIGDVIERL
A0A4P7VVU7      D--TESGSQ--GV----ASALSDI-G---LFQSS--ANVNNEMLAFQ-SPAIIADVIQRL
A0A2V1ILM4      D--TESGSQ--GV----ASALSDI-G---LFQSS--ANVNNEMLAFQ-SPAIIADVIQRL
A0A3N2L0E8      D--TESGSQ--GV----ASALSDI-G---LFQSS--ANVNNEMLAFQ-SPAIIADVIQRL
A0A3N2LFC5      D--TESGSQ--GV----ASALSDI-G---LFQSS--ANVNNEMLAFQ-SPAIIADVIQRL
A0A553LCN8      G-GKTANSDISAM----LELQGGV--------TG--SGVENEMYILR-SHQLVREVVNRL
K0XJ09          E-NKSGN-DMSAV----LELNGGI--------SG--SGVENEIYILQ-SHQLMREVVGRL
R5EUZ0          E-NKSGN-DMSAV----LELNGGI--------SG--SGVENEIYILQ-SHQLMREVVGRL
W0EQS0          E-NKSSN-DMSAI----LEMNGGV--------SV--GSVDNEIYILQ-SHQLMREVVERL
A0A1Y3WE15      E-NKSNN-DMSAI----MELNGGI--------SG--SGVDNEIYILQ-SRQLMREVVERL
A0A1Y4GUK3      E-NKSNN-DMSAL----LELNGGI--------SG--SGVENEIYILQ-SRQLMREVVERL
A0A352Z1R7      E-RGQGVLV-------------DM-----TFDQS--NSIDAELEIIK-SRTNIEQVAKRL
A0A0A2F501      D-SKGKGLS-LND----QFSFGDM-G---LLQSN--TNVNNELISIQ-SPTLTLEVVRRL
R5B7P0          N-TKGASMP-GDI-----GEFGNM-G---LFAVK--SNVNNELHAFE-SPDIMSEVVARL
R5B0L5          S-SQGASIS---------DTFAEM-G---LVQTN--SNVNDEISKLQ-SPDIMLEVAKRL
A0A374THP7      D-SKSQGIS-SDV----SSMFADM-G---LGNAK--SNVNNELIAIQ-SPAVLLETGKRL
A0A3R5XWG1      E-SKGSSIN-NDV----ESMFSDM-G---LGGTK--SNVNNELIAIK-SPSVLLEVGKQL
A0A5P0Y910      E-SKGSSIN-NDV----ESMFSDM-G---LGGTK--SNVNNELIAIK-SPSVLLEVGKQL
A0A5P0XQC0      E-SKGSSIN-NDV----ESMFSDM-G---LGGTK--SNVNNELIAIK-SPSVLLEVGKQL
A0A414YFM3      E-SKGSSIN-NDV----ESMFSDM-G---LGGTK--SNVNNELIAIK-SPSVLLEVGKQL
A0A5P0VXP6      E-SKGSSIN-NDV----ESMFSDM-G---LGGTK--SNVNNELIAIK-SPSVLLEVGKQL
A0A5P0W892      E-SKGSSIN-NDV----ESMFSDM-G---LGGTK--SNVNNELIAIK-SPSVLLEVGKQL
A0A0A2EVS5      S-DKPGASL-AQD----IGGFADM-G---LFSKS--TNVHNELVSLR-SPATLLEVIKRL
A0A1T4NAJ7      S-DKPGASL-AQD----IGGFADM-G---LFSKS--TNVHNELVSLR-SPATLLEVIKRL
A0A255T941      D-AKGKSSN-LI------SDFADMGG---LFKSN--TNIKNELSTIK-SPNLMTEVVKRL
A0A3N2KCL3      E-AAGKSAG-A-------EDFGDF-G---LFQNK--TNIQNEITTLK-SADLMEEVVRRL
A0A4P7VSV0      E-AAGKSAG-A-------EDFGDF-G---LFQNK--TNIQNEITTLK-SADLMEEVVRRL
A0A2V1IJY1      E-AAGKSAG-A-------EDFGDF-G---LFQNK--TNIQNEITTLK-SADLMEEVVRRL
A0A4P7VXK7      E-AAGKSAG-A-------EDFGDF-G---LFQNK--TNIQNEITTLK-SADLMEEVVRRL
A0A1Y4CHN5      E-GKGQSIS-SDV----SSAFASM-G---LVQSN--TNVNNEVIALQ-SPAIMTDVVKRL
A0A1M6I2S6      D-TKSGSST-TM------SEFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVRRL
A0A1Y3V692      D-TKSGSST-TM------SEFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVRRL
F3PXM2          D-SKGGATS-GSM-----GEFADF-G---LFKSN--TNINNELLTLA-SPTLMTEVVKRL
A0A3E4ZNL4      D-SKNGSST-SAM-----NEFADM-G---LFKSN--TNINNELLTMK-SPTLMTEVVRRL
A0A174AHH7      D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A174JCE8      D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A3E4JMC4      D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A412SND6      D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A414IEQ9      D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A415UKN5      D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A0M1W8D8      D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A3R6GKX5      D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A7V4S1          D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
B0NU19          D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
D4V601          D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A4Q0U3M9      D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A4R4H1Q2      D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A397WLT5      D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A3R6GM96      D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A015XH67      D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A078RZN2      D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A4R4I3T9      D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A6L0K5          D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A7ACT5          D-SKNNSPA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A6KY94          D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A173UQR8      D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A3R6HK75      D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A412B7D1      D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A412VNY9      D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A414LTU9      D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
I9Q4U4          D-SKNNSSA-SAM-----NEFADM-G---IFKSN--TNINNELLTLK-SPTLMTEVVKRL
A0A373ISF0      D-SNSGSSG-GAM-----SEFSDM-G---IFRSN--TNINNELFTLK-SPALMTEVVRRL
U6RF62          D-SKSGSSG-GAM-----SEFSDM-G---IFRSN--TNINNELFTLK-SPALMTEVVRRL
A0A662ZZD5      D-SKGGTST-NVV-----SEFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVQRL
A0A395YYT3      D-SKGGTST-NVV-----SEFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVQRL
A0A642JYJ3      D-SKGGTST-NVV-----SEFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVQRL
A0A015UXN7      D-SKGGTST-NVV-----SEFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVQRL
A0A5M5W148      D-SKGGTST-NVV-----SEFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVQRL
A0A3A5TI83      D-SKGGTST-NVV-----SEFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVQRL
A0A415NEB6      D-SKGGTST-NAV-----SEFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVQRL
A7AJ60          D-SKGGTST-NVV-----SEFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVQRL
A0A016E4F9      D-SKSGSST-NAM-----SEFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVQRL
A0A4Q5CFJ7      D-SKSGSST-NAM-----SEFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVQRL
A0A108TH71      N-SKSSSST-SAM-----NDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVNRL
I8VXH0          N-SKSSSST-SAM-----NDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVNRL
A0A412S0N6      N-SKSSSST-SAM-----NDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVNRL
A0A412IIJ0      N-SKSSSST-SAM-----NDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVNRL
A0A0P0FM97      N-SKSSSST-SAM-----NDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVNRL
R6KTP3          N-SKSSSST-SAM-----NDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVNRL
A0A139LU87      N-SKSSSST-SAM-----NDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVNRL
A0A1C6B3Y5      N-SKSSSST-SAM-----NDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVNRL
E2NMQ4          N-SKSSSST-SAM-----NDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVNRL
A0A412YDB9      N-SKSSSST-SSM-----SDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVSRL
R7DY01          N-SKSSSST-SSM-----SDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVSRL
A0A414LGK8      N-SKSNSST-SSM-----SDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVSRL
A0A415IPQ4      N-SKSSSST-SAM-----SDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVNRL
A0A3E5BRW7      N-SKSSSST-SAM-----SDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVNRL
K9DXS6          N-SKSSSST-SAM-----SDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVNRL
A0A1M6KFV3      N-SKSNSST-NAM-----SDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVSRL
A0A1Q6G7L3      N-SKSNSST-NAM-----SDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVSRL
A0A413H235      N-SKSNSST-NAM-----SDFSDL-G---IFKSN--TNINNELLTLK-SPTLMTEVVSRL
A0A1M5B2J8      D-SKGKSAS-TDM-----ESFADF-G---IFTTN--TNVNNEMGTLQ-SPDLMREVVTRL
A0A255RCT5      D-SKGKSAS-TDM-----ESFVDF-G---IFTTN--TNVNNEMGTLQ-SPDLMREVVRRL
A0A1Y4GLF5      D-SKGNSIS-SGM-----ETFSEF-G---LFQSS--TNVNNELLAFQ-SPAVMTEVVKRL
A0A1H3XSC0      D-SKGKSVS-SDL-----ESFSEF-G---LFQSS--TNVNNELVALQ-SPAVMTEVVRRL
A6LE40          D-SKGKSVS-SDL-----ESFSEF-G---LFQSG--TNVNNELITFQ-SPALMTEVVKRL
A0A4Y1VPX5      D-SKGKSVS-SDL-----ESFSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
B3JI46          D-SKGKSVS-SDL-----ESFSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
R6NN15          E-SKGQSLS-GDV----GASFSDL-G---LFQPN--TNVNNELVSLQ-SPAVMYDVVKRL
A0A358R8U0      N-TKGQSLA-SDV-----ESFGDL-G---LFQTT--TNVNNELLVLQ-SPSIMLEVVKRL
R6WSB6          N-TKGQSLA-SDV-----ESFGDL-G---LFQTT--TNVNNELLVLQ-SPSIMLEVVKRL
A0A4Q5ENK6      D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLQ-SPDIMREVVSRL
A0A401LPX7      D-SKGKSSS-ADM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
A0A3A5Z900      D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
A0A3R6EGW5      D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
A0A285TGL6      D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
A0A3A5RFX4      D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
A0A1Q6IUW9      D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
A0A3R6NPG7      D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
A0A413XDP6      D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
K6AP24          D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
A0A662ZYI7      D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
A0A078RYI7      D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
C7XEQ8          D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
D7INX6          D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
K5ZG55          D-SKGKSSS-TDM-----ESFSDL-G---LFTTN--TNVYNEMGTLK-SPDIMREVVSRL
A0A3N2N9B8      T-SKGKS---AGM----EE-FSDF-G---LISTK--TDVENEIINLR-SGELMEEVVSRL
A0A3N2NMI0      P-SKGKS---AGM----EE-FADL-G---LISSS--TSVANEITNLR-SGDLMEEVVRRL
A0A359I8H7      Q-DGGGGVA--DI----SNAFSSL-G---LVSSN--TNVNNELISLS-SPAVMYEVVKNL
A0A3N2KA63      Q-DGGGGVA--DI----SNAFSSL-G---LVSSN--TNVNNELISLS-SPAVMYEVVKNL
A0A4Q0IMT7      Q-DGGGGVA--DI----SNAFSSL-G---LVSSN--TNVNNELISLS-SPAVMYEVVKNL
A0A3B9FAU3      D-SPQRG---KDL----NAMFANL-G---QNPDQ--SNVNNEMAAIQ-APSNVLETVKRL
A0A3C1E5L7      D-SPQRG---KDL----NAMFANL-G---QNPDQ--SNVNNEMAAIQ-APSNVLETVKRL
A0A4Q0UAV1      E-ESGNGTL--AM----PD-LSAL-G---ISNNS--GDLANEMIVIR-SVDLLTDVVATL
A0A354SN68      D-NRRSASI-GNT----SGIFNNL-G---IGKSY--MNTNDEVAIIN-SQTIALEVVQSL
A0A3N2N595      N-AKSNTPSMSVG----GDEFANM-G---LFQNK--TNIQNEMTTFM-SSDLMTEVVKRL
A0A0A2DUD9      D-DKGKSLS-NDM----SSAFSEL-G---LFQSN--TNVNNELLSMK-SPMLMEEVVRRL
A0A3P1ZBJ5      N-TKGGGRS---V----EQQLSQL-G---LFE-N--TSVSNEILSFQ-SPALMEDVVKRL
R5FHS9          S-DDSRSVSIDDI----FSSASSG-G---ISTNS--NYVNNELIALQ-SPSIMLEVVKRL
A0A413TW79      D-GKSQSIN-SDV----ASMFSDM-G---LSGGK--SNVNNELIAIQ-SPAVLLEAGKQL
A0A3E5E9M7      D-GKSQSIN-SDV----TSMFSDM-G---LSGGK--SNVNNELIAIQ-SPAVLLEAGKQL
A0A3E4SK73      D-GKSQSIN-SDV----ASMFSDM-G---LSGGK--SNVNNELIAIQ-SPAVLLEAGKQL
A0A415GGC6      D-GKSQSIN-SDV----ASMFSDM-G---LSGGK--SNVNNELIAIQ-SPAVLLEAGKQL
A0A413DBH9      D-GKSQSIN-SDV----TSMFSDM-G---LSGGK--SNVNNELIAIQ-SPAVLLEAGKQL
A0A495WI87      D-SKGKSLS-ADA----GS-FADL-G---LIQAN--TNVNNEIISLQ-SPAIMTDVVKRL
A0A354M4S6      D-SKGKSLS-ADA----GS-FADL-G---LIQAN--TNVNNEIISLQ-SPAIMTDVVKRL
R7DH52          D-SKGKSLS-ADA----GS-FADL-G---LIQAN--TNVNNEIISLQ-SPAIMTDVVKRL
A0A4Q5E7L5      D-AKGKSVS-SDM----DA-FSDL-G---LFQSG--TNVNNELIAFQ-SPALITEIVKRL
A0A4P8LP09      D-SKGKSVS-SDL----ES-FSEF-G---LFQSN--TNVNNELIAFQ-SPALMTEVVKRL
A0A4R4GZU7      D-SKGKSVS-SDL----ES-FSEF-G---LFQSN--TNVNNELIAFQ-SPALMTEVVKRL
A0A016CWA4      D-SKGKSVS-SDL----ES-FSEF-G---LFQSN--TNVNNELIAFQ-SPALMTEVVKRL
A0A1C6H117      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A415TAH7      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A0M1W0V2      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A139KA16      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A174VQ92      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A1Q6HCG0      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A1Y4JYM9      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A3A5QW67      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A3A5RQE6      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A3A6BP07      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A3E5E153      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A3Q9IP20      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A412WV15      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A413ICP6      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A414KYB9      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A5B3FWR2      D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
E5WX00          D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
K0X3P3          D-SKGKSVS-PDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRF
A0A3A5Z014      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPSLMTEVVKRL
A0A1M4YZ07      D-SKGKSVS-SDL----KS-FSEF-G---LFQSG--TNVNNELITFQ-SPSLMTEVVKRL
A0A078S3Q8      D-SKGKSFS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPSLMTEVVKRL
A0A069SJV7      D-SKGKSFS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPSLMTEVVKRL
A0A3E5DXI5      D-SKGKSFS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPSLMTEVVKRL
A0A3E5EM98      D-SKGKSFS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPSLMTEVVKRL
A0A3E5F453      D-SKGKSFS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPSLMTEVVKRL
I9T3G6          D-SKGKSFS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPSLMTEVVKRL
A0A4Q5E5M7      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPALMTEVVKRL
A0A0P0FQW1      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPALMTEVVKRL
A0A5M5C0W6      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPALMTEVVKRL
A0A642LZ22      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPALMTEVVKRL
A0A5M5YM86      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPALMTEVVKRL
A0A642LE65      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPALMTEVVKRL
A0A5M5Y0P8      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPALMTEVVKRL
A0A642NJ89      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPALMTEVVKRL
C3RFN5          D-SKGKSVS-SDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRL
A0A3E4SYU0      D-SKGKSVS-SDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRL
A6LGY1          D-SKGKSVS-SDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRL
K5ZSH4          D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPALMTEVVKRL
A0A078T2W6      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFQ-SPALMTEVVKRL
A0A3R6EAF7      D-SKGKSVS-SDL----ES-FSEF-G---LFQSS--TNVNNELITFQ-SPALMTEVVKRL
A0A5C6L2P1      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A412MJT7      D-SKDKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A3E4WKT5      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A3A5YY33      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A078TAH2      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A1E9CFZ7      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A373FYU5      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A3A5TZ72      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A3A5XBP2      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A3A6MEG9      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A3E4JP35      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A3E4KP40      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A3E4NX82      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A3E4XFU8      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A412RG70      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A412TD37      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A413GAA4      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A414M7I4      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A496BTA0      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A496D2V6      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A4Q5EN83      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A4Q5G1P5      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A5C6KCA6      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A5M5AHM5      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A641WNS6      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
E5UZA2          D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A069SMG6      D-SKGKSVS-SDL----ES-FSEF-G---LFQSG--TNVNNELITFR-SPSLMTEVVKRL
A0A1Y4PQK7      E-YRGRSIA-SDI----EG-FDNF-G---LFRSA--TNVNNELIALQ-SPSVMTEVVKRL
A0A1Y4IH41      E-YRGRSIS-SDI----EG-FDNF-G---LFRSA--TNVNNELVALQ-SPAVMTEVVKRL
A0A3A6AAP4      E-YRGRSIS-SDI----EG-FDNF-G---LFRSA--TNVNNELVALQ-SPSVMTEVVKRL
A0A1Y4DYA7      D-NKSNSPS-GN-----AGVLYDL-D---LFQTG--TNVNNEIQSLQ-SPAVMYDVVKRL
A0A1Y3X4I9      D-SKGNSLS-NS-----AGVLGDL-D---LFQTN--TNVNNEMQSLQ-SPAVMYDVVKRL
A0A1Y4FNK8      D-SKGNSMS-DA-----AGVLGDM-N---LFQTS--TNVNNEIQSLQ-SPSVMLDVVKRL
A0A355FD59      D-SKGKSMA-GDV----SSLFSDL-G---LSQAN--VNVNNELIAIQ-SPAVILETIKRL
A0A359CEZ9      D-SKGKSMA-GDV----SSLFSDL-G---LSQAN--VNVNNELIAIQ-SPAVILETIKRL
A0A353Q7B4      D-SKGKSMA-GDV----SSLFSDL-G---LSQAN--VNVNNELIAIQ-SPAVILETIKRL
F8X3A5          D-SKSQSIS-SDV----ASMFADF-G---LSQPN--TNVNNELIAIQ-SPAIILETVKRL
A0A1M3KVR9      D-SKSQSIS-SDV----ASMFADF-G---LSQPN--TNVNNELIAIQ-SPSIILETVKRL
A0A4Y9IJS3      D-SKSQSIS-SDV----ASMFADF-G---LSQPN--TNVNNELIAIQ-SPSIILETVKRL
A0A4Q5WS95      E-KKGAEES---------SLSESM-N---VLSSK--KIVENEVVVLQ-SRNLADKIVAGL
A0A501VZX6      E-NKGVNDA---------KMTESI-D---AFTSN--KIVENEIKVLY-SRTLLKEVVEDL
A0A399SH26      E-KKGVDDA---------RMTESI-N---AFASK--KIVENEIEVIQ-SRALMKKVALGL
A0A501W1A9      E-KKGVNAS---------KIEESI-D---AFNAN--KTVENELNVLR-SYALMSQVVREL
A0A0E3ZGV6      E-EKGVNAS---------KITESI-D---AFSSN--KIVENELNVLR-SNALMNQVVNEL
A0A1I2N4S1      E-EKGVNAS---------KIMESI-D---AFSTN--KTVENELNVLR-SSALMSQVVHKL
A0A2T5YE44      E-EKGMNAS---------KIMESI-D---AFNTN--KTVENELNVLR-SSALMSQVVHKL
A0A1V9FHD0      E-KKGVDES---------GMGEAL-Q---IFPTK--NIVENEMEVIH-SRKLITDVINQL
A0A4V4H170      E-KKGVDES---------GVLEAL-Q---IYPTK--NIVENEMEVIH-SRKLMEKVVEQL
A0A1V9F098      E-KKGVDES---------GVLEAL-Q---IYPTK--NIVENEMEVIH-SRKLMEKVVEQL
A0A4R2VU64      E-KKGVDES---------GVLEAL-Q---IYPTK--NIVENEIEVIH-SRKLMEKVIEGL
A0A4S8HY23      E-KKGVDES---------GVQEAL-Q---IYPIK--NIVENEMEVIH-SRKLMEKVVEQL
A0A1V9F383      E-KKGVDES---------GSMEAL-Q---IYPTK--NIAENEIEVIH-SRKLMEQVIVQL
G8TRZ6          N-KKGVDES---------GAMEAL-Q---VYPMQ--NIAENEIEVLQ-SKTLMTDVVNQL
A0A543WA52      E-KKGVDDA---------RMMESI-N---AFDSK--KIVENEIEVIR-SRGLVNKVVNDL
A0A1M5BA90      E-KKGADES---------KILEAL-N---I-TSN--KTVDNEVEVIQ-SGELLNEVIDSL
A0A512B879      E-KKGADES---------KILDAL-N---IYSSN--KIVENEIEVIQ-SKELLKKVVNSL
A0A559PPI3      E-NKGVDNS---------KMVESM-S---PFDSK--KIVENEIKVIQ-SPDIMKKVVDTL
A0A1T5CS78      E-EKGVDNS---------RIMESI-N---PFDSK--KIVENEIEVLK-SRDLMKSVVRDL
A0A0Q9Z8F1      E-EKGVDDS---------KIMESI-N---PFDSK--KIVENEIEVLK-SRDLMKAVVRDL
A0A2N0U0M7      E-EKGVDDS---------KIMESI-N---PFDSK--KIVENEIEVLK-SRDLMKSVVRDL
                                                                            

A0A1T5MMH4      --NIDVT---------------------YYSKG-----EV------------------LN
A0A2W4R1L8      --KIDVS---------------------YYNKG-----EI------------------LN
A0A2E5CV79      WDSNRRN---------------------SLA---------------------------LF
A0A2D4ZVH1      ----------------------------------------------------------NE
A0A0K8QSK7      --GFEVS---------------------VYSVG-----QI------------------LD
A0A1V6CN82      --GFEVS---------------------YHNEG-----KL------------------ST
A0A1M4XZ45      --DFEVS---------------------YYALG-----RV------------------AI
A0A399D319      --DFEVS---------------------YYAVG-----RV------------------AV
A0A1M6GR99      --NLEVS---------------------YYEYK-----NY------------------QY
A0A1M6TTV4      --GMDVS---------------------YFRPG-----RS-----------------HLS
A0A4Q8RX32      --NFSVM---------------------YYEEK-----LL------------------YN
K0X1U5          --DLNIS---------------------YTSKK-----NF------------------FK
R5EXK3          --DLNIS---------------------YTSKK-----NF------------------FK
A0A401UAP7      --KLDVS---------------------YYSVG-----EF------------------LD
A0A1W2GF52      --GMGIS---------------------YYHPG-----RS-----------------HLV
A0A2G5L7B8      --GMNVS---------------------YFHPG-----RS-----------------HLY
A0A523GAC0      --DLDIS---------------------YYAVG-----NI------------------LE
L8JW09          --DLDLS---------------------YYTAG-----QV------------------LN
A0A5C7MX19      --PLEMS---------------------YFKEG-----KT------------------KF
A0A364XUP5      --NLSVS---------------------YFNKG-----EL------------------LN
A0A1M5RLA9      --DLNVS---------------------YFSVG-----RV------------------LN
A0A385SFR9      --DLNVS---------------------YFSVG-----RV------------------LN
A0A5M4A9J4      --NAEVS---------------------YYEVD-----MG------------------LE
A0A5M4B1C7      --HDEVS---------------------YYVVN-----WG------------------HT
A0A0D3LFR6      --DLDVS---------------------YFTQG-----KI------------------LD
M7N6D4          --DLDVS---------------------YFEKG-----KI------------------LD
A0A1Q3ZMZ7      --DLAVG---------------------FFNKG-----SI------------------LT
A0A2D8JJW3      SEPVNSL---------------------FLTPD-----YK--------------------
A0A2W2AFF7      --QLNVN---------------------YFSSG-----RV------------------KK
A0A2N5YXE2      --PLDVS---------------------YYRQG-----TF------------------LY
A0A2W1NDY9      --NLKIS---------------------YFSEG-----EV------------------LI
A0A5C8AQR5      --NMNVS---------------------LFSKG-----KI------------------LT
A0A1G0CI31      --HMNVS---------------------LFSKG-----RI------------------LT
A0A556N0M0      --NMNVS---------------------IFAEG-----KI------------------LT
F2IKD6          --NMNVS---------------------VFSKG-----KI------------------LT
A0A1I7BM74      --NLEVS---------------------HFAKG-----EF------------------LT
A0A2G2FJ17      --DLQVS---------------------LFAEG-----DV------------------LT
A0A077ENE7      --HADKS---------------------YKVHK-----GL------------------RD
T0NN57          --GSDIS---------------------YKVRY-----GL------------------RE
X5K347          --GSDIS---------------------YKVRY-----GL------------------RE
A0A2I0QZ80      --PLQIS---------------------LYAKG-----EF------------------LT
A0A3E1F1A3      --PLTVS---------------------HYAKG-----EF------------------LT
A0A2U2XBJ3      --PLTVS---------------------LYAKG-----EF------------------LT
A0A4Q4KU94      --PLNVS---------------------LYARG-----EF------------------LT
A0A2U1FKU2      --NLDLT---------------------LSKDG-----FW------------------RK
A0A0A2F954      --DLDVS---------------------ISKQG-----FW------------------RN
A0A0A2FW91      --DLDVS---------------------ISKQG-----FW------------------RN
A0A2D2N2N1      --DLDVS---------------------IYKQG-----FW------------------RN
Q7MWZ2          --DLDVS---------------------IYKQG-----FW------------------RN
T2NDT6          --DLDVS---------------------IYKQG-----FW------------------RN
W1R7P9          --DLDVS---------------------IYKQG-----FW------------------RN
A0A1R4AFZ0      --DLDVS---------------------IYKQG-----FW------------------RN
A0A1R4DVZ7      --DLDVS---------------------IYKQG-----FW------------------RN
A0A5M4B212      --NFEVS---------------------YLQLG-----RF------------------RT
A0A1T5K9D4      --NIDVN---------------------YIHHV-----GL------------------RN
A0A3D1KEX9      --NLDVD---------------------YVMMK-----GL------------------QP
A0A358Y7S2      --GIHTN---------------------LYSKG-----TI------------------LT
A0A1X7J248      --PLDVT---------------------YHVIG-----RF------------------KD
E4TQD2          --PLDVS---------------------YHVIG-----RF------------------KN
A0A2J6HHN3      --PLDVS---------------------IFAKG-----NI------------------LN
A0A1Y3WMT8      --ELNKI---------------------YTSKK-----NF------------------FN
A0A1Y4GQU1      --ELNKV---------------------YTSKK-----NF------------------FS
A0A1V5W8T5      --NLYTS---------------------YYLEG-----KF------------------LT
A0A2T8HKA9      --QGDIS---------------------YSKTE-----GL------------------RN
A0A3B8INU3      --PLQVS---------------------YFTQG-----KI------------------LD
A0A414ZBF2      --RLDVS---------------------YKERN-----GL------------------RK
A0A1Q3Q573      --PLDIS---------------------YLKEG-----KS------------------KF
A0A662BAY3      --DFDIN---------------------YYSVG-----RV------------------KS
A0A4U3L369      --QLNVS---------------------YYKKE-----DI------------------RT
A0A357YNR3      --GLYAT---------------------YTEMR-----PLSLLARFGLKDNVPSFLIIKS
A0A5E8AX52      --NYNVS---------------------YHYYG-----NI------------------LT
F4KK08          --GLDVQ---------------------YHYDA-----GL------------------RE
A0A496LCF9      -PQFSID---------------------FYKKK-----QF------------------KN
A0A5P2G2A9      --HLNVN---------------------YYKRV-----PL------------------GI
A0A419VXB7      --GWNVS---------------------WYRHM-----PL------------------GD
C3J7R8          --NLDVS---------------------YSQSR-----GI------------------RT
A0A0B0BTJ4      --DANIV---------------------YATKS-----KL------------------RY
A0A3B9CNN6      --DANIV---------------------YATKS-----KL------------------RY
R5X290          --DANIV---------------------YATKS-----KL------------------RY
A0A1Q6E6I7      --DANIV---------------------YATKS-----KL------------------RY
A0A1G8BVM8      --GLETN---------------------YQVKD-----GL------------------RF
A0A2G2F510      --SLNVS---------------------LYSRG-----NV------------------LT
A0A316JZ08      --NMSVS---------------------MFSRG-----KL------------------LT
A0A1I1FXP9      GENIHIT---------------------YMQKG-----NF------------------VF
A0A3N4H5N3      --KAFIF---------------------LYDKI-----GF------------------FK
A0A2P8EAX2      --SAFVT---------------------FYDKI-----GI------------------FK
A0A4V2F6N9      --NAFVT---------------------FYDHN-----GM------------------FK
A0A3B9FXJ0      --PIEIS---------------------LIASG-----RI------------------RN
R5GSU5          --KLDVD---------------------YSVKN-----GL------------------GQ
A0A2A3UE91      --DISVN---------------------YYSEG-----VF------------------KN
A0A0A2G557      --NLRVT---------------------YRKKE-----GL------------------RS
A0A2N2WFW8      --PLDVS---------------------IFVKG-----NI------------------LN
A0A1F3IU95      --PLGVS---------------------VFAKG-----NI------------------LN
A0A3D0VUF6      --PLGVS---------------------VFAKG-----NI------------------LN
A0A1T4PT95      --NLRVN---------------------YQRKE-----GI------------------SS
A0A4P5TMD1      --PLSIS---------------------YFNIG-----QI------------------LV
A0A651GU15      --PLKVS---------------------YYLKG-----DI------------------LT
A0A3Q9FR88      -IDLTVT---------------------YQSVG-----DV------------------RD
A0A553GEX3      -IDLTVT---------------------YQSVG-----DV------------------RN
A0A150ADJ9      -IDLRLS---------------------YYSVG-----EI------------------RD
A0A1B1FWQ4      -IDLSVE---------------------YYSVG-----DV------------------RD
A0A1S1Z228      -IDLSVD---------------------YYSVG-----DV------------------RD
A0A2A4PYG9      --DLGIS---------------------YYSKG-----KI------------------LD
A0A1F3K695      --PLSIA---------------------YYSEG-----TF------------------LT
A0A353KZR1      --PLSIA---------------------YYSEG-----TF------------------LT
A0A2N2WYB5      --PLQVS---------------------YFSEG-----TF------------------LS
A0A1F3K4G0      --PIQIS---------------------YFSEG-----TF------------------LS
A0A356H8Y3      --PIQIS---------------------YFSEG-----TF------------------LS
A0A351HSA6      --PIQIS---------------------YFSEG-----TF------------------LS
A0A1F3Q014      --PLQAS---------------------YYAEG-----TF------------------KN
A0A2A4YXP3      --PIDVS---------------------YYNQG-----EI------------------LT
A0A2D5KD44      --PLQVS---------------------YFSEG-----QF------------------LR
A0A1F3R158      --PLNVS---------------------YFNQG-----KF------------------LT
A0A2M8ADX2      --PLEVS---------------------YFNKG-----KF------------------LT
A0A1J5B2H0      --PLDIS---------------------YYTEG-----RL------------------LN
A0A1V5N756      --PLDIA---------------------YYKKG-----RF------------------LN
A0A1F3SJM1      --NLNVS---------------------LYSRG-----KI------------------LT
A0A2G2EB96      --NLNVS---------------------LFSRG-----QI------------------LT
A0A2G6PRA9      --NLSVS---------------------LFSRG-----EI------------------LT
A1ZKR2          --DLWIS---------------------YYQQG-----NI------------------LD
A0A1Q3GX01      --DLWVS---------------------YYEQG-----NI------------------LE
A0A349DQI4      --DLWVS---------------------YYEQG-----NI------------------LE
A0A2N3IIZ0      --DLSVE---------------------YYAEG-----RI------------------LD
A0A497D5Z2      --DFELS---------------------YYREG-----NI------------------MT
A0A662B170      --DFELS---------------------YYREG-----NI------------------MT
A0A2A5FYT6      --DLEVS---------------------YFSEG-----QV------------------MA
A0A2E6SYP1      --KLDVN---------------------YYSKG-----KF------------------LN
A0A2E5RLE8      --NIDVN---------------------YYTKG-----KF------------------LN
A0A2E7TQF6      --NIDVN---------------------YYTKG-----KF------------------LN
A0A2E6GVY9      --NIDVN---------------------YYTKG-----KF------------------LN
A0A350JJ90      --PVDVS---------------------YYAEG-----EV------------------LN
A0A3M1CDV2      --NLQIS---------------------YYNEG-----TF------------------KN
A0A522EYA6      --PLKVT---------------------YFAEG-----TF------------------KE
A0A4P5U6G4      --PLLVS---------------------YYNTG-----QI------------------LV
A0A2E2TFD1      --PLDIS---------------------YFNEG-----EL------------------LN
A0A2E4ELE6      --PLTIS---------------------YYTEG-----EF------------------LT
A0A2E3XZI5      --KLNIL---------------------YYNEG-----EI------------------IS
A0A2M7NLQ9      --DLNIS---------------------YFVKG-----RW------------------WF
I4AFR0          --DLSVS---------------------YFVKG-----RW------------------WF
A0A2N2Y3E5      --PLDVS---------------------YYSKG-----TF------------------LE
A0A2D9D7T6      --SLYTS---------------------VYSEG-----KL------------------LT
A0A1F3PPL5      --PIDIQ---------------------YFNEG-----TF------------------LS
A0A357QK06      --PIDIQ---------------------YFNEG-----TF------------------LS
A0A662AEA4      --PLEIE---------------------YYTQG-----TF------------------QS
A0A0S2HYK8      --PLDIR---------------------YFVEG-----AF------------------LS
A0A2N5ZWN6      --PLETR---------------------YYIEG-----AF------------------LS
A0A0F2NS19      --PLEVS---------------------YFNQG-----KI------------------LE
A0A2A5H8X6      --PLEVS---------------------YFNQG-----KI------------------LE
A0A2H0GAU8      --QLKVS---------------------YYNQG-----NF------------------LN
A0A2M8FTK1      --QLKVS---------------------YYNQG-----NF------------------LN
A0A2A5B3B0      --PIDVS---------------------YYRKG-----EI------------------LI
A0A5C6RXM7      --PLAIS---------------------FYNKG-----TL------------------LE
A0A2E0FJ09      --PLQIR---------------------YFLEG-----KI------------------LK
A0A1F3FZ62      --NFEVS---------------------YYIKG-----RI------------------LN
A0A1F3K211      --NFEVS---------------------YYIKG-----RI------------------LN
A0A1F3KLL5      --PFEIS---------------------YFSQG-----TF------------------LS
A0A359D1M1      --PFEIS---------------------YFSQG-----TF------------------LS
A0A2E7CT70      --NENVR---------------------YYSEG-----EI------------------LT
A0A2D5V560      --ELKVF---------------------YYFEG-----EX------------------IT
A0A2D7K5A8      --NLKVF---------------------YYFKG-----EI------------------LT
A0A2E1XQ82      --NLKVF---------------------YYFEG-----EI------------------LT
A0A1V6I2U9      --PLDIS---------------------YYRKG-----TF------------------LS
A0A1F3C1M2      --PFQIT---------------------YFSEG-----TF------------------LK
A0A1F3DS87      --PFQVT---------------------YFSEG-----TF------------------LK
A0A2H0B957      --PLGVS---------------------YYSQG-----TF------------------LV
A0A1F3CFW6      --PLKIS---------------------YFSQG-----TF------------------LE
A0A2M7E2T8      --PLKIS---------------------YFSQG-----TF------------------LE
A0A2M7NC69      --PLKIS---------------------YFSQG-----TF------------------LE
A0A5C8A5B4      --DFGIS---------------------YYATK-----YF------------------LK
A0A4Y9ITE2      --QLNKT---------------------YIVKE-----NF-----------------LKK
A0A5M8NYX7      --NLRVA---------------------YYTNG-----KL-----------------KKN
A0A3D5KRY6      --NWRYS---------------------WYQKR-----FI-----------------GKR
A0A1V5IPN7      --KKNPD-----------------------------------------------------
A0A0E3V905      --HLDVR---------------------YFQNT-----TF-----------------GKR
A0A553ETH6      --DLNIS---------------------YFTTG-----NV-----------------LID
A0A640Q161      --SLYNN-----------------------------------------------------
A0A640QU49      --SLYNN-----------------------------------------------------
A0A1Q3PII2      --HLTTQ---------------------YFASG-----HL-----------------KTT
A0A351BXT2      --IDTFK-----------------------------------------------------
A0A2K8Z965      --HLNVR---------------------YYEAT-----TF-----------------SKR
A0A418M8U8      --HLDVR---------------------YFEKT-----AF-----------------GKR
I2GTA4          --HLDVR---------------------YFEKT-----AF-----------------GKR
A0A2K8ZAJ2      --GLDVQ---------------------YYRPT-----RT-----------------LKK
A0A368JPA3      --GLNIR---------------------YFRST-----PF-----------------GKR
A0A5N1JI29      --GLNIR---------------------YFRST-----PF-----------------GKR
A0A3P1BT12      --GLNIR---------------------YFRST-----PF-----------------GKR
A0A3P1CI15      --GLNVR---------------------FFRST-----PF-----------------GKR
A0A4R8CUK1      --GLNVR---------------------YFHKT-----AF-----------------GQR
A0A3D0MYJ7      ------------------------------------------------------------
A0A662AH13      ------------------------------------------------------------
A0A5C7QA01      --HLDVQLSSQEDNFKNRFLGANHYDTVYSNDA-----VI-----------------FKD
A0A3D3LS70      ------------------------------------------------------------
A0A1G1TM36      --GLSTV---------------------YQRPG-----RF-----------------SAQ
A0A1G7ZF38      --HLTTQ---------------------YFAAG-----TL-----------------KTT
C6VS52          --HLTIQ---------------------YFASG-----LL-----------------KTT
A0A0P7X1V8      ---YDER---------------------YQPDG-----RL--------------------
A0A3B0C2S4      --NLDVS---------------------YFQKG-----NI------------------KT
L8JI02          --DFGIS---------------------YFSKE-----SF------------------RA
A6EBM4          --QYHIS---------------------FYSYE-----RL------------------LQ
A0A416GA42      --DLDVC---------------------YQVKG-----FW------------------RP
A0A4R5DL69      --QLYIS---------------------YFVSG-----NI------------------KT
A0A1T3IYP5      --GADKS---------------------YKIHS-----GL------------------RD
A0A1M4YED3      --NLYTE---------------------IKEET-----QW------------------GL
A0A3P1Z8V4      --GLEVD---------------------YTCRE-----GL------------------HN
A0A2N3U785      --SLYVN---------------------YYVEG-----HI------------------KT
A0A0E3ZG78      --SLFIG---------------------YYIEG-----RV------------------ND
A0A1I6BRK6      --DLVTR---------------------YYVEE-----RI------------------TD
A0A243WAB1      --NLVAN---------------------YYVEG-----KF------------------VN
A0A126PFG0      --QLSTL---------------------YQQRD-----HL------------------GA
A0A3M1N7Z3      --RLNYE---------------------VYSIG-----KV------------------G-
A0A2H3NSN0      --R-------------------------------------------------------TA
A0A2P6C324      --E-------------------------------------------------------DV
A0A1M6XHU0      --V-------------------------------------------------------AT
A0A5S9C8G0      --V-------------------------------------------------------AT
G2SF81          --V-------------------------------------------------------AT
A0A5S9EYW1      --V-------------------------------------------------------AT
D0MHQ9          --V-------------------------------------------------------AT
A0A4D7K1D4      --DLDVT---------------------IRTTF-----GS-----------------LKN
A0A3C1ITV0      --RLNVT---------------------YKSKN-----WI-----------------GYV
R7HN19          --RLNVT---------------------YKSKN-----WI-----------------GYV
A0A060RD97      --DLNVS---------------------YSYMG-----RF------------------RK
A0A0D3L8Q3      --DLDVT---------------------YYGDG-----RI------------------KD
A0A5B6TJH8      --DLFTN---------------------YYIEG-----QF------------------QD
A0A519U664      --DLFTS---------------------YYVEG-----KV------------------VD
A0A519UDD1      --GLFTS---------------------YYIEG-----QV------------------KD
A0A519MA34      --DLFTS---------------------YYVEG-----KI------------------ID
A0A519UCX0      --DLYTS---------------------YYVKG-----RA------------------ID
R7PCR1          --GLDVS---------------------YDTKD-----GL------------------RP
A0A350IHV0      --GLEAS---------------------YVEKQ-----FL------------------RS
A0A1G9E2A9      --DLAVS---------------------YYVVG-----DV------------------VN
A0A098LL25      --KMNVS---------------------YFAYG-----NI------------------LY
A0A2T2YJE8      --PLDIN---------------------YYSIG-----NV------------------LN
A0A127B287      --PLQVS---------------------YHVEA-----RI------------------LE
A0A3M9N829      --PLQVS---------------------YHVDA-----RV------------------LD
A0A0P0CSF9      --PLQVS---------------------YFVEA-----RV------------------LD
A0A5M8QQB8      --PLQVS---------------------YFVEA-----RV------------------LD
A0A3M9MNC3      --PLQVS---------------------YHIEA-----RV------------------LD
A0A5B6TAX2      --PLQVS---------------------YHVEA-----RV------------------LD
A0A5N1IQ33      --DLDVN---------------------YFAEG-----TV------------------LA
A0A512AYT3      --NLNVS---------------------YYALG-----NV------------------LS
A0A5M6CYN7      --NLNVS---------------------YYALG-----NV------------------LS
A0A369QP10      --PLDIS---------------------YYAIG-----NI------------------LN
A0A126PDF2      --DLYVN---------------------YYVQG-----TV------------------LE
A0A2Z3GKA1      --DLYVN---------------------YYVQG-----TV------------------LE
A0A502GZP7      --NLNVN---------------------YYVQG-----TV------------------LE
A0A519SBU8      --ALDVN---------------------YYVQG-----TV------------------LE
A0A4Q3JNZ3      --ALDVN---------------------YYVQG-----TV------------------LE
A0A519Q9V3      --ALDVN---------------------YYVQG-----TV------------------LE
A0A0M3RW20      --ELDVN---------------------YYAQG-----TV------------------LE
A0A495VFX4      --ELDVN---------------------YYAQG-----TV------------------LE
A0A1S9B3W0      --PLDVN---------------------YYAEG-----TV------------------LE
A0A1W1VRL3      --ALDVN---------------------YYVEG-----TV------------------LE
A0A1M6R305      --DLDVN---------------------YYAEG-----TV------------------LE
A0A4Z0PHK3      --ELDVN---------------------YYVEG-----TV------------------LE
A0A2M9B9H9      --ELNVN---------------------YYVEG-----TV------------------LE
A0A4Z0QCY9      --ELNVN---------------------YYVEG-----TV------------------LE
A0A418R9X5      --TLDVN---------------------YYVQG-----TV------------------LE
A0A428JSJ3      --ELDVN---------------------YYVQG-----TV------------------LE
A0A428KI59      --ALDVN---------------------YYVQG-----TV------------------LE
W8F1I6          --ALDVN---------------------YYVQG-----TV------------------LE
A0A246FQC0      --DLDVN---------------------YYVQG-----TV------------------LE
A0A372E5P8      --ALDVN---------------------YYVQG-----TV------------------LE
A0A1H3EMW1      --ALDVN---------------------YYVQG-----TV------------------LE
A0A1H9ZSN3      --ALDVN---------------------YYVQG-----TV------------------LE
A0A5N1J2M4      --NLEVS---------------------YFVRG-----NV------------------LD
A0A519S476      --ALDIN---------------------YYVQG-----TV------------------LE
A0A4Q3JRW8      --ALDVN---------------------YYVQG-----TV------------------LE
A0A519M923      --ALDVN---------------------YYVQG-----TV------------------LE
A0A4Z0ENW1      --ALDIN---------------------YYTQG-----TV------------------LE
A0A519UDB4      --PLDIN---------------------YYTQG-----TV------------------LE
A0A3S0QKV1      --PLDVN---------------------YYAEG-----TV------------------LE
A0A328BL48      --ELDVN---------------------YYTEG-----TV------------------LE
A0A5R8WLY4      --ELDVN---------------------YYTEG-----TV------------------LE
A0A1I5WSL8      --ALDVN---------------------YYVQG-----TV------------------LE
A0A0U3JVM7      --ALDIN---------------------YYVQG-----TV------------------LE
A0A1G1SSV2      --ALDVN---------------------YYVQG-----TV------------------LE
A0A1G1SXV7      --ALDVN---------------------YYVQG-----TV------------------LE
A0A0W8EDI5      --NLNVS---------------------YFVEG-----TV------------------LA
A0A3B7RBP8      --NLNVG---------------------YFVEG-----TV------------------LA
A0A3R9P8H7      --TLDVN---------------------YYVQG-----TV------------------LE
A0A238WIA7      --ELEVA---------------------YYAEG-----TV------------------LE
A0A212UCJ7      --DLEVN---------------------YYAEG-----TV------------------LE
A0A4Z0MQE1      --DLEVN---------------------YYAEG-----TV------------------LE
A0A4Z0PCF4      --DLEVN---------------------YYAEG-----TV------------------LE
A0A5D6VDG1      --DLDVN---------------------YYSQG-----TV------------------LE
A0A243WHR7      --ALDVN---------------------YYVEG-----TV------------------LE
A0A5B8A0P6      --ALDVN---------------------YYAEG-----AV------------------LE
A0A076HRT9      --DLDVN---------------------YYAEG-----TV------------------LE
A0A4Z0PVM7      --ELNVN---------------------YYVEG-----TV------------------LE
A0A1M6DHW8      --DLDVN---------------------YYVEG-----TV------------------LE
A0A4Q5LC61      --DLDVN---------------------YYVEG-----TV------------------LE
A0A2A8CVM9      --RATES---------------------ALEEK-----G---------------------
A0A3C0ZQC7      --LIKRG---------------------YTDST-----N---------------------
A0A2E3R1D0      --LIEAE---------------------TVPGT---------------------------
A0A2T2USC0      --LDSME---------------------TNPYT---------------------------
A0A2T2V0F3      --LDTME---------------------THPRT---------------------------
A0A2T2S682      --LDTMG---------------------THPRT---------------------------
D5H561          --LLEQG---------------------EARRV-----LS------------------SQ
A0A2H3NWA9      --MDEM-----------------------YPEG---------------------------
A0A2A8CVB6      --LLALG---------------------RHPET---------------------------
A0A2P6C1S6      --LQRMG---------------------THPDT---------------------------
A0A2T2UTM4      --LQDLG---------------------THPET---------------------------
R5RVP0          --GLETT---------------------YVEKQ-----FL------------------RS
R6A0L2          --NLDVD---------------------YTTKE-----KL------------------HS
R7LG80          --DLDVD---------------------YLMPV-----SL------------------HK
A0A2L2WX98      --HLDVD---------------------YTIKE-----SL------------------HE
A0A285T4L1      --HADVD---------------------YRVEE-----GL------------------RM
G5GD56          --GLDVD---------------------YTTSA-----GL------------------HS
R5KD55          --GLDVS---------------------YTTRG-----TF------------------YD
A0A174QNT3      --HLDIN---------------------YVVRN-----GL------------------RH
A0A4S2FGS1      --HLDVE---------------------YTLRN-----GL------------------RH
R9I0H0          --HLDVD---------------------YTIRD-----GL------------------RR
K5BUT9          --HLDVD---------------------YAKDG-----IL------------------RD
A0A174FPA3      --HLDVG---------------------YAKDG-----IL------------------RD
R6S9Y6          --HLDVG---------------------YAKDG-----IL------------------RD
A0A642LIH6      --HLDVG---------------------YAKDG-----IL------------------RD
C9KX15          --HLDVG---------------------YAKDG-----IL------------------RD
R6DAG6          --HLDVS---------------------YEKEG-----FF------------------RN
A0A3L8AAP1      --HLDVS---------------------YEKEG-----FF------------------RN
A0A4S2AYX2      --HLDVS---------------------YEKEG-----FF------------------RN
A0A4Y9H477      --HLDVS---------------------YEKEG-----FF------------------RN
A0A0E2M2Y7      --DLDVS---------------------ISKDG-----FW------------------RH
A0A0K2J6Z0      --DLDVS---------------------ISKDG-----FW------------------RH
B2RKZ8          --DLDVS---------------------ISKDG-----FW------------------RH
A0A212GC82      --DLDVS---------------------ISKDG-----FW------------------RH
A0A254MU12      --DLDVS---------------------ISKDG-----FW------------------RH
R6CQ93          --HADVD---------------------YRVEK-----GL------------------RM
A0A3D1NQW3      --GLTVQ---------------------YETKD-----GL------------------RP
B0MT10          --GLTVQ---------------------YETKD-----GL------------------RP
R7JGW9          --GLTVQ---------------------YETKD-----GL------------------RP
A0A414Q925      --HLDIS---------------------YKEWD-----GL------------------RK
A0A415PUS9      --HLDIS---------------------YKEWD-----GL------------------RK
A0A108TCU0      --HLDIS---------------------YKEWD-----GL------------------RK
A0A413BA42      --HLDIS---------------------YKEWD-----GL------------------RK
S3Y344          --HLDIS---------------------YKEWD-----GL------------------RK
A0A4Q5G8Y8      --HLDIS---------------------YKEWD-----GL------------------RK
A0A412TGL3      --HLDIS---------------------YKEWD-----GL------------------RK
A0A413VJ33      --HLDIS---------------------YKEWD-----GL------------------RK
A0A414L0W6      --HLDIS---------------------YKEWD-----GL------------------RK
A0A412DP39      --HLDIS---------------------YKEWD-----GL------------------RK
A0A413ZSE8      --HLDIS---------------------YKEWD-----GL------------------RK
B0NP84          --HLDIS---------------------YKEWD-----GL------------------RK
R6AK43          --HLDIS---------------------YKEWD-----GL------------------RK
A0A412N2D9      --HLNVS---------------------YKEWD-----GL------------------RK
A0A1Y4JYS9      --HLNVS---------------------YKEWD-----GL------------------RK
R6LHA4          --HLNVS---------------------YKEWD-----GL------------------RK
A0A3D2BF46      --NLHVN---------------------YVVKH-----GL------------------RT
A0A4Y1WUN1      --NLHVN---------------------YVVKH-----GL------------------RT
A0A4Y1XL94      --NLHVN---------------------YVVKH-----GL------------------RT
A0A358R538      --GLTTD---------------------YSVRD-----RL------------------RA
A0A1Y4AAB8      --RLTTG---------------------YSKRS-----GL------------------RT
A0A1Y3WWY9      --NLTEA---------------------YSIHE-----HL------------------RD
A0A1Y4U5L4      --NLTEA---------------------YSIHE-----HL------------------RD
A0A1Y3VCJ1      --NLTVN---------------------YTVDG-----RF------------------QD
A0A1Y3QTW7      --HLTVN---------------------YSVRD-----GL------------------RT
R6XWY7          --HLTVN---------------------YSVRD-----GL------------------RT
A0A4Y1X9Y9      --HLTVN---------------------YSVRD-----GL------------------RT
A0A4Y1WM66      --HLTVN---------------------YSVRD-----GL------------------RT
A0A174AVF1      --HLTVN---------------------YSVRD-----GL------------------RT
A0A656Q4F4      --HLTVN---------------------YSVRD-----GL------------------RT
A0A1Q6EIY0      --HLTVN---------------------YSVRE-----GL------------------RT
A0A5B5VN71      --HLTVN---------------------YSVRE-----GL------------------RT
E4M8L3          --HLTVN---------------------YSVRE-----GL------------------RT
I3YQ50          --HLTVN---------------------YSVRE-----GL------------------RT
R5UEY8          --HLTVN---------------------YSVRE-----GL------------------RT
A0A1H4D866      --DLTVS---------------------YSVRE-----RL------------------RR
A0A5B3G4Y7      --NLTVN---------------------YSVSE-----RL------------------RR
A0A374A9J5      --NLTVN---------------------YSVSD-----GL------------------RR
A0A5B3GQN5      --NLTVN---------------------YSVSD-----GL------------------RR
A0A1Q6E9S3      --NLTVN---------------------YSVSD-----GL------------------RR
D4IJ36          --NLTVN---------------------YSVSD-----GL------------------RR
A0A3E5HPT8      --HADVS---------------------YMVRD-----GL------------------RP
C6IJ48          --HADVS---------------------YMVRD-----GL------------------RP
Q8A3U2          --HADVS---------------------YMVRD-----GL------------------RP
A0A3R6S1H6      --NLNIS---------------------YRVEA-----GL------------------RE
A0A3R6SD81      --NLNIS---------------------YRVEA-----GL------------------RE
A0A354WXN6      --HLDIN---------------------YSIKE-----GL------------------RT
R5IP14          --DLDVG---------------------YVMQG-----GL------------------RD
A0A316SZX7      --KLDVN---------------------YTEDM-----GL------------------QT
A0A1Y4AIY1      --HLDVS---------------------YTEKR-----GL------------------RT
F3ZRU7          --SLNTT---------------------YSVRQ-----GL------------------RK
A0A0J6CIR2      --NLDIS---------------------YTIKD-----GL------------------RT
A0A3D8HG59      --KLDIS---------------------YTQKR-----GL------------------RT
A0A3R6S408      --KLDIS---------------------YTQKR-----GL------------------RT
A0A1C5Q1F3      --KLDIF---------------------YSVKG-----KF------------------RD
R7A239          --KLDIF---------------------YSVKG-----KF------------------RD
A0A3R6HIK7      --HLDVS---------------------YQVKR-----GL------------------RM
K5ZVW7          --HLDVS---------------------YQVKR-----GL------------------RT
A0A1Y4D5Z0      --HLDIS---------------------YTVKQ-----GL------------------RT
A0A413VXJ7      --HLDIS---------------------YKIKE-----GL------------------RN
I9RSN9          --HLDIS---------------------YKIKE-----GL------------------RN
U6RJK5          --HLDIS---------------------YKIKE-----GL------------------RN
A0A1Q6GA32      --HLDIS---------------------YKIKE-----GL------------------RN
I9RPU6          --HLDMS---------------------YKVKN-----GL------------------RN
I8YFS5          --HLDMS---------------------YKVKN-----GL------------------RE
A0A4Q5F7I7      --HLDMS---------------------YKVKN-----GL------------------RE
I8Y597          --HLDMS---------------------YKVKN-----GL------------------RE
A0A1Q6GBF5      --HLDMS---------------------YKVKN-----GL------------------RE
I8YFZ3          --HLDMS---------------------YKVKN-----GL------------------RN
A0A4V1YNX8      --HLDMS---------------------YKVKN-----GL------------------RN
A0A1Q6GDH2      --HLDMS---------------------YKVKN-----GL------------------RN
U6RSB0          --HLDMS---------------------YKVKN-----GL------------------RN
I9GXM2          --HLDMS---------------------YKVKN-----GL------------------RN
I9SIK1          --HLDMS---------------------YQVKN-----GL------------------RN
A0A4Q5FNG1      --HLDMS---------------------YQVKN-----GL------------------RN
I9TP59          --HLDMS---------------------YQVKN-----GL------------------RN
R5S343          --SLEQI---------------------YTTKR-----GL------------------CT
A0A1M6K7I9      --SLNMS---------------------YKVRI-----GL------------------RT
A0A5M6A8C8      --SLNMS---------------------YKVRI-----GL------------------RT
A0A4V1YPN7      --CLDMS---------------------YKIRN-----GL------------------RE
A0A4Q5F874      --HLDMS---------------------YTVKN-----GL------------------RD
A0A641LV22      --HLDMS---------------------YTVKN-----GL------------------RD
A0A3R5ZMK1      --HLDVS---------------------YTVKD-----GL------------------RT
A0A3E4ZTK7      --HLDVS---------------------YTVKE-----GL------------------RT
A0A1Y3ZIA4      --HLDVS---------------------YTVKD-----GL------------------RT
K5Y1A4          --HLDVS---------------------YTVKD-----GL------------------RT
A0A4Q5CIT0      --HLDVS---------------------YTVKD-----GL------------------RT
A0A3R6K8X4      --HLDVS---------------------YTVKD-----GL------------------RT
A0A414GI87      --HLDVS---------------------YTVKD-----GL------------------RT
A0A415BDM7      --HLDVS---------------------YTVKD-----GL------------------RT
A0A412DM15      --HLDVS---------------------YTVKD-----GL------------------RT
A7AEU7          --HLDVS---------------------YTVKD-----GL------------------RT
A0A1Q6I3T6      --HLDVS---------------------YTVKD-----GL------------------RM
A0A414XX40      --HLDVS---------------------YTVKD-----GL------------------RM
A0A3R6BKI7      --HLDVS---------------------YTVKD-----GL------------------RT
A0A414LPI6      --HLDVS---------------------YTVKD-----GL------------------RT
A0A412M2W1      --HLDVS---------------------YTVKD-----GL------------------RT
K5ZX55          --HLDVS---------------------YTVKD-----GL------------------RT
A0A5F0U645      --DLDIS---------------------YSIRE-----GL------------------RT
K5ZBN2          --DLDIS---------------------YSIRE-----GL------------------RT
A0A0J6CKW3      --DLDIS---------------------YSIRE-----GL------------------RT
A0A0F5IQM7      --DLDIS---------------------YSIRE-----GL------------------RT
A0A496CDT3      --DLDIS---------------------YSIRE-----GL------------------RT
S0GLB0          --DLDIS---------------------YSIRE-----GL------------------RT
A0A3R6NLC1      --DLDIS---------------------YSIRE-----GL------------------RT
A0A416WYC9      --DLDIS---------------------YSIRE-----GL------------------RT
A0A0F5IT40      --NLDIS---------------------YTIKD-----GL------------------RT
A0A496CX20      --NLDIS---------------------YTIKD-----GL------------------RT
A0A5F0UBI0      --NLDIS---------------------YTIKD-----GL------------------RT
S0GSI7          --NLDIS---------------------YTIKD-----GL------------------RT
K5YB65          --NLDIS---------------------YTIKD-----GL------------------RT
A0A0F5IWP9      --NLDIG---------------------YTVKE-----GL------------------RT
A0A0F5IZT8      --NLDIG---------------------YTVKE-----GL------------------RT
A0A417LKQ2      --NLDVS---------------------YTVKE-----GL------------------RT
A0A416TME1      --NLDVS---------------------YTEKD-----GL------------------RT
A0A416XPE8      --NLDVS---------------------YTEKD-----GL------------------RT
A0A5C8KAD6      --SLYAP---------------------IYEEG-----KF------------------KS
A0A5N1J695      --MLYAQ---------------------VFEED-----QF------------------RS
A0A1H4ADG3      --QLYLN---------------------FSTYK-----DF------------------RS
A0A5B8VUR8      --QLNLS---------------------FSTYK-----DF------------------KS
A0A2A4G4B1      --NLHIR---------------------YYSKN-----SF------------------KN
A0A3N2M1H3      --HLDMN---------------------YDRLG-----GF------------------HP
A0A4S2G8T2      --HLDMN---------------------YDRLG-----GF------------------HP
A0A212K7W5      --KLDED---------------------YSTKG-----FF------------------RN
F5IU11          --KLDED---------------------YSIKG-----FF------------------RN
A0A3N2N6F7      --GLRAN---------------------YVYKK-----RL------------------RP
A0A4P7VVU7      --GLQTD---------------------YIYRH-----NL------------------KN
A0A2V1ILM4      --GLQTD---------------------YIYRH-----NL------------------KN
A0A3N2L0E8      --GLQTD---------------------YIYRH-----NL------------------KN
A0A3N2LFC5      --GLQTD---------------------YIYRH-----NL------------------KN
A0A553LCN8      --HLDVS---------------------YEEDG-----FF------------------RN
K0XJ09          --HLDVT---------------------YQVKN-----WL------------------HY
R5EUZ0          --HLDVT---------------------YQVKN-----WL------------------HY
W0EQS0          --HLDVA---------------------YRVKD-----WL------------------HY
A0A1Y3WE15      --HLDVT---------------------YQVKD-----FL------------------HN
A0A1Y4GUK3      --NLDVT---------------------YQVKD-----FL------------------HN
A0A352Z1R7      --HLDWQ---------------------VTKKS-----KD------------------LD
A0A0A2F501      --GLNVE---------------------YYADG-----RY------------------YK
R5B7P0          --RLYMS---------------------YTVDG-----TF------------------HR
R5B0L5          --SLDET---------------------YNIDG-----RF------------------HK
A0A374THP7      --KLDVD---------------------YAIDG-----AF------------------HK
A0A3R5XWG1      --KLNVD---------------------YAVDG-----RF------------------HR
A0A5P0Y910      --KLNVD---------------------YAVDG-----RF------------------HR
A0A5P0XQC0      --KLNVD---------------------YAVDG-----RF------------------HR
A0A414YFM3      --KLNVD---------------------YAVDG-----RF------------------HR
A0A5P0VXP6      --KLNVD---------------------YAVDG-----RF------------------HR
A0A5P0W892      --KLNVD---------------------YAVDG-----RF------------------HR
A0A0A2EVS5      --NLDID---------------------YKVDG-----RF------------------HR
A0A1T4NAJ7      --NLDID---------------------YKVDG-----RF------------------HR
A0A255T941      --RLNEV---------------------YSVRE-----GL------------------KR
A0A3N2KCL3      --NLDMN---------------------YYIPG-----RF------------------HD
A0A4P7VSV0      --NLDMN---------------------YYIPG-----RF------------------HD
A0A2V1IJY1      --NLDMN---------------------YYIPG-----RF------------------HD
A0A4P7VXK7      --DLDMN---------------------YYIPG-----RF------------------HD
A0A1Y4CHN5      --HLDVN---------------------YKVDG-----RF------------------YD
A0A1M6I2S6      --GLNET---------------------YTVRK-----GL------------------KD
A0A1Y3V692      --GLNET---------------------YTVRK-----GL------------------KD
F3PXM2          --GLDET---------------------YTVRR-----GL------------------RR
A0A3E4ZNL4      --VLNET---------------------YIIRR-----GL------------------KQ
A0A174AHH7      --GLNEI---------------------YTIRR-----GL------------------KR
A0A174JCE8      --GLNEI---------------------YTIRR-----GL------------------KR
A0A3E4JMC4      --GLNEI---------------------YTIRR-----GL------------------KR
A0A412SND6      --GLNEI---------------------YTIRR-----GL------------------KR
A0A414IEQ9      --GLNEI---------------------YTIRR-----GL------------------KR
A0A415UKN5      --GLNEI---------------------YTIRR-----GL------------------KR
A0A0M1W8D8      --GLNEI---------------------YTIRR-----GL------------------KR
A0A3R6GKX5      --GLNEI---------------------YTIRR-----GL------------------KR
A7V4S1          --GLNEI---------------------YTIRR-----GL------------------KR
B0NU19          --GLNEI---------------------YTIRR-----GL------------------KR
D4V601          --GLNEI---------------------YTIRR-----GL------------------KR
A0A4Q0U3M9      --GLNEI---------------------YTIRR-----GL------------------KR
A0A4R4H1Q2      --GLNEI---------------------YTIRR-----GL------------------KR
A0A397WLT5      --GLNEI---------------------YTIRR-----GL------------------KR
A0A3R6GM96      --GLNEI---------------------YTIRR-----GL------------------KR
A0A015XH67      --GLNEI---------------------YTIRR-----GL------------------KR
A0A078RZN2      --GLNEI---------------------YTIRR-----GL------------------KR
A0A4R4I3T9      --GLNEI---------------------YTIRR-----GL------------------KR
A6L0K5          --GLNEI---------------------YTIRR-----GL------------------KR
A7ACT5          --GLNEI---------------------YTIRR-----GL------------------KR
A6KY94          --GLNEI---------------------YTVRR-----GL------------------KR
A0A173UQR8      --GLNEI---------------------YTVRR-----GL------------------KR
A0A3R6HK75      --GLNEI---------------------YTVRR-----GL------------------KR
A0A412B7D1      --GLNEI---------------------YTVRR-----GL------------------KR
A0A412VNY9      --GLNEI---------------------YTVRR-----GL------------------KR
A0A414LTU9      --GLNEI---------------------YTVRR-----GL------------------KR
I9Q4U4          --GLNEI---------------------YTVRR-----GL------------------KR
A0A373ISF0      --RLNET---------------------YTVRK-----GL------------------KN
U6RF62          --RLNET---------------------YTVRK-----GL------------------KN
A0A662ZZD5      --GLNET---------------------YTVRK-----GL------------------KD
A0A395YYT3      --GLNET---------------------YTVRK-----GL------------------KD
A0A642JYJ3      --GLNET---------------------YTVRK-----GL------------------KD
A0A015UXN7      --GLNET---------------------YTVRK-----GL------------------KD
A0A5M5W148      --GLNET---------------------YTVRK-----GL------------------KD
A0A3A5TI83      --GLNET---------------------YTVRK-----GL------------------KD
A0A415NEB6      --GLNET---------------------YTVRK-----GL------------------KD
A7AJ60          --GLNET---------------------YTVRK-----GL------------------KD
A0A016E4F9      --GLNET---------------------YTIRK-----GL------------------RT
A0A4Q5CFJ7      --GLNES---------------------YTVRK-----GL------------------RT
A0A108TH71      --GLNET---------------------FTIRK-----GL------------------KN
I8VXH0          --GLNET---------------------FTIRK-----GL------------------KN
A0A412S0N6      --GLNET---------------------YTIRK-----GL------------------KN
A0A412IIJ0      --GLNET---------------------FTIRK-----GL------------------KN
A0A0P0FM97      --GLNET---------------------FTIRK-----GL------------------KN
R6KTP3          --GLNET---------------------FTIRK-----GL------------------KN
A0A139LU87      --GLNET---------------------FTIRK-----GL------------------KN
A0A1C6B3Y5      --GLNET---------------------FTIRK-----GL------------------KN
E2NMQ4          --GLNET---------------------FTIRK-----GL------------------KN
A0A412YDB9      --GLNET---------------------FTVRR-----GL------------------KK
R7DY01          --GLNET---------------------FTVRR-----GL------------------KK
A0A414LGK8      --GLNEV---------------------FTVRK-----GL------------------KK
A0A415IPQ4      --GLNET---------------------FTIRR-----GL------------------KS
A0A3E5BRW7      --GLNDI---------------------FTVRR-----GL------------------KN
K9DXS6          --GLNDI---------------------FTVRR-----GL------------------KN
A0A1M6KFV3      --GLNES---------------------FTVRR-----GL------------------KN
A0A1Q6G7L3      --GLNES---------------------FTVRR-----GL------------------KN
A0A413H235      --GLNES---------------------FTVRR-----GL------------------KN
A0A1M5B2J8      --HLEMN---------------------YLVEG-----RF------------------HK
A0A255RCT5      --HLDMN---------------------YLVDG-----RF------------------HK
A0A1Y4GLF5      --QLGTT---------------------YYLPG-----KF------------------HR
A0A1H3XSC0      --HLDMN---------------------YTVPG-----RF------------------HR
A6LE40          --RLDMN---------------------YFVPG-----KF------------------HR
A0A4Y1VPX5      --RLDMN---------------------YFVRG-----KF------------------HR
B3JI46          --RLDMN---------------------YFVRG-----KF------------------HR
R6NN15          --HLEVD---------------------YSTEG-----SF------------------YA
A0A358R8U0      --HLDMN---------------------YHIPG-----RF------------------QD
R6WSB6          --HLDMN---------------------YHIPG-----RF------------------QD
A0A4Q5ENK6      --HLEMN---------------------YQTDG-----RF------------------HK
A0A401LPX7      --HLEMN---------------------YQTDG-----RF------------------HK
A0A3A5Z900      --HLEMN---------------------YQTDG-----RF------------------HK
A0A3R6EGW5      --HLEMN---------------------YQTDG-----RF------------------HK
A0A285TGL6      --HLEMN---------------------YQTDG-----RF------------------HK
A0A3A5RFX4      --HLEMN---------------------YQTDG-----RF------------------HK
A0A1Q6IUW9      --HLEMN---------------------YQTDG-----RF------------------HK
A0A3R6NPG7      --HLEMN---------------------YQTDG-----RF------------------HK
A0A413XDP6      --HLEMN---------------------YQTDG-----RF------------------HK
K6AP24          --HLEMN---------------------YQTDG-----RF------------------HK
A0A662ZYI7      --HLEMN---------------------YQTDE-----RF------------------HK
A0A078RYI7      --HLEMN---------------------YQTDG-----RF------------------HK
C7XEQ8          --HLEMN---------------------YQTDG-----RF------------------HK
D7INX6          --HLEMN---------------------YQTDG-----RF------------------HK
K5ZG55          --HLEMN---------------------YQTDG-----RF------------------HK
A0A3N2N9B8      --KLDMD---------------------YYSHG-----RF------------------HD
A0A3N2NMI0      --NLDVN---------------------YFRKG-----RF------------------HN
A0A359I8H7      --GLDVN---------------------YSTPG-----RF------------------HE
A0A3N2KA63      --GLDVN---------------------YSTPG-----RF------------------HE
A0A4Q0IMT7      --GLDVN---------------------YSTPG-----RF------------------HE
A0A3B9FAU3      --NLDMN---------------------YTMEG-----RW------------------HK
A0A3C1E5L7      --NLDMN---------------------YTMEG-----RW------------------HK
A0A4Q0UAV1      --DLNNM---------------------YYVDN-----GL------------------HN
A0A354SN68      --HLEVS---------------------YSISD-----RL------------------KE
A0A3N2N595      --KLDMN---------------------YFKDG-----TF------------------HK
A0A0A2DUD9      --ELWTS---------------------YEAPG-----AF------------------HD
A0A3P1ZBJ5      --HLDID---------------------YSVEG-----FF------------------HD
R5FHS9          --GLNVS---------------------YLTDS-----TF------------------YK
A0A413TW79      --KLDVN---------------------YSEGG-----TF------------------HP
A0A3E5E9M7      --KLDVN---------------------YSEDG-----TF------------------HP
A0A3E4SK73      --KLDVN---------------------YSEDG-----TF------------------HP
A0A415GGC6      --KLDVN---------------------YSEDG-----TF------------------HP
A0A413DBH9      --KLDVN---------------------YSEDG-----TF------------------HP
A0A495WI87      --HLNMD---------------------YHVDG-----GF------------------YR
A0A354M4S6      --HLNMD---------------------YHVDG-----GF------------------YR
R7DH52          --HLNMD---------------------YHVDG-----GF------------------YR
A0A4Q5E7L5      --RLDMN---------------------YFFPG-----KF------------------HQ
A0A4P8LP09      --RLDMN---------------------YFVPG-----KF------------------HR
A0A4R4GZU7      --RLDMN---------------------YFVPG-----KF------------------HR
A0A016CWA4      --RLDMN---------------------YFVPG-----KF------------------HR
A0A1C6H117      --RLDMN---------------------YFVPG-----KF------------------HR
A0A415TAH7      --RLDMN---------------------YFVPG-----KF------------------HR
A0A0M1W0V2      --RLDMN---------------------YFVPG-----KF------------------HR
A0A139KA16      --RLDMN---------------------YFVPG-----KF------------------HR
A0A174VQ92      --RLDMN---------------------YFVPG-----KF------------------HR
A0A1Q6HCG0      --RLDMN---------------------YFVPG-----KF------------------HR
A0A1Y4JYM9      --RLDMN---------------------YFVPG-----KF------------------HR
A0A3A5QW67      --RLDMN---------------------YFVPG-----KF------------------HR
A0A3A5RQE6      --RLDMN---------------------YFVPG-----KF------------------HR
A0A3A6BP07      --RLDMN---------------------YFVPG-----KF------------------HR
A0A3E5E153      --RLDMN---------------------YFVPG-----KF------------------HR
A0A3Q9IP20      --RLDMN---------------------YFVPG-----KF------------------HR
A0A412WV15      --RLDMN---------------------YFVPG-----KF------------------HR
A0A413ICP6      --RLDMN---------------------YFVPG-----KF------------------HR
A0A414KYB9      --RLDMN---------------------YFVPG-----KF------------------HR
A0A5B3FWR2      --RLDMN---------------------YFVPG-----KF------------------HR
E5WX00          --RLDMN---------------------YFVPG-----KF------------------HR
K0X3P3          --RLDMN---------------------YFVPG-----KF------------------HR
A0A3A5Z014      --HLDMN---------------------YFVPG-----KF------------------HR
A0A1M4YZ07      --RLDMN---------------------YFVPG-----KF------------------HR
A0A078S3Q8      --RLDMN---------------------YFVPG-----KF------------------HR
A0A069SJV7      --RLDMN---------------------YFVPG-----KF------------------HR
A0A3E5DXI5      --RLDMN---------------------YFVPG-----KF------------------HR
A0A3E5EM98      --RLDMN---------------------YFVPG-----KF------------------HR
A0A3E5F453      --RLDMN---------------------YFVPG-----KF------------------HR
I9T3G6          --RLDMN---------------------YFVPG-----KF------------------HR
A0A4Q5E5M7      --RLDMN---------------------YFVPG-----KF------------------HR
A0A0P0FQW1      --RLDMN---------------------YFVPG-----KF------------------HR
A0A5M5C0W6      --RLDMN---------------------YFVPG-----KF------------------HR
A0A642LZ22      --RLDMN---------------------YFVPG-----KF------------------HR
A0A5M5YM86      --RLDMN---------------------YFVPG-----KF------------------HR
A0A642LE65      --RLDMN---------------------YFVPG-----KF------------------HR
A0A5M5Y0P8      --RLDMN---------------------YFVPG-----KF------------------HR
A0A642NJ89      --RLDMN---------------------YFVPG-----KF------------------HR
C3RFN5          --RLDMN---------------------YFVPG-----KF------------------HR
A0A3E4SYU0      --RLDMN---------------------YFVPG-----KF------------------HR
A6LGY1          --RLDMN---------------------YFVPG-----KF------------------HR
K5ZSH4          --RLDMN---------------------YFVPG-----KF------------------HR
A0A078T2W6      --RLDMN---------------------YFVPG-----KF------------------HR
A0A3R6EAF7      --RLDMN---------------------YFVPG-----KF------------------HR
A0A5C6L2P1      --RLDMN---------------------YFVRG-----KF------------------HR
A0A412MJT7      --RLDMN---------------------YFVRG-----KF------------------HR
A0A3E4WKT5      --RLDMN---------------------YFVRG-----KF------------------HR
A0A3A5YY33      --RLDMN---------------------YFVRG-----KF------------------HR
A0A078TAH2      --RLDMN---------------------YFVRG-----KF------------------HR
A0A1E9CFZ7      --RLDMN---------------------YFVRG-----KF------------------HR
A0A373FYU5      --RLDMN---------------------YFVRG-----KF------------------HR
A0A3A5TZ72      --RLDMN---------------------YFVRG-----KF------------------HR
A0A3A5XBP2      --RLDMN---------------------YFVRG-----KF------------------HR
A0A3A6MEG9      --RLDMN---------------------YFVRG-----KF------------------HR
A0A3E4JP35      --RLDMN---------------------YFVRG-----KF------------------HR
A0A3E4KP40      --RLDMN---------------------YFVRG-----KF------------------HR
A0A3E4NX82      --RLDMN---------------------YFVRG-----KF------------------HR
A0A3E4XFU8      --RLDMN---------------------YFVRG-----KF------------------HR
A0A412RG70      --RLDMN---------------------YFVRG-----KF------------------HR
A0A412TD37      --RLDMN---------------------YFVRG-----KF------------------HR
A0A413GAA4      --RLDMN---------------------YFVRG-----KF------------------HR
A0A414M7I4      --RLDMN---------------------YFVRG-----KF------------------HR
A0A496BTA0      --RLDMN---------------------YFVRG-----KF------------------HR
A0A496D2V6      --RLDMN---------------------YFVRG-----KF------------------HR
A0A4Q5EN83      --RLDMN---------------------YFVRG-----KF------------------HR
A0A4Q5G1P5      --RLDMN---------------------YFVRG-----KF------------------HR
A0A5C6KCA6      --RLDMN---------------------YFVRG-----KF------------------HR
A0A5M5AHM5      --RLDMN---------------------YFVRG-----KF------------------HR
A0A641WNS6      --RLDMN---------------------YFVRG-----KF------------------HR
E5UZA2          --RLDMN---------------------YFVRG-----KF------------------HR
A0A069SMG6      --RLDMN---------------------YFVRG-----KF------------------HR
A0A1Y4PQK7      --HLDMS---------------------YYAPG-----RF------------------HD
A0A1Y4IH41      --HLDMS---------------------YYAPG-----RF------------------HD
A0A3A6AAP4      --HLDMS---------------------YYAPG-----RF------------------HD
A0A1Y4DYA7      --HLNIN---------------------YYTKG-----VF------------------YN
A0A1Y3X4I9      --HLNIN---------------------YSTDG-----TF------------------YK
A0A1Y4FNK8      --HLDIN---------------------YYTDG-----GF------------------YK
A0A355FD59      --HIDVD---------------------YQING-----PF------------------HR
A0A359CEZ9      --HIDVD---------------------YQING-----PF------------------HR
A0A353Q7B4      --HIDVD---------------------YQING-----PF------------------HR
F8X3A5          --HLDVN---------------------YQIKD-----AF------------------YK
A0A1M3KVR9      --HLDVN---------------------YQIKD-----SF------------------YK
A0A4Y9IJS3      --HLDVN---------------------YQIKD-----SF------------------YK
A0A4Q5WS95      --RLYAP---------------------VFESG-----RF------------------GD
A0A501VZX6      --KLYAP---------------------VFEEG-----KF------------------KT
A0A399SH26      --HLYAP---------------------VYEDT-----KF------------------KE
A0A501W1A9      --HLYAP---------------------IFEES-----RF------------------RT
A0A0E3ZGV6      --KLYAP---------------------VYEET-----KL------------------RS
A0A1I2N4S1      --KLYAP---------------------IYEED-----RF------------------KS
A0A2T5YE44      --KLYAP---------------------IYEED-----RF------------------KS
A0A1V9FHD0      --HLYAP---------------------VSEAADFGSLKM------------------HA
A0A4V4H170      --QLYAP---------------------VYEAPDYKQGKI------------------HA
A0A1V9F098      --QLYAP---------------------IYEAAG-NKGKI------------------KP
A0A4R2VU64      --YLYAP---------------------VYEDAG-NKGKL------------------KA
A0A4S8HY23      --HLYAP---------------------VFEAPDFKKRKI------------------NV
A0A1V9F383      --LLYAP---------------------INEGPEYSMGKF------------------NE
G8TRZ6          --HLYAP---------------------IYEGIDFSQWKF------------------NE
A0A543WA52      --ALYAP---------------------VYEDS-----DL------------------KN
A0A1M5BA90      --HLYAP---------------------IFEDG-----PI------------------VS
A0A512B879      --SLYAP---------------------VFEAT-----PI------------------AS
A0A559PPI3      --NLYAP---------------------VYEEKDFFGLNI------------------KS
A0A1T5CS78      --DLYAP---------------------IYEDG-----RI------------------KA
A0A0Q9Z8F1      --NLYAP---------------------IYEDA-----GI------------------KT
A0A2N0U0M7      --NLYAP---------------------IYEDT-----GI------------------KT
                                                                            

A0A1T5MMH4      H--ELFGNS-PILVS------------------------YKIE--------NPAFFN---
A0A2W4R1L8      Y--EFFGNL-PFTVD------------------------YTIT--------RPAFYG---
A0A2E5CV79      NTRKYYPRGEKYRRIL-----------------------KEIM--------SLGIYS---
A0A2D4ZVH1      VEFDQYGNKFPILWRA-----------------------YPVD--------STS------
A0A0K8QSK7      P--EVYTAA-PFVVE------------------------WDRS--------HPQMIG---
A0A1V6CN82      A--ENYTDA-AFRVE------------------------WDRN--------HPQLIG---
A0A1M4XZ45      A--ERYEEV-PFQVI------------------------WDED--------HPQIIN---
A0A399D319      S--ERYKEV-PFQVV------------------------WDEE--------HPQVID---
A0A1M6GR99      Y--NAYNES-PFKV-------------------------FIFK--------EHPQLV---
A0A1M6TTV4      D--ERYGNS-PFQVL------------------------YNEL--------SSELLD---
A0A4Q8RX32      E--NLYTSS-PFEVI------------------------IDKN--------HLQMTN---
K0X1U5          KK-EYYRNS-PFTVDI-----------------------PESM--------VDTLSS---
R5EXK3          KK-EYYRNS-PLTVEI-----------------------PESM--------VDTLSS---
A0A401UAP7      Y--ELYKNS-PFKVTP-----------------------IEVN--------NSYYN----
A0A1W2GF52      D--ERYGNS-PFEVQ------------------------YDLT--------NSALLD---
A0A2G5L7B8      D--ERYGNS-PFIVD------------------------VQVS--------DPSILN---
A0A523GAC0      D--EKYRSP-PFKVE------------------------YTFL--------DNWVYD---
L8JW09          D--EKFKTS-PFIVD------------------------YNLK--------NPQLLD---
A0A5C7MX19      ISEELYKNC-PFELK------------------------MDVK--------DLDILR---
A0A364XUP5      H--ELFGNT-PYHIE------------------------YKNV--------DDGLYN---
A0A1M5RLA9      D--ELFQNA-PFLVR------------------------YKAQ--------NESSFN---
A0A385SFR9      D--ELFQSA-PFVVR------------------------YKAQ--------NESSFN---
A0A5M4A9J4      K--ELYNNA-PFRIE------------------------WLSR--------HQQLVG---
A0A5M4B1C7      S--ELYHKS-PFVVK------------------------WNKG--------HPQLIG---
A0A0D3LFR6      D--EKYRSA-PFKVD------------------------YLLK--------DERFFN---
M7N6D4          D--EKYRSS-PFEVS------------------------YLVK--------DESFFN---
A0A1Q3ZMZ7      S--QIYQSS-SLGYKS-----------------------LLIK--------DSSIIG---
A0A2D8JJW3      ---LIFKYKEDKKDTV-----------------------SFLF--------NNEIID---
A0A2W2AFF7      T--PLYEDV-PFHFVF-----------------------IPLY--------EDSVSK---
A0A2N5YXE2      T--ELYGNT-PFEVN------------------------YRIN--------NTVILD---
A0A2W1NDY9      E--EKFKQS-PYHLIF-----------------------YELK--------DSSLIN---
A0A5C8AQR5      E--EMYRTS-SFNVQP-----------------------YSLN--------DSALCN---
A0A1G0CI31      E--EKYLQS-SFNVQP-----------------------FQLK--------DSSLCD---
A0A556N0M0      E--EKYHQS-TFTVLP-----------------------YALR--------DSSLCD---
F2IKD6          E--EKYHQN-TFTILP-----------------------YSLS--------DSSLCD---
A0A1I7BM74      E--ERYTQS-QFQVQL-----------------------FKLN--------EPDLYN---
A0A2G2FJ17      E--KRYKQS-TFYIKQ-----------------------SHIK--------DSSVFH---
A0A077ENE7      Y--ELYKKS-PVQVKV-----------------------EGIS--------SEGSYN---
T0NN57          Y--ELYKKS-PIYAKV-----------------------LGKR--------AEDSYS---
X5K347          Y--ELYKKS-PIYAKV-----------------------LGKR--------AEDSYS---
A0A2I0QZ80      E--QRYRQG-NLEISP-----------------------LLLK--------DSSLLN---
A0A3E1F1A3      E--TLYKQN-SVSIDP-----------------------VLLK--------DSSLFG---
A0A2U2XBJ3      E--TLYKQG-VVRIMP-----------------------LIIK--------DSSLFG---
A0A4Q4KU94      E--TLYKQG-TIRIKP-----------------------LIIK--------DSSLFG---
A0A2U1FKU2      E--SLYANS-PLSIKI-----------------------TNRD--------STEGYS---
A0A0A2F954      E--SLYGNS-PVSIQI-----------------------TDRD--------STENYS---
A0A0A2FW91      E--SLYGNS-PVSIQI-----------------------TDRD--------STENYS---
A0A2D2N2N1      E--SLYGNS-PVSIQI-----------------------TDRD--------STENYS---
Q7MWZ2          E--SLYGNS-PVSIQI-----------------------TDRD--------STENYS---
T2NDT6          E--SLYGNS-PVSIQI-----------------------TDRD--------STENYS---
W1R7P9          E--SLYGNS-PVSIQI-----------------------TDRD--------STENYS---
A0A1R4AFZ0      E--SLYGNS-PVSIQI-----------------------TDRD--------STENYS---
A0A1R4DVZ7      E--SLYGNS-PVSIQI-----------------------TDRD--------STENYS---
A0A5M4B212      S--ELYRNL-PFHVE------------------------WDRN--------HPQLLD---
A0A1T5K9D4      I--ELYRNA-PIRIF------------------------FSRE--------DNPIGY---
A0A3D1KEX9      V--TLFKHN-PIKVE--------------------------FL--------SPYFED---
A0A358Y7S2      Q--NLYRET-GFSLMV-----------------------YSLN--------DSSLCG---
A0A1X7J248      D--ERYRFT-PFTVS-------------------------YDK--------SCAAYG---
E4TQD2          E--ERYRFS-PFTVS-------------------------YEK--------SCANYD---
A0A2J6HHN3      S--ELYKSA-PFKVY------------------------YELI--------DSTFYA---
A0A1Y3WMT8      KV-EYYGNS-PITVDV-----------------------PESM--------LDTLVS---
A0A1Y4GQU1      KK-EYYGNS-PITVDV-----------------------PESM--------LDTLVS---
A0A1V5W8T5      S--ELYNKT-PFFVE------------------------YQDV--------QSAIFN---
A0A2T8HKA9      I--ELYKDS-PIRVT------------------------FTKL--------DPEAHA---
A0A3B8INU3      D--EKYKES-PFEAT------------------------ITVR--------NPAVFD---
A0A414ZBF2      R--ELYNST-PFTVV------------------------FQDA--------EPGQEI---
A0A1Q3Q573      ITEDLYQSA-PFEIL------------------------PEQI--------APEFYG---
A0A662BAY3      R--EIYKES-PFEVI------------------------WDYE--------HPQLIY---
A0A4U3L369      I--ETFEKT-PYSVHL-----------------------VAMR--------DSIA-----
A0A357YNR3      N--SLYGNESPVLVR------------------------MSDK--------DLNNLI---
A0A5E8AX52      E--ERYRNS-PFVVS------------------------YKLH--------NTGFFD---
F4KK08          K--DLYKQS-PVSIRF-----------------------VNAD--------PDEKIS---
A0A496LCF9      V--PLYGRS-PISIEI-----------------------INIY--------EEGYYM---
A0A5P2G2A9      R--ELYKDK-PFGIT------------------------LSNN--------ADPIKG---
A0A419VXB7      F--ILYGNE-PCHVE------------------------FEPD--------AFNLKG---
C3J7R8          E--MLYKDT-PLEVRF-----------------------VGNS--------SDVYCK---
A0A0B0BTJ4      S--YLTAESSPLKLT---------------------------A--------DTIRYT---
A0A3B9CNN6      S--YLTAESSPLKLT---------------------------A--------DTIRYT---
R5X290          S--YLTAESSPLKLT---------------------------A--------DTIRYT---
A0A1Q6E6I7      S--YLTAESSPLKLT---------------------------A--------DTIRYT---
A0A1G8BVM8      K--DLYTSS-PIEVE------------------------YMDD--------VAKQGM---
A0A2G2F510      E--EKYLSS-SYYIQP-----------------------YELY--------DSTLIN---
A0A316JZ08      E--ELYLAS-SFNIQP-----------------------YELV--------DSTLIG---
A0A1I1FXP9      S--EMYKSS-PFRVE------------------------YEVK--------NPAFYD---
A0A3N4H5N3      K--EISPFSLPVEIEV-----------------------HEIN--------NDFVGG---
A0A2P8EAX2      R--EISPYNVSINIVV-----------------------HEFN--------EEFLLE---
A0A4V2F6N9      K--ELSPYNVPVNLIV-----------------------HEFN--------EEFLSG---
A0A3B9FXJ0      T--DMYYNG-PFWVD------------------------IDVQ--------DSTVLG---
R5GSU5          S--TLYKKR-PFEAT------------------------FLRP--------AEIDED---
A0A2A3UE91      N--ELYDSS-PYLIK------------------------INAK--------KGTVYG---
A0A0A2G557      K--KLYKET-PIRLT-------------------------LLN--------TSDTLS---
A0A2N2WFW8      F--ELYDGA-PFHIQ------------------------YQIV--------DSLSYG---
A0A1F3IU95      F--ELYDDV-PFDIK------------------------YEIV--------DSTFYG---
A0A3D0VUF6      F--ELYDDV-PFDIK------------------------YEIV--------DSTFYG---
A0A1T4PT95      K--KLYKDS-PIHLTL-----------------------LEFP--------ED--HS---
A0A4P5TMD1      E--ERYKTS-PFEIV------------------------PTVN--------EPALYD---
A0A651GU15      R--QLYRVP-QPKLNL-----------------------VAIT--------DSSILD---
A0A3Q9FR88      S--ELFGDAVPFTFEY-----------------------PNNV--------QPTLKD---
A0A553GEX3      S--ELFGDAVPFTFEY-----------------------PNNI--------QPALKD---
A0A150ADJ9      S--ELFGKNLPFSITF-----------------------PSGK--------LPFLQD---
A0A1B1FWQ4      S--ELFEDGVPFTLTY-----------------------PSGK--------QPALKN---
A0A1S1Z228      S--ELFGDGVPFTLTY-----------------------PSGK--------QPAFKD---
A0A2A4PYG9      S--EIYTAS-PYTVE------------------------VRNV--------GPGLLG---
A0A1F3K695      N--ELYRMS-PFTVE------------------------ANIL--------DSRIYE---
A0A353KZR1      N--ELYRMS-PFTVE------------------------ANIL--------DSRIYE---
A0A2N2WYB5      T--ELYKRS-PFKVE------------------------WKTL--------NPSIFN---
A0A1F3K4G0      T--ELYRRS-PFQIE------------------------WKMI--------TGKLYD---
A0A356H8Y3      T--ELYRRS-PFQIE------------------------WKMI--------TGKLYD---
A0A351HSA6      T--ELYRRS-PFQIE------------------------WKMI--------TGKLYD---
A0A1F3Q014      N--ELYTSS-PYSVD------------------------YKII--------NPKISG---
A0A2A4YXP3      N--ELYRSS-PIKVE------------------------HQVK--------DSSILG---
A0A2D5KD44      N--EIYKNA-PFNVE------------------------VLYK--------EPSLSS---
A0A1F3R158      F--ELYKNS-PINIE------------------------YYIK--------DSSVIG---
A0A2M8ADX2      F--ELYKNS-PLDVN------------------------YDIK--------DSSIIG---
A0A1J5B2H0      F--ELYKSS-PFEIK------------------------YSIK--------NPAIYG---
A0A1V5N756      T--EMYRSN-HYNVH------------------------YVVK--------KPVIYN---
A0A1F3SJM1      E--EKYLSS-SFHVQP-----------------------YELR--------DSSLVY---
A0A2G2EB96      E--EKYLSS-AFNIQP-----------------------YQLS--------DSSLIN---
A0A2G6PRA9      E--EKYLSS-SFNIQP-----------------------YELS--------DSSIIN---
A1ZKR2          A--EYYKNP-PFKVID-----------------------HQVK--------SDAFLD---
A0A1Q3GX01      A--EYYTNA-PFKVVD-----------------------YKIK--------APVYYD---
A0A349DQI4      A--EYYTNA-PFKVVD-----------------------YKIK--------TPGYYD---
A0A2N3IIZ0      N--EMHGFS-PIEVQ------------------------AVVL--------NENLYN---
A0A497D5Z2      S--EMYRNP-PFRVQ------------------------WEEG--------HPQVIN---
A0A662B170      S--EMYRNP-PFRVQ------------------------WEEG--------HPQVIN---
A0A2A5FYT6      T--ENYANH-PYSVG------------------------FQVK--------DSSIFG---
A0A2E6SYP1      T--ENYRSS-KYKIS------------------------YQIK--------DKSVLN---
A0A2E5RLE8      T--ENYHSN-PFSIS------------------------YQLK--------KREAVK---
A0A2E7TQF6      T--ENYHSN-PFSIS------------------------YQLK--------KREAVK---
A0A2E6GVY9      T--ENYQSN-PFSIS------------------------YQLK--------KRKAVN---
A0A350JJ90      H--ERYLSS-DFEVI------------------------YEIH--------DPIILD---
A0A3M1CDV2      H--ELYKNS-PYLAD------------------------INIK--------NENIYG---
A0A522EYA6      N--EHYGTT-VYTAE------------------------TEVK--------SDIIYG---
A0A4P5U6G4      E--EKYKSS-PFEIL------------------------PLVK--------TNSIYD---
A0A2E2TFD1      Y--ELYMSS-PYIVD------------------------YDII--------SAEAFA---
A0A2E4ELE6      F--EHYKSC-PFEVK------------------------FEIK--------SPEAFG---
A0A2E3XZI5      R--LLYKKN-TYKLEN-----------------------FYIK--------DSSIIS---
A0A2M7NLQ9      NYFERFQDS-PFEVTE-----------------------YEVY--------DASFYN---
I4AFR0          NYFERFQDS-PFEVTD-----------------------YEVY--------DNSFYN---
A0A2N2Y3E5      T--EQYRNS-PFTVV------------------------FRNE--------GFKHFD---
A0A2D9D7T6      K--DLYRSN-LVSVEP-----------------------VKLL--------DSTLCG---
A0A1F3PPL5      N--EMYKSS-PFEVK------------------------VKIN--------NGAIYD---
A0A357QK06      N--EMYKSS-PFEVK------------------------VKIN--------NGAIYD---
A0A662AEA4      T--ELYRTS-PFIVK------------------------TKIK--------NPSIYN---
A0A0S2HYK8      D--EIYQSS-PFEIQ------------------------YKIK--------DSKAFG---
A0A2N5ZWN6      T--ETYNNS-SYSVN------------------------YEIQ--------NPSIYG---
A0A0F2NS19      Y--ELYKNS-PFKVF------------------------FEVK--------DSSVLG---
A0A2A5H8X6      Y--ELYKNS-PFKVF------------------------FEVK--------DSSVLG---
A0A2H0GAU8      N--ELYVGS-PMKVN------------------------YAIK--------DSSIVG---
A0A2M8FTK1      N--ELYVGS-PMKVN------------------------YAIK--------DSSIVG---
A0A2A5B3B0      N--ELYRST-PIKVS------------------------YVIK--------DSTILG---
A0A5C6RXM7      H--ELYKSA-PIDVE------------------------FNIK--------DSSIIN---
A0A2E0FJ09      H--EKYNGS-LFLVED-----------------------FQLL--------NSSLVN---
A0A1F3FZ62      F--DVYRNT-PFIIE------------------------QKVF--------NPSIYG---
A0A1F3K211      F--DVYRNT-PFIIE------------------------QKVF--------NPSIYG---
A0A1F3KLL5      T--ETYRTS-SYIIEV-----------------------RNVE--------PE-MYN---
A0A359D1M1      T--ETYRTS-SYIIEV-----------------------RNVE--------PE-MYN---
A0A2E7CT70      S--DLYKTS-PFEIKD-----------------------LKIR--------DSIIIG---
A0A2D5V560      R--FLYNQS-PXSFEN-----------------------FSIK--------DMSIIS---
A0A2D7K5A8      R--FLYNQS-PFIFEN-----------------------FSVK--------DESILS---
A0A2E1XQ82      R--FLYNQS-PFIFEN-----------------------FSVK--------DESIFS---
A0A1V6I2U9      T--ELYGST-PFEIK------------------------YNII--------NTEIYD---
A0A1F3C1M2      N--ELYKNA-PFTIE------------------------FNIK--------NNIVYD---
A0A1F3DS87      N--ELYKNE-PFSIE------------------------FNIK--------NNIIYD---
A0A2H0B957      S--ELYKAT-PFTVD------------------------FHIT--------KGNLYN---
A0A1F3CFW6      N--ELYKAN-PFSID------------------------YKNT--------KRNLYN---
A0A2M7E2T8      N--ELYKAN-PFSID------------------------YKNT--------KRNLYN---
A0A2M7NC69      N--ELYKAN-PFSID------------------------YKNT--------KRNLYN---
A0A5C8A5B4      Q--EQYAYP-PFFVKL--------------------------------------------
A0A4Y9ITE2      K--LKYDNT-PVEIVI--------------------------------------------
A0A5M8NYX7      E--L-YNQT-PLWVIL--------------------------------------------
A0A3D5KRY6      D--L-YKND-PLTLVL--------------------------------------------
A0A1V5IPN7      ------------------------------------------------------------
A0A0E3V905      E--I-YTDS-PIELIV--------------------------------------------
A0A553ETH6      E--K-YQNS-PFRVKF--------------------------------------------
A0A640Q161      ------------------------------------------------------------
A0A640QU49      ------------------------------------------------------------
A0A1Q3PII2      E--L-YEKT-PYKITL--------------------------------------------
A0A351BXT2      ------------------------------------------------------------
A0A2K8Z965      E--L-YEDS-PIELII--------------------------------------------
A0A418M8U8      E--I-YKAS-PVDVFV--------------------------------------------
I2GTA4          E--I-YKAS-PVEVFI--------------------------------------------
A0A2K8ZAJ2      H--I-YQES-PIRLIV--------------------------------------------
A0A368JPA3      E--I-YEEA-PIRIVL--------------------------------------------
A0A5N1JI29      E--I-YEEA-PIRIVL--------------------------------------------
A0A3P1BT12      E--I-YDDA-PLRIIL--------------------------------------------
A0A3P1CI15      E--I-YEEA-PIRLVL--------------------------------------------
A0A4R8CUK1      E--I-YDNT-PVRLVL--------------------------------------------
A0A3D0MYJ7      -------------LDT--------------------------------------------
A0A662AH13      -------------IDS--------------------------------------------
A0A5C7QA01      N--L-KSLH-IKQFDL--------------------------------------------
A0A3D3LS70      -------------IDS--------------------------------------------
A0A1G1TM36      D--L-YGKS-PVQLTF--------------------------------------------
A0A1G7ZF38      E--L-YDKT-PYKVRF--------------------------------------------
C6VS52          E--L-YEKA-PYRVRF--------------------------------------------
A0A0P7X1V8      -----------YPVIW--------------------------------------------
A0A3B0C2S4      T--EIWNPPFAITKLI-----------------------AEDS--------IGQPRVYDI
L8JI02          E--EKYGDF-PFIVE------------------------LDST--------ISQMID---
A6EBM4          T--DLYPQQ-PLQIDI-----------------------LKID--------SLQSGR---
A0A416GA42      T--DLYGVS-PVTVHF-----------------------VQGD----------DLAC---
A0A4R5DL69      A--EIYDKS-PVILHLID---------------------PKSD--------QIKRTE---
A0A1T3IYP5      Y--ELYKKS-PVHVKI-----------------------EGKT----------QESS---
A0A1M4YED3      R--SAYNTS-PVKVIAQ----------------------NPAD--------LKRTEE---
A0A3P1Z8V4      V--ALYRDR-PFTVHF------------------------DRP----------SKRY---
A0A2N3U785      E--EIYGSSLPIKVV------------------------VSDL--------KQPAFG---
A0A0E3ZG78      I--EIYGSEVPIKVL------------------------VNDL--------APPAYR---
A0A1I6BRK6      R--EIYGEALPFRIV------------------------RNGL--------DSTMTG---
A0A243WAB1      R--EIYGRELPAKLL------------------------IDKL--------DSTAIG---
A0A126PFG0      R--DLYGRS-PVQFTLV----------------------PTHS----------VPRQHVL
A0A3M1N7Z3      R--SLVFPH-PFQISF--------------------------S----------SPRAESL
A0A2H3NSN0      A--DTTDT--PFQLFA-----------------------AVDD-----------------
A0A2P6C324      A--DTTQGV-QFTLLA-----------------------PVSE-----------------
A0A1M6XHU0      A--ETAGAKERFPILA-----------------------PTED-----------------
A0A5S9C8G0      V--ETAGAKDRFPILA-----------------------PTED-----------------
G2SF81          A--ETAGAKDRFPILA-----------------------PTED-----------------
A0A5S9EYW1      A--ETAGAKDRFPILA-----------------------PTED-----------------
D0MHQ9          A--ETAGAKDRFPILA-----------------------PAED-----------------
A0A4D7K1D4      E--ERYRNK-PFRVDYQ----------------------VKSA----------DLHN---
A0A3C1ITV0      T--DWYDKT-PICVEYKNLPDH-----------------VGEQ----------PLNS---
R7HN19          T--DWYDKT-PICVEYKNLPDH-----------------VGEQ----------PLNS---
A0A060RD97      L--DIYGEETPIVVKN-----------------------VAES--------EQSNNP---
A0A0D3L8Q3      P--ELYGNKLPFRVVTN----------------------KLDS----------LAYG---
A0A5B6TJH8      I--EIYGKELPIKLVVE----------------------SLHN----------SGYN---
A0A519U664      K--EIYGQSVPIKVLRS----------------------NVDS----------TAAG---
A0A519UDD1      I--EQYGRNLPIKVLLT----------------------TADS----------TAAG---
A0A519MA34      K--EIYGQSVPIKVLRN----------------------NVDS----------TAAG---
A0A519UCX0      K--EIYGQSVPIKVLRN----------------------NMDS----------TAAG---
R7PCR1          I--SLFSIR-PFNVVFQAP--------------------FSKA-----------------
A0A350IHV0      R--ELFTSS-PIALVQ-----------------------TGDN----------HASA---
A0A1G9E2A9      S--EAYHDS-PFRVEYK----------------------LKSG----------AIQD---
A0A098LL25      E--ERYNNS-PFKVIGE----------------------IKHP----------DFLD---
A0A2T2YJE8      E--ELYKNS-PFKITYQ----------------------LTNE----------AYYD---
A0A127B287      V--ELYKDS-PFKVAFD----------------------SSRF----------DLYD---
A0A3M9N829      A--ELYKDS-PFAVNYD----------------------TSAF----------DLFD---
A0A0P0CSF9      A--ELYKDS-PFQVSYD----------------------NESF----------NLYD---
A0A5M8QQB8      A--ELYKDS-PFEVLYD----------------------SVDF----------NLYD---
A0A3M9MNC3      A--ELYKSS-PFEVVYD----------------------STNF----------SLFD---
A0A5B6TAX2      A--ELYKDS-PFEVSYD----------------------STNF----------DVYD---
A0A5N1IQ33      S--EVYKTS-PFRVEYR----------------------IKDN----------SFYN---
A0A512AYT3      E--ELYKNS-PFKVIYE----------------------IKDD----------GFYN---
A0A5M6CYN7      E--ELYNNS-PFKITYD----------------------IKDG----------RFYN---
A0A369QP10      E--ELYRSS-PFHISYE----------------------MSNE----------AYYN---
A0A126PDF2      S--ELYGIS-PFQIAYT----------------------IKDK----------DLYN---
A0A2Z3GKA1      S--ELYGIS-PFRIAYT----------------------IKDK----------ELYN---
A0A502GZP7      S--ELYGNS-PFHIAYV----------------------VRDK----------ELYN---
A0A519SBU8      T--EMYNTS-PFHVRYK----------------------VSDP----------QFYS---
A0A4Q3JNZ3      A--ELYNST-PFHVQYK----------------------ITDP----------ELYS---
A0A519Q9V3      A--ELYNSA-PFHVKYK----------------------IADQ----------GLYN---
A0A0M3RW20      S--ELYKAS-PFHIEYA----------------------IKDP----------GYYG---
A0A495VFX4      S--ELYKTS-PFHVEYY----------------------ITNL----------NLYG---
A0A1S9B3W0      T--ELYGVS-PFHVTYT----------------------VREP----------SQFN---
A0A1W1VRL3      S--ELYTRS-PFQVTYK----------------------IKNP----------AFYN---
A0A1M6R305      T--ELYGVS-PFRVDYE------------------------GD----------ILYN---
A0A4Z0PHK3      N--ELYGVS-PFNVEYK----------------------IKDP----------SFYN---
A0A2M9B9H9      N--ELYGIS-PFKVSYD----------------------IKDP----------NFYN---
A0A4Z0QCY9      T--ELYGIS-PFKVSYT----------------------IKDP----------NYYN---
A0A418R9X5      S--ELYSLS-PVRIEYK----------------------AGKG----------AMFN---
A0A428JSJ3      S--ELYNLS-PVRVEYT----------------------ANKG----------AAFN---
A0A428KI59      S--ELYNLS-PVRVEYK----------------------AGKG----------AMFN---
W8F1I6          S--ELYNLS-PIRVEYK----------------------AGKG----------ALFN---
A0A246FQC0      S--ELYASS-PFIVKYK----------------------PINN----------AVFD---
A0A372E5P8      T--EIYGAS-PFEVSYE----------------------ATAN----------AAFD---
A0A1H3EMW1      T--EIYGIS-PFEVSYQ----------------------ATAD----------ATFD---
A0A1H9ZSN3      T--EIYGSS-PFEVSYE----------------------ALAD----------AAFD---
A0A5N1J2M4      Q--EVYTDS-PFNLIFK----------------------VNNP----------ELYD---
A0A519S476      S--ELYNNA-PFHVRYK----------------------IADA----------ELYG---
A0A4Q3JRW8      A--ELYNNS-PFYVRYK----------------------ITDN----------ELYN---
A0A519M923      A--ELYSNS-PFRIEYK----------------------VTDN----------ELYG---
A0A4Z0ENW1      N--ELFGSC-PYQVKYT----------------------ISDP----------VYYN---
A0A519UDB4      T--ELFGNS-PFKVIYT----------------------ISDV----------SYYN---
A0A3S0QKV1      T--ELYGNS-PFRVEYT----------------------VREP----------IQFN---
A0A328BL48      T--ELYRTA-PFRVEYA----------------------VREP----------LQFG---
A0A5R8WLY4      T--ELYRTA-PFRVEYT----------------------VREP----------LQFG---
A0A1I5WSL8      A--ELYGTS-PFKVIYK----------------------ITDP----------SLYN---
A0A0U3JVM7      S--ELYGIA-PFRVKYH----------------------ITDP----------SLYN---
A0A1G1SSV2      S--ELYGTS-PFRVKYN----------------------ITDP----------SLYN---
A0A1G1SXV7      S--ELYRTS-PFRVKYS----------------------ITDP----------SLYN---
A0A0W8EDI5      S--ELYNAT-PFRIDYD----------------------PADQ----------ILYN---
A0A3B7RBP8      N--ELYTDT-PFRVQYS----------------------TKDG----------FLFN---
A0A3R9P8H7      T--EMYNTS-PFKVVYT----------------------PTDD----------AAYD---
A0A238WIA7      T--ELYKTS-PFKVEYE----------------------SKNG----------SLFN---
A0A212UCJ7      T--ELYRAS-PFKVEYQ----------------------TKGG----------GQYN---
A0A4Z0MQE1      T--ELYRAA-PFKVEYE----------------------VRAG--------GAGQFN---
A0A4Z0PCF4      T--ELYRTS-PFKVDYE----------------------TKAG--------GAGQLN---
A0A5D6VDG1      S--ELYGIS-PFQVNYT----------------------ITDP----------SLYN---
A0A243WHR7      N--ELYGLS-PFKVNYK----------------------IKDG----------SLYN---
A0A5B8A0P6      S--ELYGNS-PFKVEYN----------------------IKNG----------VFYN---
A0A076HRT9      S--ELYGTS-PFRVQY------------------------DGE----------VLYN---
A0A4Z0PVM7      N--ELYGVS-PFKVAYI----------------------IKDP----------NFYN---
A0A1M6DHW8      N--ELYGTS-PFEVEYR----------------------IKDA----------SLYN---
A0A4Q5LC61      N--ELYGTS-PFKVEYN----------------------IKDP----------GLYN---
A0A2A8CVM9      ----------KFPLLY-----------------------GEDG----------QARS---
A0A3C0ZQC7      -------SE-RILIIWD----------------------RAES----------GP-----
A0A2E3R1D0      -------NR-PLPILRD----------------------DDPS----------TP-----
A0A2T2USC0      -------GE-QLSVLTGPKDPSDTSEQSASETVAGLLMSPEEE----------RR-----
A0A2T2V0F3      -------GE-PLAVLTG----------------------PEGE----------RR-----
A0A2T2S682      -------GK-PLDVLTT----------------------PSGE----------GR-----
D5H561          G--VSPFGR-LMDRAWA----------------------WAGQ----------GTGG---
A0A2H3NWA9      -------EG-PPIMYTA----------------------ETQE----------RL-----
A0A2A8CVB6      -------GR-PIQMLSD----------------------VEGN----------RL-----
A0A2P6C1S6      -------GQ-PLQILRG----------------------PEGE----------QR-----
A0A2T2UTM4      -------GE-PLQILRG----------------------PEGK----------RR-----
R5RVP0          R--EKFTDS-PIALVL-----------------------AGDN----------NASA---
R6A0L2          I--TLYGKELPFQVLF-----------------------QKQY----------KGKRG--
R7LG80          V--ALYKNERPIEVLF-----------------------HDSL----------PSENPIP
A0A2L2WX98      V--SLYRNR-PFRIEF-----------------------SSEC----------QRPE---
A0A285T4L1      N--ELYNQS-PINVSF-----------------------INVM----------PERY---
G5GD56          V--ALYTDR-PFEIAF-----------------------QQKA----------E-NL---
R5KD55          K--TLYGKTLPVKVVF-----------------------RDIP----------KDET---
A0A174QNT3      D--HIFGEL-PFEINF-----------------------LDNY----------P-GY---
A0A4S2FGS1      D--NLFGDL-PFEVRF-----------------------LDIC----------P-GF---
R9I0H0          D--NLFGDL-PFEVRF-----------------------LDIY----------P-GF---
K5BUT9          T--PLYAES-PVDVHF-----------------------IDPY----------N-QP---
A0A174FPA3      A--PLYAES-PVEVHF-----------------------IDPY----------N-QP---
R6S9Y6          A--PLYAES-PVEVHF-----------------------IDPY----------N-QP---
A0A642LIH6      A--PLYAES-PVEVHF-----------------------IDPY----------N-QP---
C9KX15          A--PLYAES-PVEVHF-----------------------IDPY----------N-QP---
R6DAG6          T--SLYAES-PVEVNF-----------------------IDPY----------H-DY---
A0A3L8AAP1      T--SLYAES-PVEVNF-----------------------IDPY----------H-AY---
A0A4S2AYX2      T--SLYAES-PVEVNF-----------------------IDPY----------H-AY---
A0A4Y9H477      T--SLYAES-PVEVNF-----------------------IDPY----------H-AY---
A0A0E2M2Y7      E--SLYGKS-PVSIRI-----------------------TDRD----------STES---
A0A0K2J6Z0      E--SLYGKS-PVSIRI-----------------------TDRD----------STES---
B2RKZ8          E--SLYGKS-PVSIRI-----------------------TDRD----------STES---
A0A212GC82      E--SLYGKS-PVSIRI-----------------------TDRD----------STES---
A0A254MU12      E--SLYGKS-PVSIRI-----------------------TDRD----------STES---
R6CQ93          N--ELYNLS-PVQVSF-----------------------FNVL----------PERY---
A0A3D1NQW3      Q--DLYGQS-PIAVEF-----------------------INDN----------DRQG---
B0MT10          Q--DLYGQS-PIAVEF-----------------------INDN----------DRQG---
R7JGW9          Q--DLYGQS-PIAVEF-----------------------INDN----------DRQG---
A0A414Q925      K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
A0A415PUS9      K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
A0A108TCU0      K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
A0A413BA42      K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
S3Y344          K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
A0A4Q5G8Y8      K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
A0A412TGL3      K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
A0A413VJ33      K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
A0A414L0W6      K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
A0A412DP39      K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
A0A413ZSE8      K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
B0NP84          K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
R6AK43          K--ELYTST-PFAVTF-----------------------LDAT----------PSQQ---
A0A412N2D9      K--ELYTST-PFTVNF-----------------------LDAD----------PAQK---
A0A1Y4JYS9      K--ELYTST-PFTVNF-----------------------LDAD----------PAQK---
R6LHA4          K--ELYTST-PFTVNF-----------------------LDAD----------PAQK---
A0A3D2BF46      E--NLYRRS-PIDVTF-----------------------IDDN----------ERQA---
A0A4Y1WUN1      E--NLYRRS-PIDVTF-----------------------IDDN----------ERQA---
A0A4Y1XL94      E--NLYRRS-PIDVTF-----------------------IDDN----------ERQA---
A0A358R538      R--DLYGQS-PLRVRF-----------------------IDET----------EDLS---
A0A1Y4AAB8      Q--DLYGRS-PIEADF-----------------------VDEG----------ENQS---
A0A1Y3WWY9      R--DLYGQS-PIDVDF-----------------------INGD----------DNQS---
A0A1Y4U5L4      R--DLYGQS-PIDVDF-----------------------INGD----------DNQT---
A0A1Y3VCJ1      R--DLYGQS-PVEVVF-----------------------VNDN----------DNLT---
A0A1Y3QTW7      L--DLYGRS-PIEVDF-----------------------IDDD----------N-QR---
R6XWY7          L--DLYGRS-PIEVDF-----------------------IDDD----------N-QR---
A0A4Y1X9Y9      L--DLYGRS-PIEVDF-----------------------IDDD----------N-QR---
A0A4Y1WM66      L--DLYGRS-PIEVDF-----------------------IDDD----------N-QR---
A0A174AVF1      L--DLYGRS-PIEVDF-----------------------IDDD----------N-QR---
A0A656Q4F4      L--DLYGRS-PIEVDF-----------------------IDDD----------N-QR---
A0A1Q6EIY0      A--DLYGRS-PIEVDF-----------------------INDN----------SKQK---
A0A5B5VN71      A--DLYGRS-PIEVDF-----------------------INDN----------SKQK---
E4M8L3          A--DLYGRS-PIEVDF-----------------------INDN----------SKQK---
I3YQ50          A--DLYGRS-PIEVDF-----------------------INDN----------SKQK---
R5UEY8          A--DLYGRS-PIEVDF-----------------------INDN----------SKQK---
A0A1H4D866      R--DLYAQS-PVEVTF-----------------------VNDS----------DNQS---
A0A5B3G4Y7      R--DLYGQA-PIDVKF-----------------------INDN----------DNQS---
A0A374A9J5      R--DLYGQA-PIDVKF-----------------------INDN----------DNQS---
A0A5B3GQN5      R--DLYGQA-PIDVKF-----------------------INDN----------DNQS---
A0A1Q6E9S3      R--DLYGQA-PIDVKF-----------------------INDN----------DNQS---
D4IJ36          R--DLYGQA-PIDVKF-----------------------INDN----------DNQS---
A0A3E5HPT8      R--ELYTDS-PVRVAF-----------------------LEAG----------LDEV---
C6IJ48          R--ELYTDS-PVRVAF-----------------------LEAG----------LDEV---
Q8A3U2          R--ELYTDS-PVRVAF-----------------------LEAG----------LDEV---
A0A3R6S1H6      I--ELYKES-PVVLRF-----------------------PDAE----------ETSS---
A0A3R6SD81      L--ELYKES-PVVLRF-----------------------PDAE----------ETSS---
A0A354WXN6      V--DLYTQS-PINLTF-----------------------PEAE----------GEQV---
R5IP14          R--SLYKDS-PLAVSF-----------------------ITKD----------NNSQ---
A0A316SZX7      I--DLYRNT-PIEVSF-----------------------VDDD----------DKSY---
A0A1Y4AIY1      V--ELYRQS-PVILSF-----------------------PDAS----------ETQS---
F3ZRU7          K--DLYGNN-PFEVVF-----------------------LEAS----------TEQP---
A0A0J6CIR2      E--ELYTQS-PIAVRF-----------------------PEAE----------ASQS---
A0A3D8HG59      T--ELYTQS-PVHLEF-----------------------PDAE----------PNQQ---
A0A3R6S408      T--ELYTQS-PVHLEF-----------------------PDAE----------PNQQ---
A0A1C5Q1F3      W--DLYTTS-PVTLTF-----------------------PEAL----------ETSS---
R7A239          W--DLYTTS-PVTLTF-----------------------PEAL----------ETSS---
A0A3R6HIK7      V--ELYTHS-PVVLSF-----------------------PETE----------ESQS---
K5ZVW7          V--ELYTHS-PVVLSF-----------------------PETE----------ESQS---
A0A1Y4D5Z0      V--ELYRES-PVVLSF-----------------------PEAG----------EGQS---
A0A413VXJ7      K--ELYTHS-PIILSF-----------------------PEAE----------ERQS---
I9RSN9          K--ELYTHS-PIILSF-----------------------PEAE----------ERQS---
U6RJK5          K--ELYTHS-PIILSF-----------------------PEAE----------ERQS---
A0A1Q6GA32      K--ELYTHS-PIILSF-----------------------PEAE----------ERQS---
I9RPU6          D--ELYTHA-PVTVSF-----------------------PEAE----------ERQV---
I8YFS5          D--ELYTHS-PITVLF-----------------------PESE----------ERQV---
A0A4Q5F7I7      D--ELYTHS-PITVLF-----------------------PESE----------ERQV---
I8Y597          D--ELYTHS-PITVLF-----------------------PESE----------ERQV---
A0A1Q6GBF5      D--ELYTHT-PVTVSF-----------------------PEAE----------ERQV---
I8YFZ3          D--ELYTHA-PVTVSF-----------------------PEAE----------ERQV---
A0A4V1YNX8      D--ELYTHA-PVTVSF-----------------------PEAE----------ERQV---
A0A1Q6GDH2      D--ELYTHA-PVTVSF-----------------------PEAE----------ERQI---
U6RSB0          D--ELYTHA-PVTVSF-----------------------PEAE----------ERQV---
I9GXM2          D--ELYTHA-PVTVSF-----------------------PEAE----------ERQI---
I9SIK1          D--ELYTHA-PVTVSF-----------------------PEAE----------ERQV---
A0A4Q5FNG1      D--ELYTHA-PVTVSF-----------------------PEAE----------ERQV---
I9TP59          D--ELYTHA-PVTVSF-----------------------PEAE----------ERQV---
R5S343          V--DLYGIS-PIRVRF-----------------------LDRG----------EDEA---
A0A1M6K7I9      I--ELYTQS-PIKVAF-----------------------PDAE----------DNQY---
A0A5M6A8C8      I--ELYTQS-PIKVAF-----------------------LDAE----------DNQY---
A0A4V1YPN7      D--ELYTHS-PIVVVF-----------------------PESE----------ERQV---
A0A4Q5F874      D--ELYTHS-PITVSF-----------------------PESE----------ERQV---
A0A641LV22      D--ELYTHS-PITVSF-----------------------PESE----------ERQV---
A0A3R5ZMK1      V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A0A3E4ZTK7      V--ELYTQS-PVLLSF-----------------------PDAE----------EAQA---
A0A1Y3ZIA4      V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
K5Y1A4          V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A0A4Q5CIT0      V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A0A3R6K8X4      V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A0A414GI87      V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A0A415BDM7      V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A0A412DM15      V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A7AEU7          V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A0A1Q6I3T6      V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A0A414XX40      V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A0A3R6BKI7      V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A0A414LPI6      V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A0A412M2W1      V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
K5ZX55          V--ELYTQS-PVQLSF-----------------------PDAE----------EAQA---
A0A5F0U645      V--ELYSHS-PVVVRF-----------------------PEAN----------ENLE---
K5ZBN2          V--ELYSHS-PVVVRF-----------------------PEAN----------ENLE---
A0A0J6CKW3      V--ELYSHS-PVVVRF-----------------------PEAN----------ENLE---
A0A0F5IQM7      V--ELYSHS-PVVVRF-----------------------PEAN----------ESLE---
A0A496CDT3      V--ELYSHS-PVVVRF-----------------------PEAN----------ENLE---
S0GLB0          V--ELYSHS-PVVVRF-----------------------PEAN----------ENLE---
A0A3R6NLC1      V--ELYSHS-PVVVRF-----------------------PEIN----------ENLE---
A0A416WYC9      V--ELYSHS-PVVVRF-----------------------PEIN----------ENLE---
A0A0F5IT40      E--ELYTQS-PIAVRF-----------------------PEAE----------ASQS---
A0A496CX20      E--ELYTQS-PIAVRF-----------------------PEAE----------ASQS---
A0A5F0UBI0      E--ELYTQS-PIAVRF-----------------------PEAE----------ASQS---
S0GSI7          E--ELYTQS-PIAVRF-----------------------PEAE----------ASQS---
K5YB65          E--ELYTQS-PIAVRF-----------------------PEAE----------ASQS---
A0A0F5IWP9      V--ELYTQS-PIAVQF-----------------------PEAE----------ATQA---
A0A0F5IZT8      V--ELYTQS-PIAVQF-----------------------PEAE----------ATQA---
A0A417LKQ2      V--ELYTQS-PVAVQF-----------------------PETE----------AVQA---
A0A416TME1      V--ELYTQS-PVAVQF-----------------------PEAE----------ATQA---
A0A416XPE8      V--ELYTQS-PVAVQF-----------------------PEAE----------ATQA---
A0A5C8KAD6      T--NAYTSS-PIRIKL-----------------------K--N----PEDIKQTVQV---
A0A5N1J695      I--PAYASS-PVIIKV-----------------------K--N----PERISEVPQV---
A0A1H4ADG3      K--PLYKKSLPFTTSI-----------------------TGFS----TDNLDPSQLS---
A0A5B8VUR8      E--PLYKESLPFKISI-----------------------EGFT----TDNLDPKQLR---
A0A2A4G4B1      T--ELFLDK-PFKLEW-----------------------LSP---------INDSYT---
A0A3N2M1H3      V--TLYGHTLPYIVDM-----------------------QGIE--------EQGGAS---
A0A4S2G8T2      V--TLYGHTLPYIVDM-----------------------QGIE--------EQGGAS---
A0A212K7W5      K--PLYKNS-PVIVSI-----------------------DSTN--------VNESFS---
F5IU11          R--SLYKNS-PVIVST-----------------------GPVN--------VNESFS---
A0A3N2N6F7      V--SLYGDSMVLSVSL-----------------------PDIS--------VNRGLR---
A0A4P7VVU7      I--TLYGDSCPVSVDF-----------------------LSIP--------SKQSAS---
A0A2V1ILM4      I--TLYGDSCPVSVNF-----------------------LSIP--------SKQSAS---
A0A3N2L0E8      I--TLYGDSCPVSVDF-----------------------LSIP--------SKQSAS---
A0A3N2LFC5      I--TLYGDSCPVSVDF-----------------------LSIP--------SKQSAS---
A0A553LCN8      T--SLFAES-PVEVTF-----------------------FD-P--------YHSFVS---
K0XJ09          D--QLYAES-PIRVNF-----------------------LD-A--------YTAPVS---
R5EUZ0          D--QLYAES-PIRVNF-----------------------LD-A--------YTAPVS---
W0EQS0          K--SLYAES-PIRVNF-----------------------ID-P--------YTAPVF---
A0A1Y3WE15      K--QLYAES-PIRVDF-----------------------LD-D--------YTAPVS---
A0A1Y4GUK3      K--QLYAES-PLRAHF-----------------------LD-A--------YTLPVS---
A0A352Z1R7      F--KLLDFS---------------------------------S--------TAKTPS---
A0A0A2F501      E--VLYGQELPYRVKF-----------------------LGLK--------DTDNAS---
R5B7P0          N--VLYGTSLPISADL-----------------------LDVD--------ENVGVG---
R5B0L5          D--LLYGSSLPIDVDF-----------------------STLA--------DGESGS---
A0A374THP7      E--ALYGGDLPVTVDF-----------------------IGFT--------DDQSGS---
A0A3R5XWG1      N--VLYGNDLPVTVQF-----------------------LTIG--------EEHYGS---
A0A5P0Y910      N--VLYGNDLPVTVQF-----------------------LTIG--------EEHYGS---
A0A5P0XQC0      N--VLYGNDLPVTVQF-----------------------LTIG--------EEHYGS---
A0A414YFM3      N--VLYGNDLPVTVQF-----------------------LTIG--------EEHYGS---
A0A5P0VXP6      N--VLYGNDLPVTVQF-----------------------LTIG--------EEHYGS---
A0A5P0W892      N--VLYGNDLPVTVQF-----------------------LTIG--------EEHYGS---
A0A0A2EVS5      S--TLYGSELPIVVSI-----------------------DRFY--------GALEWS---
A0A1T4NAJ7      S--TLYGSELPIMVSI-----------------------DRFY--------GALEWS---
A0A255T941      V--ELYGTS-PVEVMM-----------------------RK-Q--------SKYPFS---
A0A3N2KCL3      V--VAYGSNLPVRVEM-----------------------PGFA--------ENGSAS---
A0A4P7VSV0      V--VAYGSNLPVRVEM-----------------------PGFA--------ENGSAS---
A0A2V1IJY1      V--VAYGSNLPVRVEM-----------------------PGFA--------ENGSAL---
A0A4P7VXK7      V--VAYGSNLPVRVEM-----------------------PGFA--------ENGSAL---
A0A1Y4CHN5      R--VLYGQNLPVSVSF-----------------------LDLN--------DNESAS---
A0A1M6I2S6      V--GLYKSN-PVAVSY-----------------------RH-Q--------DETPVS---
A0A1Y3V692      V--GLYKSN-PVAVSY-----------------------RH-Q--------DETPVS---
F3PXM2          V--ELYRSA-PVAVRF-----------------------CG-K--------AERPVA---
A0A3E4ZNL4      I--ELYKNS-PVWVTY-----------------------LA-N--------NKKDVS---
A0A174AHH7      I--ELYKSS-PILVTY-----------------------LV-D--------NKKNVS---
A0A174JCE8      I--ELYKSS-PILVTY-----------------------LV-D--------NKKNVS---
A0A3E4JMC4      I--ELYKSS-PILVTY-----------------------LV-D--------NKKNVS---
A0A412SND6      I--ELYKSS-PILVTY-----------------------LV-D--------NKKNVS---
A0A414IEQ9      I--ELYKSS-PILVTY-----------------------LV-D--------NKKNVS---
A0A415UKN5      I--ELYKSS-PILVTY-----------------------LV-D--------NKKNVS---
A0A0M1W8D8      I--ELYKSS-PILVTY-----------------------LV-D--------NKKNVS---
A0A3R6GKX5      I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
A7V4S1          I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
B0NU19          I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
D4V601          I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
A0A4Q0U3M9      I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
A0A4R4H1Q2      I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
A0A397WLT5      I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
A0A3R6GM96      I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
A0A015XH67      I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
A0A078RZN2      I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
A0A4R4I3T9      I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
A6L0K5          I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
A7ACT5          I--ELYKSS-PILVTY-----------------------LF-D--------NKKSVS---
A6KY94          I--ELYKSS-PILVTY-----------------------LF-D--------DKKSVS---
A0A173UQR8      I--ELYKSS-PILVTY-----------------------LF-D--------DKKSVS---
A0A3R6HK75      I--ELYKSS-PILVTY-----------------------LF-D--------DKKSVS---
A0A412B7D1      I--ELYKSS-PILVTY-----------------------LF-D--------DKKSVS---
A0A412VNY9      I--ELYKSS-PILVTY-----------------------LF-D--------DKKSVS---
A0A414LTU9      I--ELYKSS-PILVTY-----------------------LF-D--------DKKSVS---
I9Q4U4          I--ELYKSS-PILVTY-----------------------LF-D--------DKKSVS---
A0A373ISF0      V--GLYKAN-PVAVTF-----------------------GE-V--------MEKPVS---
U6RF62          V--DLYKAN-PVAVTF-----------------------GE-V--------MEKPVS---
A0A662ZZD5      V--ELYKSS-PLAVTY-----------------------RH-L--------DETPVG---
A0A395YYT3      V--ELYKSS-PLAVTY-----------------------RH-L--------DETPVG---
A0A642JYJ3      V--ELYKSS-PLAVTY-----------------------RH-L--------DETPVG---
A0A015UXN7      V--ELYKSS-PLAVTY-----------------------RH-L--------DETPVG---
A0A5M5W148      V--ELYKSS-PLAVTY-----------------------RH-L--------DETPVG---
A0A3A5TI83      V--ELYKSS-PLAVTY-----------------------RH-L--------DETPVG---
A0A415NEB6      V--ELYKSS-PLAVTY-----------------------RH-L--------DETPVG---
A7AJ60          V--ELYKSS-PLAVTY-----------------------RH-L--------DETPVG---
A0A016E4F9      I--GLYKCN-PIAVTY-----------------------RH-L--------DEIPIS---
A0A4Q5CFJ7      I--GLYKCN-PIVITY-----------------------RH-L--------DETPVS---
A0A108TH71      V--DLYKVS-PVTITF-----------------------CD-K--------IEVPLS---
I8VXH0          V--DLYKVS-PVTITF-----------------------CD-K--------IEVPLS---
A0A412S0N6      V--DLYKVS-PVTITF-----------------------CD-K--------IEVPLS---
A0A412IIJ0      V--DLYKVS-PVTITF-----------------------CD-K--------IEVPLS---
A0A0P0FM97      V--DLYKVS-PVTITF-----------------------CD-K--------TEVPLS---
R6KTP3          V--DLYKVS-PVTITF-----------------------CD-K--------TEVPLS---
A0A139LU87      V--DLYKVS-PVTITF-----------------------CD-K--------IEVPLS---
A0A1C6B3Y5      V--DLYKVS-PVTITF-----------------------CD-K--------IEVPLS---
E2NMQ4          V--DLYKVS-PVTITF-----------------------CD-K--------IEVPLS---
A0A412YDB9      V--DLYKAA-PFTVTF-----------------------RD-Q--------PEAPLS---
R7DY01          V--DLYKAA-PFTVTF-----------------------RD-Q--------PEAPLS---
A0A414LGK8      V--DLYKAA-PFTVTF-----------------------RD-Q--------PEAPLS---
A0A415IPQ4      V--DLYKGS-PVTITF-----------------------CD-K--------IEVPLS---
A0A3E5BRW7      V--DLYQST-PVTVTF-----------------------FD-K--------VETPLS---
K9DXS6          V--DLYQST-PVTVTF-----------------------FD-K--------VETPLS---
A0A1M6KFV3      V--DLYKSA-PVAVTF-----------------------LD-K--------MEAPLS---
A0A1Q6G7L3      V--DLYKSA-PVAVTF-----------------------LD-K--------VEAPLS---
A0A413H235      V--DLYKSA-PVAVTF-----------------------LD-K--------VEAPLS---
A0A1M5B2J8      N--TIYGDQLPVAVTL-----------------------TDFP--------DNQSAA---
A0A255RCT5      V--TIYGDQLPVAVSF-----------------------ADFP--------DNQSAS---
A0A1Y4GLF5      V--VAYGKNLPVTVTL-----------------------CDLP--------EDETGS---
A0A1H3XSC0      Q--VAYGPTLPVNVSI-----------------------NGLS--------ENESVG---
A6LE40          K--VAYGLTLPVDVTI-----------------------SDLP--------ENESAG---
A0A4Y1VPX5      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
B3JI46          Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
R6NN15          Q--VRYGQNLPVTVSF-----------------------AGLA--------DNETAA---
A0A358R8U0      R--VAYGASLPLTVSL-----------------------PELT--------ENESAR---
R6WSB6          R--VAYGASLPLTVSL-----------------------PELT--------ENESAR---
A0A4Q5ENK6      Q--TVYGNRLPVQVVI-----------------------PTLS--------ENESAT---
A0A401LPX7      Q--TVYGNQLPVHVVI-----------------------PNLS--------ENESAT---
A0A3A5Z900      Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
A0A3R6EGW5      Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
A0A285TGL6      Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
A0A3A5RFX4      Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
A0A1Q6IUW9      Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
A0A3R6NPG7      Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
A0A413XDP6      Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
K6AP24          Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
A0A662ZYI7      Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
A0A078RYI7      Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
C7XEQ8          Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
D7INX6          Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
K5ZG55          Q--TVYGNQLPVQVVI-----------------------PNLS--------ENESAT---
A0A3N2N9B8      E--VAYGTTLPIELSI-----------------------VNAP--------ADASAE---
A0A3N2NMI0      I--VAYGTGLPIQLEI-----------------------VNFP--------TDASAT---
A0A359I8H7      K--TLYGSNLPVNVKF-----------------------HDLE--------EQQCAG---
A0A3N2KA63      K--TLYGSNLPVNVKF-----------------------HDLE--------EQQCAG---
A0A4Q0IMT7      K--TLYGSNLPVNVKF-----------------------HDLE--------EQQCAG---
A0A3B9FAU3      N--ILYGRSLPANVRM-----------------------MGLG--------DHESAA---
A0A3C1E5L7      N--ILYGRSLPANVRM-----------------------MGLG--------DHESAA---
A0A4Q0UAV1      K--LLYNNSPVTAVNM-----------------------APED--------KKLKGY---
A0A354SN68      I--TLYGKNLPIKVSF-----------------------LEAT--------SMDNLS---
A0A3N2N595      E--IAYGYTLPICAEL-----------------------IDFS--------AYGTLK---
A0A0A2DUD9      H--LLYGTNLPLNLRF-----------------------TDLS--------EQESAE---
A0A3P1ZBJ5      I--TLYGRTLPFQVRF-----------------------LSLN--------EEQGAR---
R5FHS9          G--VLYGQNMPYTVSM-----------------------PDVQ--------DEDVVK---
A0A413TW79      V--ALYGRTLPVTVHF-----------------------YSLN--------DMQSAS---
A0A3E5E9M7      V--ALYGRTLPVTVHF-----------------------YSLN--------DMQSAN---
A0A3E4SK73      V--ALYGRTLPVTVHF-----------------------YSLN--------DMQSAN---
A0A415GGC6      V--ALYGRTLPVTVHF-----------------------YSLN--------DMQSAS---
A0A413DBH9      V--ALYGRTLPVTVHF-----------------------YSLN--------DMQSAN---
A0A495WI87      E--VLYGRTLPINVSI-----------------------DTPN--------DNESSA---
A0A354M4S6      E--VLYGRTLPINVSI-----------------------DTPN--------DNESSA---
R7DH52          E--VLYGRTLPINVSI-----------------------DTPN--------DNESSA---
A0A4Q5E7L5      Q--VAYGLTLPVNVTM-----------------------SDLS--------ENESAG---
A0A4P8LP09      Q--VAYGLTLPVDVTI-----------------------SDLP--------ENESAG---
A0A4R4GZU7      Q--VAYGLTLPVDVTI-----------------------SDLP--------ENESAG---
A0A016CWA4      Q--VAYGLTLPVDVTI-----------------------SDLP--------ENESAG---
A0A1C6H117      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A415TAH7      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAR---
A0A0M1W0V2      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A139KA16      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A174VQ92      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A1Q6HCG0      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A1Y4JYM9      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A3A5QW67      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A3A5RQE6      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A3A6BP07      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A3E5E153      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A3Q9IP20      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A412WV15      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A413ICP6      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A414KYB9      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A5B3FWR2      Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
E5WX00          Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
K0X3P3          Q--VAYGLTLPVDVTI-----------------------SDFP--------ENESAG---
A0A3A5Z014      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A1M4YZ07      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A078S3Q8      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A069SJV7      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3E5DXI5      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3E5EM98      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3E5F453      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
I9T3G6          Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A4Q5E5M7      Q--VAYGLTLPVDVTI-----------------------SDLP--------ENESAG---
A0A0P0FQW1      Q--VAYGLTLPVDVTI-----------------------SDLP--------ENESAG---
A0A5M5C0W6      Q--VAYGLTLPVDVTI-----------------------SDLP--------ENESAG---
A0A642LZ22      Q--VAYGLTLPVDVTI-----------------------SDLP--------ENESAG---
A0A5M5YM86      Q--VAYGLTLPVDVTI-----------------------SDLP--------ENESAG---
A0A642LE65      Q--VAYGLTLPVDVTI-----------------------SDLP--------ENESAG---
A0A5M5Y0P8      Q--VAYGLTLPVDVTI-----------------------SDLP--------ENESAG---
A0A642NJ89      Q--VAYGLTLPVDVTI-----------------------SDLP--------ENESAG---
C3RFN5          K--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3E4SYU0      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A6LGY1          Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
K5ZSH4          Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A078T2W6      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3R6EAF7      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A5C6L2P1      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A412MJT7      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3E4WKT5      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3A5YY33      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A078TAH2      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A1E9CFZ7      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A373FYU5      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3A5TZ72      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3A5XBP2      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3A6MEG9      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3E4JP35      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3E4KP40      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3E4NX82      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A3E4XFU8      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A412RG70      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A412TD37      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A413GAA4      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A414M7I4      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A496BTA0      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A496D2V6      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A4Q5EN83      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A4Q5G1P5      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A5C6KCA6      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A5M5AHM5      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A641WNS6      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
E5UZA2          Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A069SMG6      Q--VAYGLTLPVDVTI-----------------------NDLP--------ENESAG---
A0A1Y4PQK7      R--LLYGMALPFQANI-----------------------TGLQ--------ENESVG---
A0A1Y4IH41      R--LLYGMTLPFQANI-----------------------AGIQ--------ENDFAG---
A0A3A6AAP4      R--LLYGMTLPFQANI-----------------------AGIQ--------ENDFAG---
A0A1Y4DYA7      H--ILYGQNCPYEVEF-----------------------FDLQ--------DNDVAS---
A0A1Y3X4I9      Q--VLYGQACPYEVEF-----------------------FDLL--------DNEGAS---
A0A1Y4FNK8      K--VLYGGTCPYSVSF-----------------------NDLQ--------DNESVS---
A0A355FD59      K--TLYGSELPVRVVF-----------------------TDLT--------DKENAK---
A0A359CEZ9      K--TLYGSELPVRVVF-----------------------ADLT--------DKENAK---
A0A353Q7B4      K--TLYGSELPVRVVF-----------------------TDLT--------DKENAK---
F8X3A5          K--VLYGPDLPITVSF-----------------------TDLA--------DNESAE---
A0A1M3KVR9      K--VLYGPDLPITVSF-----------------------ADLA--------DNESVE---
A0A4Y9IJS3      K--VLYGPDLPITVSF-----------------------ADLA--------DNESAE---
A0A4Q5WS95      R--SAYTSS-PVVITA-----------------------FNLDQVRTTPN-----IP---
A0A501VZX6      T--SAYITS-PVQIEV-----------------------KHPE----ALK-ETAKVY---
A0A399SH26      V--AAYTSS-PVIVTH-----------------------YNPDAILATED-EPQKIY---
A0A501W1A9      V--SAYTSS-PIKVIL-----------------------KSFD----KVQ-EQPAVY---
A0A0E3ZGV6      V--PAYTSS-PITITL-----------------------KDPE----KAT-ENPMIF---
A0A1I2N4S1      I--PAYNTS-PITISL-----------------------KSPE----TAV-EYPAVY---
A0A2T5YE44      I--PAYTTS-PITISL-----------------------KSPE----TAA-EYPAVY---
A0A1V9FHD0      T--SAYLSS-PITIVA-----------------------QDPDQVKETGD-TDVLFS---
A0A4V4H170      T--SAYTSS-PITITA-----------------------RKPDDLKETGE-VDVQFT---
A0A1V9F098      T--SAYNSS-PVTIIA-----------------------RKPDELKSTGD-SVVHFQ---
A0A4R2VU64      T--SAYTSS-PITIMA-----------------------RKPDDLKETGD-SDVYFM---
A0A4S8HY23      T--SAYTSS-PITITA-----------------------RKPDELKETGE-VDVPFS---
A0A1V9F383      T--SAYVSS-PVSIVA-----------------------KDPDELIETGD-TDIVMS---
G8TRZ6          T--SAYISS-PVSIVA-----------------------RNPDELTETGD-TDIAIA---
A0A543WA52      V--SAYITS-PIRVEL-----------------------KNPQDVPIVTEGKPTRFY---
A0A1M5BA90      R--SAYTSS-PVTIEL-----------------------EYPNNIQ---D--TDRID---
A0A512B879      Y--SAFTSS-PVTVEL-----------------------ADPDMIV---E-VVERID---
A0A559PPI3      V--SAYNSS-PIQIKL-----------------------KNPDEIVIEKD-VPAEHY---
A0A1T5CS78      I--SAYTSS-PIKVIV-----------------------KEPNRISISNE-EPEKHF---
A0A0Q9Z8F1      I--SAYTSS-PIKVIV-----------------------EDPNKISLSED-EPEKHF---
A0A2N0U0M7      I--SAYTSS-PIRVIV-----------------------QDPNRISISAD-EPEKHF---
                                                                            

A0A1T5MMH4      ----QPFFLE------KESPE---TFSLVWGEGTQKI-------------------SGRY
A0A2W4R1L8      ----VPIFVD------LGSTE---AVRLRINQDGDQV-------------------SGKY
A0A2E5CV79      ----PEIEKE--------------------------------------------------
A0A2D4ZVH1      ------------------------------------------------------------
A0A0K8QSK7      ----TRIRLT-----FAGDG----KIRYQAEGENVRVHDFVTGENIRTIPNVNIDETRLL
A0A1V6CN82      ----FDFRIS-----VHPDR----SITLSGFGEGVGVYNYSENRGAGYFPEVKIEQKVQS
A0A1M4XZ45      ----ADFYLT-----IQPDG----KLRVEMDQEDVAVYNYLDEKIVERLPQFSFSRDISA
A0A399D319      ----ADFFLT-----IEPNG----KLKIDMEEEVISAYSYTEEEVVKRIPGYSFSRTIDP
A0A1M6GR99      ----GPVFDV-----ILNSDG---SYALKVEKQDAMVYNYNTGHKIGERKDLEFSINGNV
A0A1M6TTV4      ----RRIYIE-----FVGD-N---HFYLSLDHDQTEGRP-----------------KYKF
A0A4Q8RX32      ----VVFNVE-----VLSAS----EFVLSAKNEECMLYDFQKERNDREVANFEMSQKFNF
K0X1U5          ----GFVVKV-----QTGGSDDKIKVLLKKGFFTTLAEME----------------ATSF
R5EXK3          ----GFVVKV-----QTGDSDDKIKVLLKKGFFTTLVEME----------------ATSF
A0A401UAP7      ---------------LNHTIDKKSEAQFEITLSDGEKL------------------TGNF
A0A1W2GF52      ----KRFDIE-----ILNE-T---DFYISSEYLGGRIGE-----------------KQQF
A0A2G5L7B8      ----RRIDVE-----ILSD-D---HFVMDFELHGTSHRT-----------------RYPF
A0A523GAC0      ----QQFTVA-----ISNE-D---EFILGYPDHTQIPDQ-----------------SCRF
L8JW09          ----RRIFVN-----IVDE-K---TYTINFSGDEQEKAM-----------------KYNF
A0A5C7MX19      ----VPIYIN-----IIDE-E---KFSINHIYKDGEFER-----------------IYRF
A0A364XUP5      ----IPLHLT------ETDGN---SFSIKVGESQRKI-------------------TGKF
A0A1M5RLA9      ----VPIHLD------DSGSD---EFTLQVGDEGQKT-------------------TGRY
A0A385SFR9      ----APIHLD------DTGND---EFTLQVGDEGQKA-------------------AGRY
A0A5M4A9J4      ----ATFEFD-----AQPHSG---RFILNVTGEKPRTWDFRHRQAIHQYSDYSVTLPVRL
A0A5M4B1C7      ----ATFEFT-----VDDKGH---TSELKVKGEKPAIYNYENKTVLQKPEEIDKTIPFSI
A0A0D3LFR6      ----QKIYVN------IHDLQ---EYTLSYFQGENEVSN-----------------RYRF
M7N6D4          ----RRFFVR------IHNSE---EYTLSYQLGDQEISG-----------------RHRF
A0A1Q3ZMZ7      ----QPVYLI-----LQD------ENLIRYQSKGKTYTF-----------------PFVF
A0A2D8JJW3      ----VPIHIKEGCGTLIENIS---ETIQIKNEKNALNNLSLHSDNTVFDLSGVVIPDGDF
A0A2W2AFF7      ----DMYTFS-----VKINGD---NIALKCSGKKCNNVDW----------------KGKF
A0A2N5YXE2      ----QKVNIE-----FVDY-----KCHLYYKIGNQDYEY-----------------LISP
A0A2W1NDY9      ----VPIYLK------DGQ-D---GLYLVFNANQKKNEI-----------------PVAH
A0A5C8AQR5      ----VPIYVE-----YMGN-N---RIRLNYELHGQKISI-----------------NGSL
A0A1G0CI31      ----IPIWIE------LKG-N---KVQLSYQVGGKSYSM-----------------LKPI
A0A556N0M0      ----VPIGVE-----TTDN-R---RVKLTYVLNGQTYSK-----------------TSEI
F2IKD6          ----IPIWIE-----TLEN-R---KIRLSYSLLGRNYSK-----------------VSAI
A0A1I7BM74      ----LPIYFY-----KDNS-N---QYKIKYNYKGKEYIE-----------------EVFL
A0A2G2FJ17      ----IPIYIK-----PKAQ-G---LVELSMQRHGERLKW-----------------DIES
A0A077ENE7      ----FTVIPL-----DGN------SVIIKNWNPENKDKEI----------------KIAL
T0NN57          ----FVITPI-----DSR------SVIIKNWSKNGNEKEI----------------KVSI
X5K347          ----FVITPI-----DSR------SVIIKNWSKNGNEKEI----------------KVSI
A0A2I0QZ80      ----TPINIT-----TEGN-----KIFLNFTHQNKAHHI-----------------AIQP
A0A3E1F1A3      ----VPIYLS-----VDEE-----KVLMRFNHKGVDYNY-----------------KFIP
A0A2U2XBJ3      ----TPIFLS-----SMED-----KIIMNFKFNGGNYNY-----------------KFAP
A0A4Q4KU94      ----TPIFLS-----AFDD-----KVIMNFKYNGGNYNY-----------------KFSP
A0A2U1FKU2      ----FRIQIK-----DEKTFR---LTHFKRHAGRGLSGMEV---------------DGTF
A0A0A2F954      ----FRIRIN-----DAHSFQ---LTHFEQKERNGIGDIKI---------------DGSF
A0A0A2FW91      ----FRIRIN-----DAHSFQ---LTHFEQKERNGIGDIKI---------------DGSF
A0A2D2N2N1      ----FRIQIN-----DAHSFQ---LTHFEQKERNGIGDIKI---------------DGSF
Q7MWZ2          ----FRIQIN-----DAHSFQ---LTHFEQKERNGIGDIKI---------------DGSF
T2NDT6          ----FRIQIN-----DAHSFQ---LTHFEQKERNGIGDIKI---------------DGSF
W1R7P9          ----FRIQIN-----DAHSFQ---LTHFEQKERNGIGDIKI---------------DGSF
A0A1R4AFZ0      ----FRIQIN-----DAHSFQ---LTHFEQKERNGIGDIKI---------------DGSF
A0A1R4DVZ7      ----FRIQIN-----DAHSFQ---LTHFEQKERNGIGDIKI---------------DGSF
A0A5M4B212      ----ANFDLH-----ILPD-N---RIEMTVRGKEAIRYDFQNEKELKPAREIEQTRTFPV
A0A1T5K9D4      ----FTIKAT-----PRDS-K---TIELDLSSLGQKNV------------------VVSY
A0A3D1KEX9      ----ISFEVE-----LLPS-K---QLKVSDMQIDDSDVDFKQ--------------VVSY
A0A358Y7S2      ----TEMHVS-----VEND-----LILIDYEKSGAKNKL-----------------KLKP
A0A1X7J248      ----EKFFVD-----IIDK-T---NFKISTNQDGEEWV------------------SQKF
E4TQD2          ----QKFYVD-----IIDK-E---NFKLTTNPDEDQWI------------------NQKF
A0A2J6HHN3      ----ESLDIT-----IHDD-----HLNVSYMNLDGSMEDK----------------SFQP
A0A1Y3WMT8      ----GFVVKV-----QTNKGSDKIKVLLKQGFFTTLAETE----------------ATSF
A0A1Y4GQU1      ----GFVVKV-----QTDKSSDKIKVVLKRGFFETLAETE----------------ATSF
A0A1V5W8T5      ----KNIYLD-----YNKKTD---KITIEYSLDGEKSIKH----------------EIKR
A0A2T8HKA9      ----SMTIIP-----KDSN-----HVDFLLMENDNIIHSQ----------------RIKL
A0A3B8INU3      ----KKVMVT-----ILDN-D---RYEIRFPWVGEDVQPE----------------EHRF
A0A414ZBF2      ----SLTATA-----IDGNRALLSDFVLDENDFDEVV-------------------TVQM
A0A1Q3Q573      ----NPVYIR-----LVNK-----NSMVVSYSFNGDEFEK----------------EIKP
A0A662BAY3      ----ADFLLE-----ILPD-G---KLLIKVEDEHAAIFDFLNSEIVTYVTNLSFSKEAAY
A0A4U3L369      ------------------------PFTLHWKEVNPTSYALFDSKDKQVV-------TGTY
A0A357YNR3      ----DKVSID-----VVVYPTGNYNFSVEYNKNNFHYN------------------LSPG
A0A5E8AX52      ----RPIDIE-----IISE-S---EFELSFEPAEQSGAS-----------------RHKF
F4KK08          ----LRIKSD-----KEAH-NQVILYDIKSSLIGKVQEPI----------------AATL
A0A496LCF9      ----YYSYKK-----RDSH-----SFTITIYDNTDNEIETI---------------EGTF
A0A5P2G2A9      ----YKFEIS-----SWDE-K---GIALIRKIKDEDDSTF----------------FVKW
A0A419VXB7      ----VPVHIS-----PINDREFKIEVKSKANLLGINTEVDFEG-------------TGVF
C3J7R8          ----LEVSSV-----DASHVS---LLCEESSIEAARGTTS----------------QVQI
A0A0B0BTJ4      ----FNIHIK-----SIEDADGSFKALLEYRLPGQKTTEKTI--------------TGAF
A0A3B9CNN6      ----FNIHIK-----SIEDADGSFKALLEYRLPGQKTTEKTI--------------TGAF
R5X290          ----FNIHIK-----SIEDADGSFKALLEYRLPGQKTTEKTI--------------TGAF
A0A1Q6E6I7      ----FNIHIK-----SIEDADGSFKALLEYRLPGQKTTEKTI--------------TGAF
A0A1G8BVM8      ----FTITVT-----LLKN-N---KAKLTYNISETRDDGEIISNDVVD--------DISL
A0A2G2F510      ----KEVRVD-----YDGE-----NISLSYLK-NGETKVV----------------KGYV
A0A316JZ08      ----QEIGIT-----TRND-----QVILSYSK-GGKNVKL----------------KGPL
A0A1I1FXP9      ----IPVDVL-----FIDE-K---QFSLKYKL-GNVNYSR----------------NFNF
A0A3N4H5N3      ----GELLQI-----HLKEEN---KFELILEDEKKA--------------------EFEF
A0A2P8EAX2      ----GEVFTI-----KVLNEK---KFEIEFAKNKKT--------------------EFNF
A0A4V2F6N9      ----VEVFAI-----TILGDK---KFEINFKDNKKA--------------------EFNF
A0A3B9FXJ0      ----DVIELR-----PIGD-Q---KIRCAYEW-KGETWSQ----------------ELEY
R5GSU5          ----ITFKVD-----LIDNQK---FRIFDVRYKDEDCRIDK---------------VVAY
A0A2A3UE91      ----SQIKVE-----LNKQLT---GGVLKIGTQKL---------------------NFAL
A0A0A2G557      ----GSFSLS-----FIEE-N---KVSLSNFEGDFEQLSSAPKM------------IVSL
A0A2N2WFW8      ----TPYSLT-----VGDS-----TFVISTKTAGGTESET----------------EFRF
A0A1F3IU95      ----VPLLIE-----VHDT-----GFVIT--EINGIQTDK----------------SFRF
A0A3D0VUF6      ----VPLLIE-----VHDT-----GFVIT--EINGIQTDK----------------SFRF
A0A1T4PT95      ----GSFILS-----FEGS-D---KVRLSHFKGDFSK-------------------TSPL
A0A4P5TMD1      ----IPIYFI-----FKSA-R---EFQIEYRI-LKVKYSF----------------NGKF
A0A651GU15      ----KQIFIR-----NLAD-G---RYELHL---NNNAISD----------------PFLP
A0A3Q9FR88      ----LPFFLE-----FSNGGK---DFIITYKI-GEQQIEI----------------AGKS
A0A553GEX3      ----LPFLLE-----FSNGGK---NFIITYKI-GEQENEI----------------EGKS
A0A150ADJ9      ----KPILLN-----FSGDGK---SYQLTYNQ-GKS--VV----------------EGIS
A0A1B1FWQ4      ----TPFYLQ-----FSNEGK---EYVITYKV-GQTEKEI----------------KGSS
A0A1S1Z228      ----IPLFLQ-----FLNGGD---QYQVTYKT-GDQENTI----------------SGKS
A0A2A4PYG9      ----KPIYIS-----FPSTKK---IYT--SYYVGEEQFNK----------------PIXI
A0A1F3K695      ----IPIYID-----FISSKE---TKA--LYKIGEENHEF----------------AIYS
A0A353KZR1      ----IPIYID-----FISSKE---TKA--LYKIGEENHEF----------------AIYS
A0A2N2WYB5      ----TPIYID-----FTDDKN---GIITTYVKKEGYDQK------------------IEL
A0A1F3K4G0      ----IPVYIE-----FDGSEK---ALI--YYGDGGVNASY----------------PIEI
A0A356H8Y3      ----IPVYIE-----FDGSEK---ALI--YYGDGGVNASY----------------PIEI
A0A351HSA6      ----IPVYIE-----FDGSEK---ALI--YYGDGGVNASY----------------PIEI
A0A1F3Q014      ----VKIYID-----FVDSTH---GTI-SYSFDNETEQQH----------------NFIS
A0A2A4YXP3      ----QHFYVK-----FIDTHK--------FELVVNKLVLG----------------EYQT
A0A2D5KD44      ----TKIDIS-----FANSSS---GKL-SWGEGKESSV------------------DFYA
A0A1F3R158      ----ISHFVE-----ITNNNK--------FKLYENEKLIG----------------EFSD
A0A2M8ADX2      ----LPFYIE-----LTQNDK--------FKLFENETFLG----------------EFIN
A0A1J5B2H0      ----IPIYIN-----FNDDKQ---IKI-SYCISDNSKIEK----------------TFGL
A0A1V5N756      ----VPINIS-----FLSNSN---IHI-DFEAEKKSN-QY----------------EFSI
A0A1F3SJM1      ----EGTEVA-----VAYNNG---KVVLSYLK-NGKKKTI----------------RGNL
A0A2G2EB96      ----QEIAV------TSSGNS---KVKLTYVK-NGKQVIL----------------SGKL
A0A2G6PRA9      ----QEVAV------VSKGRN---KVELSYVK-GGEKQRV----------------EGML
A1ZKR2          ----KNINIE-----IIDD-Q---RFQLSYVL-GTQTVKK----------------TYRF
A0A1Q3GX01      ----KKFNIR-----IKNQ-N---EFELSFQV-GTNLKKQ----------------IYKF
A0A349DQI4      ----KKFNIK-----LKSQ-K---EFELSFQT-GKVLNKQ----------------VYKF
A0A2N3IIZ0      ----QKFYIE-----SEDG-H---SYNIEVKNDKKTLAEY----------------KGKF
A0A497D5Z2      ----ADFYVS-----FLPG-G---KLELSVDGENVPVYDYLNDKVIKRLPDLAWFGEGDA
A0A662B170      ----ADFYVS-----FLPG-G---KLELSVDGENVPVYDYLNDKVIKRLPDLSWFGEVDA
A0A2A5FYT6      ----RKIYIQ-----FDDE-F---KAIASYTI-NDSVYSR----------------EAPI
A0A2E6SYP1      ----KLIQIE-----FVKG------CALLSFN-DDPSSNT----------------IVPV
A0A2E5RLE8      ----SPIMVN-----FSNG------SAIISKV-DVDSGTV----------------LIPV
A0A2E7TQF6      ----SPIMVN-----FSNG------SAIISKV-DVDSGTV----------------LIPV
A0A2E6GVY9      ----YPLMIN-----FKNG------SAVISKM-DVDSGSF----------------IIPV
A0A350JJ90      ----RRIYIE-----FETP-T---SGTINYLV-GTKSFSE----------------KFAE
A0A3M1CDV2      ----KKIYVD-----FNDNLQ---TGKIKILLSEDNLIQI----------------PFHI
A0A522EYA6      ----TKIYVY-----FDSE-T---SGEITYTV-GDQIKTH----------------KFKQ
A0A4P5U6G4      ----LPINFE-----FINN-K---SFKISYRI-GQQKFIY----------------NGSY
A0A2E2TFD1      ----HKYYIY-----FPNT-T---QIHLSIDEPIGDANYQ----------------VFKI
A0A2E4ELE6      ----KDYYVY-----FESE-K---ELILTIENGKETVEKR----------------LSTN
A0A2E3XZI5      ----KKIYLK-----F-EK-N---YFSLVDEE-NEKIYAE----------------YIEA
A0A2M7NLQ9      ----RHLDIQ-----IIDE-E---EFVLTYQTATGEDFSK----------------IYKF
I4AFR0          ----HPLNIQ-----IIDE-E---EFVLTYETPTGDNFSK----------------IYKF
A0A2N2Y3E5      ----VPIALD-----FENI-T---DGWLYFQN-NSSAEKV----------------KIKT
A0A2D9D7T6      ----VHFDIK------EKK-G---KLEISYTH-NGQSKKI----------------SGEL
A0A1F3PPL5      ----KKIYID-----FENP-T---TYHLKINS-DDLEFE-----------------NLSV
A0A357QK06      ----KKIYID-----FENP-T---TYHLKINS-DDLEFE-----------------NLSV
A0A662AEA4      ----TPIFVN-----FNNK-N---SFSIQYEI-NGNEYKY----------------ELKT
A0A0S2HYK8      ----IPVFIS-----FKDK-K---NVVFEYEY-NGETYSY----------------PGEA
A0A2N5ZWN6      ----EPIHIQ-----FIDE-N---NAKIEFEI-GDNIITK----------------DIEI
A0A0F2NS19      ----KKFYLE-----KTNN-E---KFNL---F-QSEKLIG----------------EFSS
A0A2A5H8X6      ----KKFYIE-----KTNN-E---KFNL---F-QSEKLIG----------------EFSS
A0A2H0GAU8      ----IPFFIE-----ITKN-N---KFNL---F-ENETLLG----------------EFEV
A0A2M8FTK1      ----IPFFIE-----ITKN-N---KFNL---F-ENETLLG----------------EFEV
A0A2A5B3B0      ----QSFFVE-----FIDD-Y---KFRL---T-QNDKVIG----------------DFNV
A0A5C6RXM7      ----HTFNVV-----INDI-N---QFEL---R-DGEEILG----------------VFKS
A0A2E0FJ09      ----VPIYVL-----LKPD-K---TIHLKYTV-DEETFEF----------------NESL
A0A1F3FZ62      ----INFDIE-----FKGN-N---KYILRYLL-NEKLNIR----------------EFYF
A0A1F3K211      ----INFDIE-----FKGN-N---KYILRYLL-NEKLNIR----------------EFYF
A0A1F3KLL5      ----NQIYIS-----FLNK-N---SFTLEYYI-NGVKSHY----------------SLKP
A0A359D1M1      ----NQIYIS-----FLNK-N---SFTLEYYI-NGVKSHY----------------SLKP
A0A2E7CT70      ----LPIYIQ-----K-KG-D---YFILTDFD-NQKSYAK----------------FIKP
A0A2D5V560      ----KPIYLL-----F-DG-N---YFSLTDEK-AEIIYAK----------------YILP
A0A2D7K5A8      ----KAIYLL-----Y-DG-T---YFSLTDEN-EEIEYAN----------------YILP
A0A2E1XQ82      ----KPIYLS-----F-DG-T---YFSLKDKN-QEIEYAN----------------YILP
A0A1V6I2U9      ----QNIDLE-----F-KD-Y---KCHIAYTL-GNQKYEY----------------TIQP
A0A1F3C1M2      ----IPIYIE-----FIDK-L---NFNLSFTI-NEKTIEK----------------KFTI
A0A1F3DS87      ----VPIYIE-----FIDK-I---NYNLSYEI-NDKKFER----------------KYTI
A0A2H0B957      ----IPIYVS-----FSLN-G---DAAIKYTY-NNQIVQK----------------SLKS
A0A1F3CFW6      ----VPIYVS-----FDKN-G---DSNIKYKT-NNTNFEK----------------TIKK
A0A2M7E2T8      ----VPIYVS-----FDKN-G---DSNIKYKT-NNTNYEK----------------TIIK
A0A2M7NC69      ----VPIYVS-----FDKN-G---DSNIKYKT-NNTNYEK----------------TIIK
A0A5C8A5B4      ----DSMAIQ-----VIDVPIEVEVDRAARTYRVKAQGKNVRLYNVKTQEVLPELIEKY-
A0A4Y9ITE2      ----PPMFSD-----TVSEPVIFKLTATKDGKVDIKLKKGRFSTIAETSGKTFP------
A0A5M8NYX7      ----KNQIG----------------WG---------------SFILDKKGDTFS-----I
A0A3D5KRY6      ----PSDFIQ-----LENVPIHIKIIS---------------KTKYEISCDEKIRIGGWS
A0A1V5IPN7      ------------------------------------------WESYPISGSAYP-----V
A0A0E3V905      ----ESGKPE-----LYKKPLEVSMLS---------------NKAVKINEQVYP-----V
A0A553ETH6      ----IVKDGN-----VYDKRIYVRLIN---------------KTKYQISFDGED-----V
A0A640Q161      ------------------------------------------AEFMPKDEEPSF-----V
A0A640QU49      ------------------------------------------DDFMPAEDESSI-----V
A0A1Q3PII2      ----LKPRT-------AKPTTY---------------------HIERRTGNTFT-----V
A0A351BXT2      ------------------------------------------------------------
A0A2K8Z965      ----EQPISA-----LYKSPLDITLPG---------------DNTVTINEHVYP-----L
A0A418M8U8      ----EFGKPE-----LYEEPMLLTFID---------------SSSVEINEQVYP-----L
I2GTA4          ----EFGKPE-----LYEAPMLLTFID---------------SSSVEINEQVYP-----L
A0A2K8ZAJ2      ----EKPTSQ-----LYMEELKFLFVD---------------SKMVKLNGHMYP-----V
A0A368JPA3      ----TDPTPN-----LYRADLEIGIIS---------------PTTVRLNDWVYP-----A
A0A5N1JI29      ----TDPTPN-----LYRADLEIGIIS---------------PTTVRLNDWVYP-----A
A0A3P1BT12      ----KEPTAN-----LYRADLEIGIIS---------------PTTIRLNDWVYP-----A
A0A3P1CI15      ----SDPTPN-----LYRADLEISIIS---------------PTTVRLNDWVYP-----A
A0A4R8CUK1      ----DSPTPN-----LYRADLHIGILS---------------PTMVQLNDGVYP-----A
A0A3D0MYJ7      ----LNTIKD-----IDKSLYP---------------------NLYIKNKENTY-----N
A0A662AH13      ----FNVID-------KPDSFY---------------------NIFDPKFEIIE-----E
A0A5C7QA01      ----PEAYL-------DQPLHL---------------------KINQNNYQLLD-----A
A0A3D3LS70      ----FKNSD-------SKTDFY---------------------YLINRNKKVNS-----E
A0A1G1TM36      ----LHTLR-------GQHVLN---------------------IVLQDTASFAV-----R
A0A1G7ZF38      ----LKSRP-------AKPESY---------------------LIIRETDSTFR-----L
C6VS52          ----IQKQP-------PRPETY---------------------HIVRQAGDFYI-----I
A0A0P7X1V8      --------------------------------------------------------RAF-
A0A3B0C2S4      SLDAFEARIT-----NMDGA-----------------------------TTVVGLAEKD-
L8JI02          ----VPVYIE-----PLPGG-SYRIEAVGRDVDVYNFLTNRTED--TFDEINLREVVEA-
A6EBM4          ----QLILFD-----PIDHE-KFTLTWTIGKEDI---------------RKN----FRF-
A0A416GA42      -----SFRLR-----LLPGR-KVELSQLKYQAQELTE------------TKT----FVL-
A0A4R5DL69      ----VTYKIT-----VKAND-QFTLTDKVH-------------------TWN----QSF-
A0A1T3IYP5      ----YSFIIT-----PFDSK-TVILKGWDQSGK----------------DVK----VAL-
A0A1M4YED3      ----IDLSVN-----ATTNVVTVD-------------------------GKS----YPM-
A0A3P1Z8V4      ----TRMEAV-----INPDN-TVTLTDFEGIRGLSSEQENL--------KLK----VPF-
A0A2N3U785      ----KTLRVQ-----IKDKN-NFVLND-EEK------------------ETL----HEF-
A0A0E3ZG78      ----KSFVIH-----IKSDS-TYNLDDNEGK------------------MYT----YKF-
A0A1I6BRK6      ----KSIIIH-----LKKNN-FFDLEDYKGI------------------TTS----HRF-
A0A243WAB1      ----KSITLH-----LHPDN-SFQLEDYDGT------------------VTS----HSF-
A0A126PFG0      -------DIV-----LKDQT-SFYMAATNGN------------------LTA----HPF-
A0A3M1N7Z3      FWQGGRVRVI-----FDAER-KVEIWRAETL------------------I----------
A0A2H3NSN0      --------------------------------------------------EQ----PTD-
A0A2P6C324      -------------------------------------------------EEP----YTQ-
A0A1M6XHU0      -------------------------------------------------GRE----PSI-
A0A5S9C8G0      -------------------------------------------------GRE----PSI-
G2SF81          -------------------------------------------------GRE----PSI-
A0A5S9EYW1      -------------------------------------------------GRE----PTI-
D0MHQ9          -------------------------------------------------GRE----PSI-
A0A4D7K1D4      ----RLFNVH-----ISSKE-HYTLTYELGEVTQ---------------RFE----ANF-
A0A3C1ITV0      ----VTFVAE-----KEGQS-QLTVKDFKINGIKSDAP-----------AQT----VKL-
R7HN19          ----VTFVAK-----KEGQS-QLTVKDFKINGIKSDAP-----------AQT----VKL-
A0A060RD97      ----VSFTVT-----PKNSE-AFQLSYIDENETRV--------------SIE----KKF-
A0A0D3L8Q3      ----KVIKVH-----LKGNN-SYDI-EYNEK------------------ISS----HKF-
A0A5B6TJH8      ----KELIIH-----TKDNN-SFVLEEQDGK------------------RSI----HSF-
A0A519U664      ----KSFVVF-----LKADN-SFQLQDYTGT------------------TNT----YKL-
A0A519UDD1      ----KSFIVR-----VRPDN-AFDLDDYTGH------------------ITT----HKF-
A0A519MA34      ----KSFTVF-----LKADN-SFQLQDYTGA------------------VTT----HKF-
A0A519UCX0      ----KSFTVF-----LKADN-SFQLQDYTGA------------------VTT----HRF-
R7PCR1          ----LAFDVK-----ILDEN-SFELKNLQFEDFDSEF------------NYK----GTF-
A0A350IHV0      ----YSFELT-----KTGDS-TFVIKNLRVAGEKMKYKG----------KIK----GSF-
A0A1G9E2A9      ----RSIELE-----VLNER-EYRLKYELNGEEI---------------QGN----FLF-
A0A098LL25      ----FKFDIT-----FLDKD-KFLLSYKKNDEEI---------------KSE----HYF-
A0A2T2YJE8      ----RRYNVT-----LLDAT-RFNLSYLEGDQEI---------------TEE----HTI-
A0A127B287      ----QKIYVT-----FDSRT-RYTVQIGEDGKK----------------SDV----HTV-
A0A3M9N829      ----QQIFIA-----FSSPS-RYEVYVGEEGERL---------------V------ATV-
A0A0P0CSF9      ----QKIYVK-----FTSPS-RFDLYVGENGNQS---------------S------YTV-
A0A5M8QQB8      ----QKIYVK-----FQSPS-RFDLYVGETGTPS---------------S------HAV-
A0A3M9MNC3      ----QKVYIH-----FNSPS-KFDIYIGKEGKHS---------------S------HAV-
A0A5B6TAX2      ----QKIYVK-----FESPS-KFDVYVGEEGSHT---------------S------HIV-
A0A5N1IQ33      ----RKFNLN-----FLDAN-RFRLTYLLNGQEA---------------GGE----YRF-
A0A512AYT3      ----KNFDVN-----FLDEN-RFTLSYQVGEEEI---------------SGE----YRF-
A0A5M6CYN7      ----KKINVD-----FLDAN-RFRLSYLVGEEEI---------------SGD----YRF-
A0A369QP10      ----IKFGVS-----ILDAT-RYNLSYVQGDQEV---------------TEE----HTI-
A0A126PDF2      ----QKISLA-----FTSPT-RYSISYSGPGTAL---------------DGE----YDL-
A0A2Z3GKA1      ----QKISLE-----FTSPT-RYSISYSGPGAAL---------------DGE----YNL-
A0A502GZP7      ----QKISLV-----FVSPT-RYSIDYSGTAATL---------------SGE----YAV-
A0A519SBU8      ----RKFQVS-----FPAPN-QYVVSVKSGAETL---------------TST----RAL-
A0A4Q3JNZ3      ----HKFLLN-----FLDSN-RYTVSVKAHNQTL---------------AGT----YTV-
A0A519Q9V3      ----HKFLIN-----FLTPS-KYEVSVKVHSQTL---------------TGT----YTV-
A0A0M3RW20      ----IQFNIQ-----FLNKD-KFILSYALRGNEI---------------KEE----KVV-
A0A495VFX4      ----VRFNVQ-----FLSDE-KFILSFNLKNEEY---------------TRE----YKV-
A0A1S9B3W0      ----LKFSVK-----LLDAQ-RFKLSYPAGAGET---------------EGE----YRF-
A0A1W1VRL3      ----RKFNVN-----FSSPT-QFRLSYLEGEQEV---------------SGV----YSV-
A0A1M6R305      ----TKFSVV-----FTSPQ-KFRISYLQGGQEQ---------------TSE----HTV-
A0A4Z0PHK3      ----TKFSLT-----FTGPQ-QFRLSYLYQGQER---------------TAD----HAL-
A0A2M9B9H9      ----SKFNLN-----FTGGK-QFRLSYLYLGQER---------------SAT----YTL-
A0A4Z0QCY9      ----TKFNLN-----FTGPQ-QFRLSYLYQGQEK---------------TGD----YTL-
A0A418R9X5      ----QKIGLQ-----LLEND-RFSLQLPNG-ASA---------------TQA----LKF-
A0A428JSJ3      ----QKIGLE-----LLDND-QFKLHLPGN-GSE---------------TSA----LTF-
A0A428KI59      ----QKIGFQ-----LLEND-RFRLQLPGG-AAE---------------TGE----LSY-
W8F1I6          ----QKIGFQ-----LLEND-RFRLQLPNG-GTE---------------TGE----LSY-
A0A246FQC0      ----LKIGIN-----LLSAT-TFQLILPDGLGGG---------------EQE----YRF-
A0A372E5P8      ----QKIALR-----FLSPT-TFELILPEDLGGT---------------EQQ----HTF-
A0A1H3EMW1      ----QKLALR-----FLSPT-TFELTLPEQLGGG---------------EQQ----HSF-
A0A1H9ZSN3      ----RKIALR-----FLSPT-TFELTLPEELGGT---------------EQQ----HTF-
A0A5N1J2M4      ----KPVEVE-----FLNKD-RFRLTYTLGNKTN---------------TGE----YGF-
A0A519S476      ----HKFQVS-----FPTPD-TYQISVKAHGQTL---------------TGT----YPV-
A0A4Q3JRW8      ----HKFLVN-----FLPSN-RYQISVKVRNQTL---------------TGT----YAV-
A0A519M923      ----HKFQVS-----FPTVS-QYQVSVKAHNQAL---------------TGT----YPV-
A0A4Z0ENW1      ----HKFDVE-----YIDTK-HYRLSITTANTTL---------------GGN----YEF-
A0A519UDB4      ----RKFNIE-----YIDAK-TYRLSVNVGSNIL---------------TGN----YAF-
A0A3S0QKV1      ----KKFSVR-----LLEGK-RFRLSYLMGQQEI---------------DGE----YQL-
A0A328BL48      ----QKFSVE-----VLDQN-RFRLSYAQGQAEQ---------------GGE----YSF-
A0A5R8WLY4      ----QKFNVE-----ILDQN-RFRLSYAQGQGEQ---------------GGE----YRF-
A0A1I5WSL8      ----RKFDLR-----FINKQ-RFILEFMGQGRPT---------------SGE----YAL-
A0A0U3JVM7      ----HKFDLK-----FVGPQ-RFALEFTGQGRPL---------------GGE----YSL-
A0A1G1SSV2      ----RKFELR-----FTGPS-RFKLDFVAQGRPL---------------GGE----YAL-
A0A1G1SXV7      ----RKFELR-----FTAPG-RFRLEFVGQGRPL---------------GGE----YAL-
A0A0W8EDI5      ----RKFDIV-----FSDAK-RFSLVSKAESGDV---------------RVD----GVF-
A0A3B7RBP8      ----KKIYIN-----FIDEQ-HFLLLYRKNDVEQ---------------KVN----GKI-
A0A3R9P8H7      ----QKIAVQ-----FMSPT-TFRLTLPESLGGG---------------VQE----HTI-
A0A238WIA7      ----TRFNLK-----FLSPN-RVQLTYLEGGQEV---------------VKE----TGF-
A0A212UCJ7      ----TKFGLR-----FLTPQ-QIELTYQENGQEV---------------IQK----AIL-
A0A4Z0MQE1      ----SKFGLH-----FLSPQ-QIELTYQEGGQEK---------------SQK----AAV-
A0A4Z0PCF4      ----TKFGLR-----FLSPQ-QVELTYQEAGQEK---------------TDK----ANI-
A0A5D6VDG1      ----TRFNVL-----FTSST-KFQLSH--EGHEA---------------TSE----YAI-
A0A243WHR7      ----TRFDLT-----FSNPQ-QFRLSYQYKGQEI---------------SAE----YRF-
A0A5B8A0P6      ----TPINIQ-----FVDNK-HFKISYNFQGQEV---------------NRE----HSV-
A0A076HRT9      ----TKFNLR-----FKDAQ-FFHLSYQKDGQEQ---------------GGD----YAL-
A0A4Z0PVM7      ----SKFNLN-----FTGPQ-QFRLSYMYQGQEK---------------TGD----YTI-
A0A1M6DHW8      ----TKFNLV-----FTGSQ-RIRLSYLYAGQER---------------SGE----YSL-
A0A4Q5LC61      ----TKFNLI-----FTGPQ-RIRLNYLYGGQEQ---------------SGE----YSL-
A0A2A8CVM9      ------------------------------------------------------------
A0A3C0ZQC7      ------------------------------------------------------------
A0A2E3R1D0      ------------------------------------------------------------
A0A2T2USC0      ------------------------------------------------------------
A0A2T2V0F3      ------------------------------------------------------------
A0A2T2S682      ------------------------------------------------------------
D5H561          ----AEGGAS-----GDDPS----------------------------------------
A0A2H3NWA9      ------------------------------------------------------------
A0A2A8CVB6      ------------------------------------------------------------
A0A2P6C1S6      ------------------------------------------------------------
A0A2T2UTM4      ------------------------------------------------------------
R5RVP0          ----FSFEIV-----NEKDS-TFVIKDLAVV----GETIKHTE------KIT----GRL-
R6A0L2          ----QHIDVV-----KKGSN-TVTLKGMTDRMGNDVPD------------VD----VQL-
R7LG80          KNMIVSLKIK-----KLDQN-TVEIKGFRNKKGKKTDE-----------KIK----ANF-
A0A2L2WX98      -----KFEVV-----KTGDR-KFALSNFERGKDKYKG------------KVS----IAV-
A0A285T4L1      ----ISFTVT-----PKNAK-QVLLSDFTGIPAANDK------------TYT----MRL-
G5GD56          ----VRFEAK-----IQADG-TVKLSDFVCYNRSTGKKKIFKE------HLS----VRP-
R5KD55          ----ASLHIR-----LKKDG-SIKMSEFVKNGKPQNSY-----------DLT----CHV-
A0A174QNT3      ----TELKVS-----VVNDK-QCRISNIEIEEETRDYD------------KI----VAF-
A0A4S2FGS1      ----TKFTVS-----VINEK-GVRLSQLEIDGNAQSYE------------QA----VAF-
R9I0H0          ----TELTVS-----IINEK-GVRISQLEIDGNAPSYE------------QV----VAF-
K5BUT9          ----VSFNIT-----PLNTT-KFRISDWKVMGEKGEIQ-----------EQE----LAY-
A0A174FPA3      ----VSFNIT-----PLNTT-KFRISDWKVAGEKGRMQ-----------EQD----LTY-
R6S9Y6          ----VSFNIT-----PLNTT-KFRISDWKVAGEKGRMQ-----------EQD----LTY-
A0A642LIH6      ----VSFNIT-----PLNTT-KFRISDWKVAGEKGRMQ-----------EQD----LTY-
C9KX15          ----VSFNIT-----PLNTT-KFRISDWKVAGEKGRMQ-----------EQD----LTY-
R6DAG6          ----YRTKVT-----PLDVK-NYTILG-----------------------EK----YAY-
A0A3L8AAP1      ----YRTKVT-----PLDVK-NYTISD-----------------------KK----YAY-
A0A4S2AYX2      ----YRTKVT-----PLDVK-NYTISD-----------------------KK----YAY-
A0A4Y9H477      ----YRTKVT-----PLDVK-NYTISD-----------------------KK----YAY-
A0A0E2M2Y7      ----YSFKID-----IKDSR-SFQLSDFKQQKLNRISEI----------KVE----GSF-
A0A0K2J6Z0      ----YSFKID-----IKDSR-SFQLSDFKQQKLNRISEI----------KVE----GSF-
B2RKZ8          ----YSFKID-----IKDSR-SFQLSDFKQQKLNRISEI----------KVE----GSF-
A0A212GC82      ----YSFKID-----IKDSR-SFQLSDFKQQKLNRISEI----------KVE----GSF-
A0A254MU12      ----YSFKID-----IKDSR-SFQLSDFKQQKLNRISEI----------KVE----GSF-
R6CQ93          ----FSFVVT-----PKDET-SVELSEIEGIPGAQE-------------TYK----VQL-
A0A3D1NQW3      ----FRFEVS-----LRPDS-IVKLNYFEIFGPDKQKFKQ---------EIS----AVF-
B0MT10          ----FRFEVS-----LRPDS-IVKLNYFEIFGPDKQKFKQ---------EIS----AVF-
R7JGW9          ----FRFEVS-----LRPDS-IVKLNYFEIFGPDKQKFKQ---------EIS----AVF-
A0A414Q925      ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
A0A415PUS9      ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
A0A108TCU0      ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
A0A413BA42      ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
S3Y344          ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
A0A4Q5G8Y8      ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
A0A412TGL3      ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
A0A413VJ33      ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
A0A414L0W6      ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
A0A412DP39      ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
A0A413ZSE8      ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
B0NP84          ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
R6AK43          ----ISLTVT-----MSDNG-KVTLADMTLQNEEEEEEFDE--------ILT----VQP-
A0A412N2D9      ----ISLTVT-----MTDNG-KVTLTDMVLQNELEEEEFDE--------SLT----VQP-
A0A1Y4JYS9      ----ISLTVT-----MTDNG-KVTLTDMVLQNELEEEEFDE--------SLT----VQP-
R6LHA4          ----ISLTVT-----MTDNG-KVTLTDMVLQNELEEEEFDE--------SLT----VQP-
A0A3D2BF46      ----LAFELT-----PVDNE-KFSLTKFVNRTSADSDKDKDSEI--YEVEMT----GRF-
A0A4Y1WUN1      ----LAFELT-----PVDNE-KFSLTKFVNRTSADSDKDKDSEI--YEVEMT----GRF-
A0A4Y1XL94      ----LAFELT-----PVDNE-KFSLTKFVNRTSADSDKDKDSEI--YEVEMT----GRF-
A0A358R538      ----AELTVT-----PLPDG-RLRLSDFDDGFLPKSERRT---------QIV----VES-
A0A1Y4AAB8      ----FSFRAR-----PLAGGEQVELTDFDDGYISDEERGR---------VVT----AAY-
A0A1Y3WWY9      ----LSMTVT-----PRGEQ-QIEISQFQDGFVSKQESRS---------VVT----AQY-
A0A1Y4U5L4      ----LSMTIT-----PRGEQ-QIEISQFQDGFVSKQESRS---------VVT----AQY-
A0A1Y3VCJ1      ----LSLEVT-----PVDDQ-NIRLSNFHDPFISKQESED---------RVS----ARF-
A0A1Y3QTW7      ----LSLEVT-----ELEDG-RIKLADFDDKYLTKQEKRR---------VIR----GQY-
R6XWY7          ----LSLEVT-----ELEDG-RIKLADFDDKYLTKQEKRR---------VIR----GQY-
A0A4Y1X9Y9      ----LSLEVT-----ELEDG-RIKLADFDDKYLTKQEKRR---------VIR----AQY-
A0A4Y1WM66      ----LSLEVT-----ELEDG-RIKLADFDDKYLTKQEKRR---------VIR----AQY-
A0A174AVF1      ----LSLEVT-----ELEDG-RIKLADFDDKYLTKQEKRR---------VIR----AQY-
A0A656Q4F4      ----LSLEVT-----ELEDG-RIKLADFDDKYLTKQEKRR---------VIR----AQY-
A0A1Q6EIY0      ----LSLEVT-----PLRNG-KIELTDFEDKFVTRQETKR---------VIL----AEY-
A0A5B5VN71      ----LSLEVT-----PLRNG-KIELTDFEDKFVTRQETKR---------VIL----AEY-
E4M8L3          ----LSLEVT-----PLRNG-KIELTDFEDKFVTRQETKR---------VIL----AEY-
I3YQ50          ----LSLEVT-----PLRNG-KIELTDFEDKFVTRQETKR---------VIL----AEY-
R5UEY8          ----LSLEVT-----PLRNG-KIELTDFEDKFVTRQETKR---------VIL----AEY-
A0A1H4D866      ----LSMEIT-----PLEGD-KVRLTNFEDRFVTKQETRS---------SIT----AAY-
A0A5B3G4Y7      ----LAMEIT-----PIDDD-KIRLSGFEDQFVTKHESRS---------VIT----AAY-
A0A374A9J5      ----LAMEIT-----PIDDD-KIRLSEFKDQFVTKHESRS---------VIT----AAY-
A0A5B3GQN5      ----LAMEIT-----PIDDD-KIRLSEFKDQFVTKHESRS---------VIT----AAY-
A0A1Q6E9S3      ----LAMEIT-----PIDDD-KIRLSEFKDQFVTKHESRS---------VIT----AAY-
D4IJ36          ----LAMEIT-----PIDDD-KIRLSEFKDQFVTKHESRS---------VIT----AAY-
A0A3E5HPT8      ----CSLSVI-----PKNKQ-QVELADFSLD--------ELEQ------RKT----VNL-
C6IJ48          ----CSLSVI-----PKNKQ-QVELADFSLD--------ELEQ------RKT----VNL-
Q8A3U2          ----CSLSVI-----PKNKQ-QVELADFSLD--------ELEQ------RKT----VNL-
A0A3R6S1H6      ----LQMVVT-----PLDDK-TVMLAGWKGD--------DEEW------KQK----VAL-
A0A3R6SD81      ----LQMVVT-----PLDDK-TVMLAGWKGD--------DEEW------KQK----VAL-
A0A354WXN6      ----FSLKAT-----PLDDK-KVLLHDFKIA-NTEGKLVEAGK------PME----VLL-
R5IP14          ----FSFDIV-----PISDQ-EVLLSDFTSN---------EDW------SKK----VQL-
A0A316SZX7      ----SGFTAK-----K-KGK-EIYLSDLRTS--AQVSDIDRDL------TIK----ASL-
A0A1Y4AIY1      ----FSLTAI-----PLSKE-KVRLFDFVTV-NEAGEPVEIKN------PQE----VVL-
F3ZRU7          ----IQLKG------KLKEN-QVQFTDVKTW---TGGEEVELP------HFS----VQL-
A0A0J6CIR2      ----FSLVAT-----PLSAG-EILLSGFSTN------E---AK------SLK----VAL-
A0A3D8HG59      ----FRLVAT-----AIDEG-KVALSDFEAD------SVDVSD------AVT----VAL-
A0A3R6S408      ----FRLVAT-----AIDES-KVALSDFEAD------SVDVSD------AMT----VAL-
A0A1C5Q1F3      ----FSFKVT-----PLNDK-EVLLSDFPEM-----EGVKPVE------QMK----VHL-
R7A239          ----FSFKVT-----PLNDK-EVLLSDFPEM-----EGVKPVE------QMK----VHL-
A0A3R6HIK7      ----FALKVT-----PLSKE-KVRLSDFIMA-DSNGQRVEIKK------AQD----VAL-
K5ZVW7          ----FALKVT-----PLSKE-KVRLSDFITA-DSNGQRVEIKK------AQD----VAL-
A0A1Y4D5Z0      ----FSLTVT-----PMSDK-EVVLSKFITR-NEEGKLVEIEK------AQR----VAL-
A0A413VXJ7      ----ILVTVT-----PIDSA-RVRLSDLKMS--VGDGEVTSNE------VLE----VNL-
I9RSN9          ----ILVTVT-----PIDSA-RVRLSDLKMS--VGDGEVTSNE------VLE----VNL-
U6RJK5          ----ILVTVT-----PIDSA-RVRLSDLKMS--VGDGEVTSNE------VLE----VNL-
A0A1Q6GA32      ----ILVTVT-----PIDSA-RVRLSDLKMS--VGDGEVTSNE------VLE----VNL-
I9RPU6          ----ITVVVT-----PVDSV-TVRLSGFSLA--VGGGGVHSEE------ALD----VHL-
I8YFS5          ----IEMTVT-----PVDSA-TVRLSDFSLS--IAGEEIRSAE------VVD----ARL-
A0A4Q5F7I7      ----IEMTVT-----PVDSA-TVRLSDFSLS--IAGEEIRSAE------VVD----ARL-
I8Y597          ----IEMTVT-----PVDSA-TVRLSDFSLS--IAGEEIRSAE------VVD----ARL-
A0A1Q6GBF5      ----IKVAVV-----PVDSV-TVRLSGFSLA--VGGGIIHSEE------ILD----VHL-
I8YFZ3          ----IRVVVT-----PVDSI-MVRLSGFSLA--VGGGEVHSEE------VLD----VRL-
A0A4V1YNX8      ----IKVVVT-----PVDSA-TVRLSNFSLA--VGEGEIHSEE------VLD----VNL-
A0A1Q6GDH2      ----ITVVVT-----PVDSV-TVRLSGFSLA--VGGGGVHSEE------VLD----VHL-
U6RSB0          ----ITVVVT-----PVDSV-TVRLSGFSLA--VGGGGIHSEE------VLD----VHL-
I9GXM2          ----IKVVVT-----PVDSV-TVRLSDFSLA--VGGGEISSEE------VLD----VHL-
I9SIK1          ----IKVVVT-----PVDSA-TVRLSGFSLA--VGGGGVRSEE------VLD----VHL-
A0A4Q5FNG1      ----IKVVVT-----PVDSA-TVRLSGFSLA--VGGGVVRSEE------VLD----VHL-
I9TP59          ----IKVVVT-----PVDSA-TVRLSGFSLA--VGEGEIHSEE------VLD----VHL-
R5S343          ----ATCAVT-----FMTCE-RVLLSGFKEE----------NR------EIE----AVL-
A0A1M6K7I9      ----IHVCVT-----PLSEN-KVRLSELLMI--VNNEEIQSVD------EPE----VAL-
A0A5M6A8C8      ----IRVCVT-----PLSEK-KVRLSELLMI--VNNEEIQSVD------EPE----VAL-
A0A4V1YPN7      ----IKTAIT-----PIDSV-TVRLSDFVLS--VNGEESHFAE------TVD----VHL-
A0A4Q5F874      ----IEMKVT-----PVDSV-TVKLSDLTLT--IGDEELRSTE------TID----VHL-
A0A641LV22      ----IEMKVT-----PVDSV-TVKLSDLTLT--IGDEELRSTE------TID----VHL-
A0A3R5ZMK1      ----FSLKAV-----PVSGK-EVVLSGFTLG----GQEVADGK------PVK----VAL-
A0A3E4ZTK7      ----FSLRAK-----PISAE-EVVLSDFVID----DE--SAGE------SMT----VAL-
A0A1Y3ZIA4      ----FSLQAV-----PVSGK-EVMLSGFTLG----DQEVSDGK------PMK----VAL-
K5Y1A4          ----FSLQAV-----PVSGK-EVMLSGFTLG----DQEVSDGK------PMK----VAL-
A0A4Q5CIT0      ----FSLKAV-----PVSGK-EVVLSGFTLD----GQEVADGK------PVK----VAL-
A0A3R6K8X4      ----FSLKAV-----PVSGK-EVILSGFTLG----GQEVADGK------PVK----VAL-
A0A414GI87      ----FSLKAV-----PVSGK-EVVLSGFTLG----GREVADGK------PVK----VAL-
A0A415BDM7      ----FSLKAV-----PVSGK-EVVLSGFTLG----GREVADGK------PVK----VAL-
A0A412DM15      ----FSLKAV-----PVSGK-EVILSGFTLG----GQEVADGK------PVK----VAL-
A7AEU7          ----FSLKAV-----PVSGK-EVILSGFTLG----GQEVADGK------PVK----VAL-
A0A1Q6I3T6      ----FSLKAV-----PVSGK-EVVLSGFTLG----GQEVADGK------PVK----VAL-
A0A414XX40      ----FSLKAV-----PVSGK-EVILSGFTLG----GQEVADGK------PVK----VAL-
A0A3R6BKI7      ----FSLKAV-----PVSGK-EVVLSGFTLG----GQEVADGK------PVK----VAL-
A0A414LPI6      ----FSLKAV-----PVSGK-EVVLSGFTLG----GQEVADGK------PVK----VAL-
A0A412M2W1      ----FSLKAV-----PVSGK-EVVLSGFTLG----GQEVADGK------PVK----VAL-
K5ZX55          ----FSLKAV-----PVSGK-EVVLSGFTLG----GQEVADGK------PVK----VAL-
A0A5F0U645      ----FGLTVV-----PVSDK-EVSLSGFFSEELEEEGQVQEDQ------TLT----VAL-
K5ZBN2          ----FGLTVV-----PVSDK-EVSLSGFFSEELEEEGQVQEDQ------TLT----VAL-
A0A0J6CKW3      ----FGLTVV-----PVSDK-EVSLSGFFSEELEEEGQVQEDQ------TLT----VAL-
A0A0F5IQM7      ----FGLTVV-----PVSDK-EVSLSGFFSEELEEEGQVLEDQ------TLT----VAL-
A0A496CDT3      ----FGLTVV-----PVSDK-EVSLSGFFSEELEEEGQVLEDQ------TLT----VAL-
S0GLB0          ----FGLTVV-----PVSDK-EVSLSGFFSEELEEEGQVQEDQ------TLT----VAL-
A0A3R6NLC1      ----IGLTVV-----PVSDK-EVSLSGFTSEELEEEGQSLEDQ------TLT----VAL-
A0A416WYC9      ----IGLTVV-----PVSDK-EVSLSGFTSEELEEEGQTLEDQ------TQT----VAL-
A0A0F5IT40      ----FSLVAT-----PLSAG-EILLSGFSTN---------EAK------SLK----VAL-
A0A496CX20      ----FSLVAT-----PLSAE-EILLSGFSTN---------EAK------SLK----VAL-
A0A5F0UBI0      ----FSLVAT-----PLSAG-EILLSGFSTN---------EAK------SLK----VAL-
S0GSI7          ----FSLVAT-----PLSAG-EILLSGFSTN---------EAK------SLK----VAL-
K5YB65          ----FSLVAT-----PLSAG-EILLSGFSTN---------EAK------SLK----VAL-
A0A0F5IWP9      ----FSLNVT-----PLTET-EVMLSDFSTD---------ETK------MLK----VVL-
A0A0F5IZT8      ----FSLNVT-----PLTET-EVMLSDFSTD---------ETK------MLK----VVL-
A0A417LKQ2      ----FSLTVT-----PLSEK-EVMLSDFSTD---------EGK------MQK----IAL-
A0A416TME1      ----FSLVVT-----PLSEK-EVLLSDFSMA---------EGK------MQK----VVL-
A0A416XPE8      ----FSLVVT-----PLSEK-EVLLSDFSMA---------EGK------MQK----VVL-
A0A5C8KAD6      ----YFTYNN-----KTKKVK-FDGMKY-----------------------------PL-
A0A5N1J695      ----YFTFNE-----GTHKIK-FQEKEY-----------------------------PL-
A0A1H4ADG3      ----YEFTLN-----GKSGFT-VSSDKH-------V------------------WKGKW-
A0A5B8VUR8      ----YEFHII-----STSGFE-ISSADH-------I------------------WKGSW-
A0A2A4G4B1      ----FDFALL-----DSE--N-FSLS-------------INGSEEMPLH-----FNKEIG
A0A3N2M1H3      ----FKMELS-----ADG--N-IKMREF-------RKFTIDGKIELAGEATL--PKG---
A0A4S2G8T2      ----FKMELS-----ADG--N-IKMREF-------RKFTIDGKIELAGEATL--PKG---
A0A212K7W5      ----FYIELL-----PQN--K-IRLANL-------T---LNGEELDFPD-----EEINL-
F5IU11          ----FQIELL-----SQN--K-IRLSDL-------I---LNGEELDFTD-----KEINL-
A0A3N2N6F7      ----MRMTIL-----EDG--K-VEVSD--------M---YDHLGNELDV-----MTVTL-
A0A4P7VVU7      ----MELDIR-----DDG--K-IDISKM-------M---LNGVECDPSE-----MTVNI-
A0A2V1ILM4      ----MELDIR-----DDG--K-IDISKM-------M---LNGVECDPSE-----MTVNI-
A0A3N2L0E8      ----MGLDIR-----DDG--K-IDISKM-------M---LNGVECDPSE-----MTVNI-
A0A3N2LFC5      ----MELDIR-----DDG--K-IDISKM-------M---LNGVECDPSE-----MTVNI-
A0A553LCN8      ----MNVTPL-----DVK--N-YTISNL-------V---VGGKK--LSIN----GNH-AY
K0XJ09          ----MEIKPL-----NGN--R-FLLNQL-------K---IGTKK--SDNE----GQEFLF
R5EUZ0          ----MEIKPL-----NGN--R-FLLNQL-------K---IGTKK--SDNE----GQEFLF
W0EQS0          ----MKIRPL-----DDT--H-YLLKQF-------S---VGGVK--SEDR----EQEIAF
A0A1Y3WE15      ----MKIKPV-----DEN--R-FLLKQL-------S---IGGGK--KSES----EQEIAF
A0A1Y4GUK3      ----MKVSPI-----DEN--H-YALKEL-------N---VGGKK--TNEG----NQQIAF
A0A352Z1R7      ----YRIEMT-----GADTFT--------------V---KDDDDKLVGEG----SSGRL-
A0A0A2F501      ----LTLTIL-----ANG--Q-FAISNL-------M---LNDNE--LQTQR---ITCSL-
R5B7P0          ----FTVS-E-----NGG--R-VTLNDF-------I---HKNEK--VGGKP---VVGHY-
R5B0L5          ----VIVKIN-----KKG--V-IVLSDL-------V---LNNIP--VDLPNS--GVAIP-
A0A374THP7      ----FQLQLK-----GDG--S-YVISKI-------KGSNRDNLP--VDDSDE--ISGRL-
A0A3R5XWG1      ----MTVYLK-----GGD--K-FELTDF-------KGTSSNGTP--VETNKT--VTGKL-
A0A5P0Y910      ----MTVYLK-----GGD--K-FELTDF-------KGTSSNGTP--VETNKT--VTGKL-
A0A5P0XQC0      ----MTVYLK-----GGD--K-FELTDF-------KGTSSNGTP--VETNKT--VTGKL-
A0A414YFM3      ----MTVYLK-----GGD--K-FELTDF-------KGTSSNGTP--VETNKT--VTGKL-
A0A5P0VXP6      ----MTVYLK-----GGD--K-FELTDF-------KGTSSNGTP--VETNKT--VTGKL-
A0A5P0W892      ----MTVYLK-----GGD--K-FELTDF-------KGTSSNGTP--VETNKT--VTGKL-
A0A0A2EVS5      ----LSVTVR-----GDG--M-VEVSDM-------I---LDGEP--MGEGQI--FLGEL-
A0A1T4NAJ7      ----LSLTVR-----GDG--M-VEVSDM-------I---LDGEP--MGEGQI--FLGEL-
A0A255T941      ----FVIKLN-----DEH--S-FTLYDF-------K---MYTEDGKVEYDKE--VKGNI-
A0A3N2KCL3      ----FRVEVD-----GDG--K-VSVSDV-------K---SGDLK--SEER----VQGAM-
A0A4P7VSV0      ----FRVEVD-----GDG--K-VSVSDV-------K---SGDLK--SEER----VQGAM-
A0A2V1IJY1      ----FRVEVD-----GAG--K-VSVSDV-------K---SGDLK--SEER----VQGAM-
A0A4P7VXK7      ----FRVEVD-----GAG--K-VSVSDV-------K---SGDLK--SEER----VQGAM-
A0A1Y4CHN5      ----FTIKPA-----ADG--T-LGFSDF-------V---RNGEE--SDAE----ATGKL-
A0A1M6I2S6      ----FKIDFS-----SKE--E-FTISDV-------M---INGEE--LETE----FSGKM-
A0A1Y3V692      ----FKIDFS-----SKE--E-FTISDV-------M---IDGEE--LETE----FSGKM-
F3PXM2          ----FDLELT-----SRN--D-FLLSGF-------K---VEGEE--TGET----FSGKT-
A0A3E4ZNL4      ----FAIEIN-----GSN--Q-FHLSEF-------V---VAGEE--TDEQ----FEGNI-
A0A174AHH7      ----FDIEVD-----TQN--K-FYLSNF-------I---VAGKE--TGER----FEGNI-
A0A174JCE8      ----FDIEVD-----TQN--K-FYLSNF-------I---VAGKE--TGER----FEGNI-
A0A3E4JMC4      ----FDIEVD-----TQN--K-FYLSNF-------I---VAGKE--TGER----FEGNI-
A0A412SND6      ----FDIEVD-----TQN--K-FYLSNF-------I---VAGKE--TGER----FEGNI-
A0A414IEQ9      ----FDIEVD-----TQN--K-FYLSNF-------I---VAGKE--TGER----FEGNI-
A0A415UKN5      ----FDIEVD-----TQN--K-FYLSNF-------I---VAGKE--TGER----FEGNI-
A0A0M1W8D8      ----FDIEVD-----TQN--K-FYLSNF-------I---VAGKE--TGER----FEGNI-
A0A3R6GKX5      ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
A7V4S1          ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
B0NU19          ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
D4V601          ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
A0A4Q0U3M9      ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
A0A4R4H1Q2      ----FDIEVD-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
A0A397WLT5      ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
A0A3R6GM96      ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
A0A015XH67      ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
A0A078RZN2      ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
A0A4R4I3T9      ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
A6L0K5          ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
A7ACT5          ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----FEGII-
A6KY94          ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----LEGII-
A0A173UQR8      ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TEER----LEGII-
A0A3R6HK75      ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TEER----LEGII-
A0A412B7D1      ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TEER----LEGII-
A0A412VNY9      ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TEER----LEGII-
A0A414LTU9      ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TGER----LEGII-
I9Q4U4          ----FDIEVG-----AQN--K-FYLSNF-------I---VAGEE--TEER----LEGII-
A0A373ISF0      ----FTIRID-----SKD--A-FTISGL-------K---VAGVE--SENT----FAGRM-
U6RF62          ----FTIRID-----SKD--A-FTISGL-------K---VAGVE--SENS----FAGRM-
A0A662ZZD5      ----FTIDIS-----SKE--T-FVISDM-------E---VNGKA--FGED----FSGKM-
A0A395YYT3      ----FTIDIS-----SKE--T-FVISDM-------E---VNGKA--FGED----FSGKM-
A0A642JYJ3      ----FTIDIS-----SKE--T-FVISDM-------E---VNGKA--FGED----FSGKM-
A0A015UXN7      ----FTIDIS-----SKE--T-FVISDM-------E---VNGKA--FGED----FSGKM-
A0A5M5W148      ----FTIDIS-----SKE--T-FVISDM-------E---VNGKA--FGED----FSGKM-
A0A3A5TI83      ----FTIDIS-----SKE--T-FVISDM-------E---VNGKA--FGED----FSGKM-
A0A415NEB6      ----FTIDIS-----SKE--T-FVISDM-------E---VNGKA--FGEE----FSGKM-
A7AJ60          ----FTIDIS-----SKE--T-FVISDM-------E---VNGKA--FGED----FSGKM-
A0A016E4F9      ----FTINLP-----SKK--E-FTISDV-------M---IDGEE--LGID----FSGKM-
A0A4Q5CFJ7      ----FTINLP-----SKK--E-FTISDV-------M---IDGEE--LGTD----FSGKM-
A0A108TH71      ----FTIKFS-----SKE--A-FAISEL-------E---ISGED--IGET----LSAQM-
I8VXH0          ----FTIKFS-----SKE--A-FAISEL-------E---ISGED--IGET----LSAQM-
A0A412S0N6      ----FTIKFS-----SKE--A-FAISEL-------E---ISGED--IGET----LSAQM-
A0A412IIJ0      ----FTIKFS-----SKE--A-FAISEL-------E---ISGED--IGET----LSAQM-
A0A0P0FM97      ----FTIKFS-----SKE--A-FAISEL-------E---ISGED--IGET----LSAQM-
R6KTP3          ----FTIKFS-----SKE--A-FAISEL-------E---ISGED--IGET----LSAQM-
A0A139LU87      ----FTIKFS-----SKE--A-FAISEL-------E---ISGED--IGET----LSAQM-
A0A1C6B3Y5      ----FTIKFS-----SKE--A-FAISEL-------E---ISGED--IGET----LSAQM-
E2NMQ4          ----FTIKFS-----SKE--A-FAISEL-------E---ISGED--IGET----LSAQM-
A0A412YDB9      ----FTIEFS-----SKD--T-FTISDL-------K---VSDES--TGET----FSAQM-
R7DY01          ----FTIEFS-----SKD--T-FTISDL-------K---VSDES--TGET----FSAQM-
A0A414LGK8      ----FTIEFS-----SKN--T-FTISDL-------K---VSDES--TGET----FSAQM-
A0A415IPQ4      ----FTIEFS-----SKE--A-FTISEF-------E---ISGES--IGET----FSAQI-
A0A3E5BRW7      ----FTIEFS-----SKD--M-FTISEF-------E---ISEES--TRET----FSARP-
K9DXS6          ----FTIEFS-----SKD--M-FTISEF-------E---ISEES--TGET----FSARP-
A0A1M6KFV3      ----FTIEFS-----SKD--T-FAISEF-------E---VSGVD--TRET----FSAQT-
A0A1Q6G7L3      ----FTIEFS-----SKD--T-FAISEF-------E---VSGVD--TREN----FSAQT-
A0A413H235      ----FTIEFS-----SKD--T-FAISEF-------E---VSGVD--TREN----FSAQT-
A0A1M5B2J8      ----FQLHLG-----KDG--H-YTISDL-------T---RNGTP--VEG-E---VNGQL-
A0A255RCT5      ----FRLHLG-----TNG--R-YTLYEL-------T---RNGEH--VGG-E---VKGKL-
A0A1Y4GLF5      ----FTVEIR-----PGR--S-FGLSDF-------T---RNGDD--MKSDK---ITGTL-
A0A1H3XSC0      ----FTLQVQ-----PDS--T-VRLSDF-------T---RNGNE--FDD-E---ISGRL-
A6LE40          ----FTLEVQ-----PDG--T-LFLSDF-------T---RNGTE--LDGKD---IKGSL-
A0A4Y1VPX5      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEEKD---VKGSL-
B3JI46          ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEEKD---VKGSL-
R6NN15          ----LTVEPA-----QSK--G-IKLTSF-------V---HNGEK--V--DGE--VVGTL-
A0A358R8U0      ----FTLKVR-----PGG--E-VELSEF-------V---RNGEE--IPSEKV--IKGNL-
R6WSB6          ----FTLKVR-----PGG--E-VELSEF-------V---RNGEE--IPSEKV--IKGNL-
A0A4Q5ENK6      ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--TGDDNA--VKGKL-
A0A401LPX7      ----FELYLA-----KDG--A-VELSSF-------T---RNGTE--IENDDI--VKGSL-
A0A3A5Z900      ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
A0A3R6EGW5      ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
A0A285TGL6      ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
A0A3A5RFX4      ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
A0A1Q6IUW9      ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
A0A3R6NPG7      ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
A0A413XDP6      ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
K6AP24          ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
A0A662ZYI7      ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
A0A078RYI7      ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
C7XEQ8          ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
D7INX6          ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
K5ZG55          ----FELHLA-----KDG--A-VELSSF-------T---RNGTE--IENDGF--VKGNL-
A0A3N2N9B8      ----MNVDIS-----PEG--K-ASISEL-------R---YAGKE--FKGT----FTGSI-
A0A3N2NMI0      ----LELNIS-----ADK--K-VTIREL-------K---QGELK--WEES----FTGSL-
A0A359I8H7      ----FRIELG-----KDG--N-VVLRKF----HLET---PDGDE--EIE-KE--VKAKIG
A0A3N2KA63      ----FRIELG-----KDG--N-VVLSKF----HLET---PDGDE--EIE-KE--VKAKIG
A0A4Q0IMT7      ----FRIELG-----KDG--N-VVLSKF----HLET---PDGDE--EIE-KE--VKAKIG
A0A3B9FAU3      ----MQMELQ-----PNG--V-VKLSNF-------M---RNGKP--VGS-PEVTVTGRT-
A0A3C1E5L7      ----MQMELQ-----PNG--V-VKLSNF-------M---RNGKP--VGS-PEVTVTGRT-
A0A4Q0UAV1      ----YSFTIT-----MVSATR-FTLSDF------------AGGA--GDT-KNLILSGEV-
A0A354SN68      ----FEIQLE-----KGG--K-AILSHFKGDFGDEV---VNDEE--AEM-KT--ILSQE-
A0A3N2N595      ----FDLMVN-----GDG--N-VTISGM-------K---IGEKD--IIK-AD--FSGKL-
A0A0A2DUD9      ----CILSQL-----PSG--E-LQLHSF-------V---LNGEK--TEVQDP--VTLVL-
A0A3P1ZBJ5      ----LSINYQ-----QDG--S-FELTGF-------E---SANTK--KKD-KELRIKGRF-
R5FHS9          ----FTVKME-----GTR----FVLSKF-------I---RNKEE--LDG-ED--VTAKL-
A0A413TW79      ----LDVEVK-----HGNLFSIVHVSGT-------D---KAGNQ--VESDEE--VQGKL-
A0A3E5E9M7      ----LDVEVK-----HGNLFSIVHVSGT-------D---KAGNQ--VESDEE--VQGKL-
A0A3E4SK73      ----LDVEVK-----HGNLFSIVHVSGT-------D---KAGNV--VESDEE--VQGKL-
A0A415GGC6      ----LDVEVK-----HGNLFSIVHVSGT-------D---KAGNV--VESAVE--VQGKL-
A0A413DBH9      ----LDVEVK-----HDDLFSIVHVSGT-------D---KDGNQ--VESDEE--VQGKL-
A0A495WI87      ----LTVKIL-----ADS--T-VELSDF-------I---RNGEE--LPG-KL--VKGQL-
A0A354M4S6      ----LTVKIL-----ADS--T-VELSDF-------I---RNGEE--LPG-KL--LKGQL-
R7DH52          ----LTVKIL-----ADS--T-VELSDF-------I---RNGEE--LPG-KL--LKGQL-
A0A4Q5E7L5      ----FTLEIH-----PDS--T-LLLSDF-------T---RNGTD--LDG-KD--IKGRL-
A0A4P8LP09      ----FTLEVR-----PDS--T-LLLSGF-------T---RNGTD--LEG-KD--IKGRL-
A0A4R4GZU7      ----FTLEVR-----PDS--T-LLLSGF-------T---RNGTD--LEG-KD--IKGRL-
A0A016CWA4      ----FTLEVR-----PDS--T-LLLSGF-------T---RNGTD--LEG-KD--IKGRL-
A0A1C6H117      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A415TAH7      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A0M1W0V2      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A139KA16      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A174VQ92      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A1Q6HCG0      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A1Y4JYM9      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A3A5QW67      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A3A5RQE6      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A3A6BP07      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A3E5E153      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A3Q9IP20      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A412WV15      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A413ICP6      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A414KYB9      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A5B3FWR2      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
E5WX00          ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
K0X3P3          ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-
A0A3A5Z014      ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDE-KD--IKGSL-
A0A1M4YZ07      ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDG-KD--IKGNL-
A0A078S3Q8      ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-
A0A069SJV7      ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-
A0A3E5DXI5      ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-
A0A3E5EM98      ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-
A0A3E5F453      ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-
I9T3G6          ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-
A0A4Q5E5M7      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-
A0A0P0FQW1      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-
A0A5M5C0W6      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-
A0A642LZ22      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-
A0A5M5YM86      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-
A0A642LE65      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-
A0A5M5Y0P8      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-
A0A642NJ89      ----FTLEVQ-----PDS--T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-
C3RFN5          ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDE-KD--IKGSL-
A0A3E4SYU0      ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDE-KD--IKGSL-
A6LGY1          ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDE-KD--IKGSL-
K5ZSH4          ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDE-KD--IKGSL-
A0A078T2W6      ----FTLKIQ-----PDG--T-LYLSDF-------I---RNGTD--LDE-KD--VKGSL-
A0A3R6EAF7      ----FTLEVQ-----PDG--T-LFLSDF-------I---RNGTD--LDE-KD--IKGSL-
A0A5C6L2P1      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A412MJT7      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A3E4WKT5      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A3A5YY33      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A078TAH2      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A1E9CFZ7      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A373FYU5      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A3A5TZ72      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A3A5XBP2      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A3A6MEG9      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A3E4JP35      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A3E4KP40      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A3E4NX82      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A3E4XFU8      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A412RG70      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A412TD37      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A413GAA4      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A414M7I4      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A496BTA0      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A496D2V6      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A4Q5EN83      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A4Q5G1P5      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A5C6KCA6      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A5M5AHM5      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A641WNS6      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
E5UZA2          ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A069SMG6      ----FTLEIQ-----PDG--T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-
A0A1Y4PQK7      ----FTVNVY-----KDG--H-VQLSDF-------V---LKGES--LKEVKP--VTGKF-
A0A1Y4IH41      ----FTVNVY-----KDG--R-VQLSDF-------V---LKGEL--LKEVKP--VTGKF-
A0A3A6AAP4      ----FTVNVY-----KDG--R-VQLSDF-------V---LKGEL--LKEVKP--VTGKF-
A0A1Y4DYA7      ----FTIFPV-----SGN--KGVELTDF-------I---HGGEE---SD-KR--IVVEF-
A0A1Y3X4I9      ----LTILPV-----SGN--KGVELTDF-------V---RGEEE---SG-QA--VKALF-
A0A1Y4FNK8      ----FTVNPS-----SIG--Q-VKLTDF-------V---HNGED---VD-GE--VTATL-
A0A355FD59      ----LTLRVS-----EDS--T-VVLSDF-------V---WGDGS--KSS-KA--IDTRL-
A0A359CEZ9      ----LTLRVS-----EDS--T-VVLSDF-------V---WGDGS--KSS-KA--IDTRL-
A0A353Q7B4      ----LTLRVS-----EDS--T-VVLSDF-------V---WGDGS--KSS-KT--IDTRL-
F8X3A5          ----LIIKLL-----ADG--T-FECSDF-------A---CDNKD--IAN-NV--IKGKL-
A0A1M3KVR9      ----LVIKLL-----ADG--T-FECSDF-------T---SDNKD--IAN-NV--IKGKF-
A0A4Y9IJS3      ----LVIKLL-----ADG--T-FECSDF-------T---SDNKD--IAN-NV--IKGKF-
A0A4Q5WS95      ----FTYDAA-----AR--------------------------QVRIGA-----AAYPL-
A0A501VZX6      ----FHYNRA-----SK--------------------------QVIINN-----DEYST-
A0A399SH26      ----FTYNPD-----LE--------------------------EVTVDG-----KSYPL-
A0A501W1A9      ----FTYDEA-----KK--------------------------QVIIDN-----KPYNL-
A0A0E3ZGV6      ----FTYDES-----SK--------------------------EVIIDS-----KKYSI-
A0A1I2N4S1      ----FTYDQA-----TQ--------------------------KVQIDG-----KEYPL-
A0A2T5YE44      ----FTFDQA-----TQ--------------------------KVKIDG-----KEYPL-
A0A1V9FHD0      ----VNYFPG-----PNG--KASK----------------EIKEVVIDK-----KAYPM-
A0A4V4H170      ----VNYFSD-----NNG--GEFRDVIK------------KVREIVIGE-----KIYPI-
A0A1V9F098      ----VNYYDD-----NNA--GEFRNVDE-----------PKVKEVVIGK-----KVFPI-
A0A4R2VU64      ----VNYYAN-----NNA--GEFKELSN-----------LKVKEVVIKK-----KTYPV-
A0A4S8HY23      ----VNYFSN-----NNA--GEFNGLIK-----------QKVKEVIIDN-----NAYPI-
A0A1V9F383      ----VNYYTD-----KER--RAATNVYK-----------DKVKEVVIEN-----RKYPL-
G8TRZ6          ----VNYYSP-----KEM--QVAHNGYK-----------DKVKEVVIEN-----KKYPL-
A0A543WA52      ----ISLAGD-----KN--------------------------KIKIDN-----KVFSL-
A0A1M5BA90      ----FVYNKG-----NN--------------------------TVAIEG-----KMYSL-
A0A512B879      ----FTYNKI-----KK--------------------------TIDIAG-----KSYPL-
A0A559PPI3      ----FTVDFS-----KK--------------------------NVKVDG-----RIYPL-
A0A1T5CS78      ----FNYNFN-----EE--------------------------NVVFSG-----KEYSL-
A0A0Q9Z8F1      ----FKYNAN-----DE--------------------------KVIFSG-----KEYSL-
A0A2N0U0M7      ----FKYNAN-----DE--------------------------KVVFSG-----KEYSL-
                                                                            

A0A1T5MMH4      GAPVH-ISGI------------------E-LTLRKNENFLDEN----DID-------LFF
A0A2W4R1L8      GEPID-LNGL------------------T-VTIHRNPAFTSES----GLN-------CFF
A0A2E5CV79      ---------------------------------------------------------EHY
A0A2D4ZVH1      ------------------------------------------------------------
A0A0K8QSK7      GERFS-GNDY------------------S-FAIRVKENAPSGL----SGT-------YAI
A0A1V6CN82      GEEVVIPGQC------------------S-FKINLNEGFFPPV----TDY-------FFF
A0A1M4XZ45      GTKLK-AEQF------------------S-ITILLNEKFNPNA----ANS-------YKF
A0A399D319      GTKIT-SDEF------------------S-FTILLNELFDSNA----SNN-------YKF
A0A1M6GR99      GQVVE-TDDF------------------K-ILVTINENDSLLS----SDNRR-----FAF
A0A1M6TTV4      GEMIS-HRLG------------------E-LTIQKTSNFASQK----NLVE------FYF
A0A4Q8RX32      GKTIE-SEYF------------------K-FTVLLKEGVALEE----VSAND-----YFF
K0X1U5          PIKVD-YGE-------------------G-IVIDKTEFYKPGK----KLK-------FVA
R5EXK3          PIKVD-YGE-------------------G-IIIDKTQFYEPGK----KLK-------FVA
A0A401UAP7      GKVVQ-MEGF------------------K-VLIESAKGYTYEP----KNT-------YSF
A0A1W2GF52      GNPIV-TKDF------------------S-FTLEKTNFFDDQK----NLID------FYF
A0A2G5L7B8      GKKIN-TAFG------------------E-LIVSKTIFFKEQQ----NLID------FYF
A0A523GAC0      SQ--T-IQNE------------------H-FALRLTMNLPLNE----VDKDQL----YSF
L8JW09          GEHAN-LPDI------------------E-FIIYLTNYF---D----PKGDKN----FFF
A0A5C7MX19      GQDIY-SPSFK-----------------G-VVIKKVPKFQKQD----FRGV------FYV
A0A364XUP5      NEPIN-LDAS------------------V-VTIKRNPNFKESD----EEIE------FFF
A0A1M5RLA9      NSKVS-LNGV------------------D-LYIEKNEAFRKGD-----EIG------YFF
A0A385SFR9      NSKVS-LNGV------------------D-LYIEKNEAFKKGD-----EIG------YFF
A0A5M4A9J4      NEVIE-RSEF------------------A-FRIIPVNGATLPE----GT--------YRF
A0A5M4B1C7      NKTTT-DSQF------------------S-FCVVPKNGEPIPS----GT--------YRF
A0A0D3LFR6      GQAVE-TGSF------------------N-LTLTLLEGTTGDA----INSN------YYF
M7N6D4          GQTVE-TDPL------------------T-FSLSLRNGINKDI----PESR------YYF
A0A1Q3ZMZ7      GKLIS-TPHF------------------E-VIINGDKESFSSS----RDND------LYF
A0A2D8JJW3      KDGCD-LPKYRQLHVLNTRDYKPVGWRET-FNSAISLFGLWPV----SNQKKHDLVNYTF
A0A2W2AFF7      GQTVS-LPIG------------------K-LQVIKNPLVKADE----EE--------YRV
A0A2N5YXE2      EEWQS-VFGM------------------E-VFIHFPSKKDMEF----ELNPDNKSQ-YFF
A0A2W1NDY9      DQLVD-NEYF------------------K-FVFKINNEKVFKA----DLEKDD----LFF
A0A5C8AQR5      NDVIQ-NNHF------------------K-IVVKTASIGAFKF----ASEANQ----LYF
A0A1G0CI31      NSRFS-NQHF------------------D-IAFKVDNIENLRS----DDEQNE----LYF
A0A556N0M0      NKTIH-TRHF------------------D-IAFKVENWNILKQ----DDEANR----LYF
F2IKD6          NQTIK-TSHF------------------E-IGFKVNNWQSLKQ----EDVSND----LYF
A0A1I7BM74      NQAHK-NEFF------------------H-IFIKSENEEVLKR----DINDNE----LYF
A0A2G2FJ17      NKLLA-TPYF------------------D-LEIEIPNWESFVT----DAETNV----LYF
A0A077ENE7      NKLTS-TPVG------------------K-ILITPSKYYKKDY----YGVE------IQV
T0NN57          NQSVK-TPFG------------------E-VLIVPSKFYGTDF----YGKD------IQV
X5K347          NQSVK-TPFG------------------E-VLIVPSKFYGTDF----YGKD------IQV
A0A2I0QZ80      NEILK-NNLF------------------D-IKMKVNDFQELKT----DAETNQ----LYF
A0A3E1F1A3      NSLVQ-TPFF------------------K-MRVDILNWNQFKT----NSSNNK----YYI
A0A2U2XBJ3      NSLLK-TPFF------------------D-MRVIVDNWSQFVL----NSTSNK----LYF
A0A4Q4KU94      NSLLK-TPFF------------------D-MRVSIDNWDQYLA----NTTSNK----LYF
A0A2U1FKU2      GQPVA-TPVG------------------E-LQIDQTPFFVAAW----KGQV------VYV
A0A0A2F954      GRPIA-TPVG------------------E-LKLDTTLFFADSW----KGEV------LYV
A0A0A2FW91      GRPIA-TPVG------------------E-LKLDTTLFFADSW----KGEV------LYV
A0A2D2N2N1      GRPIA-TPVG------------------E-LKLNTTLFFADSW----KGEV------LYV
Q7MWZ2          GRPIA-TPVG------------------E-LKLNTTLFFADSW----KGEV------LYV
T2NDT6          GRPIA-TPVG------------------E-LKLNTTLFFADSW----KGEV------LYV
W1R7P9          GRPIA-TPVG------------------E-LKLNTTLFFADLW----KGEV------LYV
A0A1R4AFZ0      GRPIA-TPVG------------------E-LKLNTTLFFADSW----KGEV------LYV
A0A1R4DVZ7      GRPIA-TPVG------------------E-LKLNTTLFFADSW----KGEV------LYV
A0A5M4B212      NSYVA-SDDY------------------A-FRIIPAADTQLEG----S---------YRI
A0A1T5K9D4      GDKVK-IGDG------------------S-FTIDKTRNLGKHW----FGEA------IYI
A0A3D1KEX9      GQSFN-SPAG------------------N-IRISQAEFDPEFV----GKI-------IHV
A0A358Y7S2      NSRFK-NPQF------------------D-IMFKVKNIDELKE----HCAENE----VYF
A0A1X7J248      GQEFI-VDGC------------------K-YKLEITPHFFNTE----S---------LTF
E4TQD2          GEYFT-FNGC------------------G-YKLETTPHFFNTE----R---------LFF
A0A2J6HHN3      YESVV-LPKV------------------I-FSVEPVDTVNFMQ----KFKNRE----FIV
A0A1Y3WMT8      PIRVD-YGEG------------------I-VIDTTRYYNPDKK----LR--------FVA
A0A1Y4GQU1      PIKVD-YGEG------------------I-VIDKTSYYKPGEK----LR--------FVA
A0A1V5W8T5      NEWTQ-IQGL------------------K-LYVNIINVEQILE----NKGNK-----FYF
A0A2T8HKA9      REETT-TPIG------------------K-LTISSNKLYKPSI----FGEE------ITV
A0A3B8INU3      GETLS-VPHL------------------D-LRLESTSHLNSSY----LGEP------MYF
A0A414ZBF2      GDTTD-TPVG------------------K-VVVASTLFMNEEY----MGKP------VYV
A0A1Q3Q573      EQKLK-TPYF------------------Q-ATISLKPDKLSDG----SFNSL-----YFV
A0A662BAY3      NEVIK-TDYF------------------S-FIIKPKRERNKIE----TAT-------YKF
A0A4U3L369      GDTVH-YNKF------------------V-FYINRNKYIKIDK----DNEDK-----FFF
A0A357YNR3      DSTLK-FPFG------------------E-IEVATTPIIHSRN----MM--------VEI
A0A5E8AX52      GETIS-TPDY------------------N-LLIEKTENFAEDN----GIGK------YYF
F4KK08          GDTIA-TPIG------------------K-VVVEATPYYSNFP----NYEV------LKV
A0A496LCF9      NEPIG-CKYF------------------L-VKVIPNSDFMDLK----T---------VNF
A0A5P2G2A9      GDSIP-LSKG------------------K-FVIYKQTFFDKKK----AN--------YTF
A0A419VXB7      GEKFE-NRYF------------------S-FTLQKKVLPTEGD--------------YYF
C3J7R8          GVPQD-TPMG------------------R-VLVTATEHFPSSE----ASFS------LEV
A0A0B0BTJ4      GETIR-DTVG------------------V-FRLERAVATAGYN----PKAANS----LRI
A0A3B9CNN6      GETIR-DTVG------------------V-FRLERAVATAGYN----PKAANS----LRI
R5X290          GETIR-DTVG------------------V-FRLERAVATAGYN----PKAANS----LRI
A0A1Q6E6I7      GETIR-DTVG------------------V-FRLERAVATAGYN----PKAANS----LRI
A0A1G8BVM8      DSVVA-FSHG------------------K-IKIKPTIFMHSGY----IGQN------III
A0A2G2F510      NEHLK-NEDF------------------D-VVVKVISDDALRD----ASTINE----LYF
A0A316JZ08      NKHVT-NDDM------------------N-VVVKSANPKVFRK----MASENE----LYF
A0A1I1FXP9      DKTYE-NQDV------------------K-FKITKTPFYKPDV----INYE------YFF
A0A3N4H5N3      NEKIR-TNFG------------------V-FSLVKKEEEGERL----ESVSS-----FVL
A0A2P8EAX2      GDKIK-TEFG------------------V-FSLEKKSEEDAIS----FPFST-----FVV
A0A4V2F6N9      GDKIK-TEFG------------------V-FSIEKKSEESAVS----FPFST-----FVV
A0A3B9FXJ0      NKPYS-TPAF------------------S-ISVSRNGKGKVLA----ES--------YEL
R5GSU5          GQRIA-TPAG------------------N-VYLTRKMNLEGLE----PTTVTVSRLPVF-
A0A2A3UE91      NSWLK-TADF------------------D-INIYLNPNIQASV----INEIVKDNKGFYF
A0A0A2G557      GETIE-TPIG------------------S-FFLTSNTIATSKK----EP--------IEI
A0A2N2WFW8      HETVS-LPQV------------------N-FLLTPVAGDAKSF----FAANNGKQ--FLI
A0A1F3IU95      HEPVS-LPQV------------------N-FVLTPINNDAHAF----FKSNRNKQ--FIV
A0A3D0VUF6      HEPVS-LPQV------------------N-FVLTPINNDAHAF----FKSNRNKQ--FIV
A0A1T4PT95      SDRVV-LFGE------------------T-IETPIGSFVLTGN----PSTEVEDKE-IKI
A0A4P5TMD1      NQKTI-TPHF------------------N-FIAKLTAHDFKNN----PNVYLSSN--YYF
A0A651GU15      NDYVR-TRFF------------------E-GRIDLAPPLEENS----DKGSYNE---LYF
A0A3Q9FR88      GQRFS-LGGR------------------P-IIIRSKSPNVDNN----K---------YSF
A0A553GEX3      GQRFS-LGGQ------------------P-IIIRSKSPNVDNN----R---------YSF
A0A150ADJ9      GKPLF-FEGA------------------D-IIIEPNSKSTINN----T---------FSF
A0A1B1FWQ4      GESII-LGGQ------------------S-LIITPKNKILETN----K---------YSF
A0A1S1Z228      GEQII-LGGQ------------------P-LIVTPKNKILETN----K---------YSF
A0A2A4PYG9      GXWXA-LEHL------------------E-VKIDVTDFSLIST----QQNQFAQNP-YFF
A0A1F3K695      NVWSN-IGLA------------------E-IKLKIDDTSQIQA----QLSDLKQNS-FYF
A0A353KZR1      NVWSN-IGLA------------------E-IKLKIDDTSQIQA----QLSDLKQNS-FYF
A0A2N2WYB5      NQWTA-IQGG------------------E-IKVSILNIDDIES----QQEYYKSNR-YYF
A0A1F3K4G0      GKWSA-IRAD------------------S-IRCTVSDYLTIES----QKENYKGNR-FYF
A0A356H8Y3      GKWSA-IRAD------------------S-IRCTVSDYLTIES----QKENYKGNR-FYF
A0A351HSA6      GKWSA-IRAD------------------S-IRCTVSDYLTIES----QKENYKGNR-FYF
A0A1F3Q014      NKWMK-FPEM------------------D-LFISIKNFTEIAN----EQNVVKKNA-YYF
A0A2A4YXP3      NTTIH-LPKV------------------D-LKITLLRKE--------NYEILKEGN-LYF
A0A2D5KD44      GKSCH-LPFA------------------E-VIVTVTDYSRIKK----EVEAVKGIE-YHF
A0A1F3R158      REKIQ-TNLA------------------E-FTVIFNNYEEAKN----AQSDIKNTL-LFF
A0A2M8ADX2      NQDIK-LSKV------------------D-FKISIDGYEELKK----SQSDIKGTS-IFF
A0A1J5B2H0      TEKIV-FQDV------------------D-LDVKVTNPEVVFN----KSGILNSDN-YYF
A0A1V5N756      LDTLK-TEYF------------------D-MFVTLKDPG-YFK----NISFIDKDD-YFF
A0A1F3SJM1      NEHFV-NDDM------------------D-VVIKSTNKQLFIS----TSQNDD----LYF
A0A2G2EB96      NERIK-NEDF------------------D-VVVKATDPHSFYQ----VSKENE----LFF
A0A2G6PRA9      NEHIQ-NSDF------------------D-IVVKAADPDNFHK----VSKEND----LFF
A1ZKR2          DQPIV-TSYY------------------S-FKVIKTSFYKPAF----RQIP------FYF
A0A1Q3GX01      DQTIN-HSGL------------------S-FKVIKTPFYKKRF----HNIP------FYF
A0A349DQI4      NQTVK-YPGF------------------S-FKVIKTPFYKKRF----HNIP------FYF
A0A2N3IIZ0      GEWLK-NKDV------------------E-LLITQKMPLSTYS----EN--------IYF
A0A497D5Z2      GTPVG-TDNF------------------S-FTVYADGNANYDL----NNYDE-----YFF
A0A662B170      GTPVV-TDNF------------------S-FTVYADGNANYDL----NNYDE-----YFF
A0A2A5FYT6      NEIII-LPHV------------------N-LRIKDVDFIQITT----SKKQLKQND-YFF
A0A2E6SYP1      NTWTD-FEGL------------------A-LKINISNINQNKL----SDQNLK----FLF
A0A2E5RLE8      NKWVS-IDGL------------------E-LKINISNRKLNEL----NNSGKK----FLV
A0A2E7TQF6      NKWVS-IDGL------------------E-LKINISNRKLNEL----NNSGKK----FLV
A0A2E6GVY9      NKWIS-INGL------------------E-LKINISNRNLNDL----NDSGKR----FLV
A0A350JJ90      EDTIQ-TPHF------------------S-F--TIVRLDEAQA----QSSGLTEDR-KYF
A0A3M1CDV2      NTWTK-HEWL------------------D-FFIRLNEKRDTTS----IRKDLYNNQRTFI
A0A522EYA6      GTAVS-APEM------------------N-FTITVLNFPEIQS----QQNAVKGNS-QYF
A0A4P5U6G4      GKKIR-TPHF------------------D-FTAN-TDQEVLKS----NIESLKTGQ-FYF
A0A2E2TFD1      DGDIE-LPFV------------------T-LSIKILDFDIIKN----DQETGTRND-VFF
A0A2E4ELE6      KWE-D-LGFV------------------E-LKFIIIDFDIIKS----EQTDLSNND-FYF
A0A2E3XZI5      NKFFS-SKYI------------------S-GILKID--WELEE----FKKNLEKSN-FYF
A0A2M7NLQ9      NTRIK-NQYF------------------K-LIISLSDTFDKLK----STSDS-----YFF
I4AFR0          NTRIK-NQYF------------------T-LIISLNNTFDKLQ----SPSSN-----YFF
A0A2N2Y3E5      GEWLN-FYGS------------------W-LRIEIRDTAALLE----YENMLKKDG-LFF
A0A2D9D7T6      NKPIK-TKSF------------------E-IIVKAKNKFGITE----INKNNR----LYF
A0A1F3PPL5      GKWEN-INGI------------------D-VKVTITNYKGIEE----LHKSLNHES-FFF
A0A357QK06      GKWEN-INGI------------------D-VKVTITNYKGIEE----LHKSLNHES-FFF
A0A662AEA4      NTWNL-ICGG------------------E-IKLNINNYKRIEL----QQSNLKKTA-YSF
A0A0S2HYK8      GKWTD-LGIL------------------S-CKAEILRYNVIKS----MYESAKQNS-YYF
A0A2N5ZWN6      NEWNE-LGYF------------------K-IFVTINNFAAIQS----MYEKESQNS-YYF
A0A0F2NS19      NVPIE-LKEV------------------T-LRIVFDNYNEFGA----DKNNS-----MFF
A0A2A5H8X6      NVPIE-LKEV------------------T-LRIVFDNYNEFGA----DKNNS-----MFF
A0A2H0GAU8      DTPIK-LKQV------------------D-LKIQIDEYESLKD----VKNNK-----MLF
A0A2M8FTK1      DTPIK-LKQV------------------D-LKIQIDEYESLKD----VKNNK-----MLF
A0A2A5B3B0      NETIN-HPKV------------------E-LKISLLDKDLYVT----PQGGD-----LFF
A0A5C6RXM7      GELIV-IDKI------------------D-FKIKILKEKV-TD----FIGAV-----IYF
A0A2E0FJ09      NESFS-TEHF------------------I-CSIQISDLNRFYA----QQNDGE----FYF
A0A1F3FZ62      NETVK-LPEM------------------E-FVLKLNPKSSIKT----DLNADE----YYF
A0A1F3K211      NETVK-LPEM------------------E-FVLKLNPKSSIKT----DLNADE----YYF
A0A1F3KLL5      DRWNK-INKT------------------E-IKININNIDDLLA----DKQNLKQNS-FYF
A0A359D1M1      DRWNK-INKT------------------E-IKININNIDDLLA----DKQNLKQNS-FYF
A0A2E7CT70      GDFFS-SNYI------------------S-GKLIIDDIPTFSE----SLDKFN----YFF
A0A2D5V560      NKFFS-SEFI------------------S-GKLKFSS-NNWKD----NLNSMSTNERLFF
A0A2D7K5A8      NKFFS-SKFI------------------S-GKLSFSN-GNWKD----LLSSLSSNERLFF
A0A2E1XQ82      NKFFS-SKFL------------------S-GKLSFSN-EDWKD----FLSSLSSNERLLF
A0A1V6I2U9      EELQT-IYGM------------------D-IYVHFPSKKDLEQ----ELDPQNKSQ-YFF
A0A1F3C1M2      GEWID-LDLI------------------E-FKLTVNNYNAILE----EHDELTKNN-YFF
A0A1F3DS87      GEWID-LSLV------------------E-LKLTVSNYTAILE----EHDELKKNN-YFF
A0A2H0B957      NAWTD-IGGF------------------E-IILNITDLAAIRE----QSNKIKTDS-YYF
A0A1F3CFW6      NKWTD-INGL------------------E-IKIEVTDIDAIRT----QINKIKNDS-YYF
A0A2M7E2T8      NQWTD-INGL------------------E-IKIEVTDIDAIRT----QINKIKNDS-YYF
A0A2M7NC69      NQWTD-INGL------------------E-IKIEVTDIDAIRT----QINKIKNDS-YYF
A0A5C8A5B4      EVDQV-VPMD------------------S-MFVGDR---LSFRIKFPEDRMYDKNTKYHF
A0A4Y9ITE2      -AKFD-TPYG------------------D-FVFQKKDAFY----------EEGKPLNITI
A0A5M8NYX7      EAQGA-DFQK------------------T-FKIDEEINSPWGTLTFEKNPFGTGEYPIVV
A0A3D5KRY6      KHIQF-HKEQ------------------T-LGEAFKNEFFQFTISAKTGVAPQEDEEYVL
A0A1V5IPN7      GNLRR-IQIS--------------------------------------------------
A0A0E3V905      NHAIE-TPYG------------------R-LKIVTKKQTF------------DSENPYSI
A0A553ETH6      SGAAE-YKTG------------------E-LVSTPQLNFT---LELTEHYDENGESDYFF
A0A640Q161      DALKA-NIVE------------------A-LPFLPQDDPK-------------ELTEEQL
A0A640QU49      DDIKA-QLTE------------------W-LPFLPQEEVK-------------TLTPEEI
A0A1Q3PII2      RTPSN-IYKG------------------T-FGIPMALPHG-LSIIDTTRFKPASHYLYSF
A0A351BXT2      ---ID-EDKK------------------K-FYYILNHGEN-----------------EDV
A0A2K8Z965      NKSIE-TPYG------------------R-LKIVSRKATA-------------RIKKMIV
A0A418M8U8      NQRIK-TPQG------------------R-FLIKTRRSVG------------DTTNQVLV
I2GTA4          NQRIK-TPQG------------------R-FLIKTRRAVG------------DTTNQVLV
A0A2K8ZAJ2      NQSIK-TPYG------------------Q-LRIFVRKPLS------------SKLKPIFA
A0A368JPA3      NQIIN-TPFG------------------R-LQIFIKQPVV------------YTNEPLVV
A0A5N1JI29      NQIIN-TPFG------------------R-LQIFIKQPVV------------YTNEPLVV
A0A3P1BT12      NQIIN-TPFG------------------R-MQIFIKQPVV------------YSNEPLIV
A0A3P1CI15      NQVIN-TPFG------------------R-LKIFIKQPVV------------YSNEPILV
A0A4R8CUK1      NQSVT-TPFG------------------R-LRMLVNEPVD------------YANEPVSV
A0A3D0MYJ7      LINED-GLRK------------------R-LEGMASITAP--------------------
A0A662AH13      NNNP----------------------------KPLKSVPAIAKMLEDTKIEQK-------
A0A5C7QA01      NTAEV-LLQA------------------Q-LNKKVKIHNRMGLWTVEINSKDIQSGLYNI
A0A3D3LS70      HILQD-ELTE------------------L-LGGIVSISQK--------------------
A0A1G1TM36      AADGT-LTRH------------------A-FGRPISDSLGTWQLNATASLRGFEGGEVRI
A0A1G7ZF38      QTSDH-YYKG------------------S-FGKKLSLPHG-AAIMDTTRFKPSSHYQYSF
C6VS52          EISGS-RFRG------------------R-FSSPLALPQGVAVIVDTTRFKPSALYQYSF
A0A0P7X1V8      PEDSS-IVTA------------------D-TVFARL------------------------
A0A3B0C2S4      TVPIQ-LPFN------------------I-TFLENA-----------QPIAYEGI-QFRV
L8JI02          GKPFR-THSL------------------A-FTIRPN-----------ELYAPKENTRYYF
A6EBM4          NSRIK-VGNV------------------S-FMIRNT------------AQAAPSS-SYLF
A0A416GA42      NDTVQ-TAVG------------------Q-LVVVPT----------GFYQKFDRELEIEV
A0A4R5DL69      GDTFL-LPTG------------------E-ATLRKT-----------IYKPDPEN-TYSI
A0A1T3IYP5      NQLVE-TPVG------------------K-VFVTPS----------KNYKDYYGT-DVFV
A0A1M4YED3      NKFVT-TPFG------------------V-LKFTKN-----------DKANAAPQGALKL
A0A3P1Z8V4      GVKTK-TPIG------------------T-LTLYKE---T--P----FRRFPKGT-PIVV
A0A2N3U785      GQKIV-LPYA------------------T-FTVTAAPGFS--T-----TNYS----EVLV
A0A0E3ZG78      GQQIQ-KPYG------------------V-FTVVPDSGLT--A-----SSKSIGS-KLTV
A0A1I6BRK6      GQKIH-KAFG------------------S-FTVITAGG-----------QYNVGT-KIIV
A0A243WAB1      GQQIA-KPYG------------------L-FTIIAASG-----------GNTADR-KVIV
A0A126PFG0      GRPVS-DSIG------------------T-WQLTPVPAFA--L---------PAGSRLRI
A0A3M1N7Z3      ---VS-GKIG------------------Q-WMALPGASSA--QLRIDCDPNCPSEGQYEV
A0A2H3NSN0      SEAMI-RLFD------------------M-VDFAAE------------------------
A0A2P6C324      YAAIL-RLQE------------------M-VSFVPD------------------------
A0A1M6XHU0      REIAF-RLRE------------------R-VRFRPL------------------------
A0A5S9C8G0      REIAF-RLRE------------------R-VRFSPL------------------------
G2SF81          REIAF-RLRE------------------R-VRFSPL------------------------
A0A5S9EYW1      REIAL-RLRE------------------R-VHFQPL------------------------
D0MHQ9          REIAF-RLRE------------------R-VRFSPL------------------------
A0A4D7K1D4      GKPLV-VNGG------------------I-ITLFLT---E--H----YSRGEGFD-DYSF
A0A3C1ITV0      GQPFK-TPVG------------------T-VVLKAT---K--E----YGKNFEQ--AVIV
R7HN19          GQPFK-TPVG------------------T-VVLKAT---K--E----YGKNFEQ--AVIV
A0A060RD97      GDTVL-IRNV------------------L-IEIKPT------I----SAEKFVGK-EVNV
A0A0D3L8Q3      GQRVN-VGFG------------------E-FTIVSD------------SRLIRNGMTVRV
A0A5B6TJH8      GKRIQ-KPYA------------------T-FTVLAT--YK--L----NSTPTSNLNQVKV
A0A519U664      GQQIK-KPYG------------------S-FTIVAS------------SIKNAVSDKIIV
A0A519UDD1      GQQIR-KPYG------------------T-FTVIAT------------GLQNMPATKIIV
A0A519MA34      GQQIE-KPYG------------------S-FTIVAA------------STKNAVSDKIIV
A0A519UCX0      GQEIK-MPYG------------------S-FTIVAS------------ATKSAVSDKIIV
R7PCR1          GRPFS-TPVG------------------K-IVLNKN---S--Q----YISEFVGK-KISI
A0A350IHV0      REELQ-TPVG------------------K-IKIVPTMHID--K----WHD------PIVV
A0A1G9E2A9      DKSYE-NQHF------------------R-FEIHKT---R--F----FTVPGSIR-RYYF
A0A098LL25      GEKIS-TDNY------------------S-FTLYPT---T--F----WSTNETGA-KYFF
A0A2T2YJE8      GKPVE-KPGF------------------S-FTLTLR---V--P----LSADVIAQ-KYYF
A0A127B287      GSPIS-LSGN------------------N-INVLTN---P--S----FSANHIGE-SFYF
A0A3M9N829      GQPVN-ISGN------------------N-ITITTT---S--S----FSSAKVGE-TYYF
A0A0P0CSF9      GNPIT-VSGS------------------T-FSINPV---N--N----FSSSNVGI-VYYF
A0A5M8QQB8      GEPVS-VVGS------------------R-VTIKTA---P--S----FSSASVGV-EYYF
A0A3M9MNC3      GVPFA-LSGS------------------T-ITVNSL---P--S----FTSVNVGE-TYYF
A0A5B6TAX2      GVPFK-FSGS------------------T-LTVNPS---S--S----FTTSNVGE-TYYF
A0A5N1IQ33      GQPIS-TPQM------------------E-LTIYRT--SP--A----TGAEELKV-NYYF
A0A512AYT3      GEKID-KKEI------------------S-LTLYPN--N---N----FNEDAQGR-KYFF
A0A5M6CYN7      GEKID-KKEI------------------S-LTLYPN--N---N----FGEGTLDG-KYYF
A0A369QP10      GEPVQ-KPGF------------------T-FTLKLT---A--P----LNSDILAQ-KYYF
A0A126PDF2      EKQVS-LPGL------------------D-LKVTPT---Q--Y----FGPASLIA-KYHF
A0A2Z3GKA1      GQQVS-LPGL------------------D-LKVTPT---R--Y----FGPATLTA-KYHF
A0A502GZP7      GQQVT-LPGL------------------D-LTVTTT---S--Y----FGPATLGE-KYHF
A0A519SBU8      GQWAK-LPGI------------------D-LLVEAA--PD--Q----TIPTSESS-PYFF
A0A4Q3JNZ3      GQWAT-FPGM------------------Q-LLLEAV--PG--R----ALPVGDDP-QYHF
A0A519Q9V3      GQWAA-FPGM------------------Q-LLLEAA--PG--R----TLPVGNDP-QYHF
A0A0M3RW20      GSAII-QPGI------------------N-LQLNLT---P--Q----FSSDVIGK-DYHF
A0A495VFX4      GDAII-LPGI------------------H-LKLVKA---P--Y----FSDEAIGR-DYHF
A0A1S9B3W0      GQPIT-TPGF------------------T-LELQPT---K--H----FNPQDTEG-AYYF
A0A1W1VRL3      GQPLN-LAGL------------------D-LRLTTH--GT--Y----FDANALDA-QFYF
A0A1M6R305      NQPFR-IGGM------------------T-LRLRPT---A--Y----MGATTLDN-NYHF
A0A4Z0PHK3      GQPVL-VPGM------------------E-LLLTAT---P--L----LTDESREK-NYHF
A0A2M9B9H9      GQPVV-VPGM------------------T-LVVTAT---P--L----LDEEALEK-NYHF
A0A4Z0QCY9      GQPII-VPGM------------------E-LKVTST---A--L----LDADAREK-NYHF
A0A418R9X5      GQPID-IAGF------------------T-LYMYKT---A--Q----YEGANRDA-NYSF
A0A428JSJ3      GQPFQ-AAGF------------------T-LRVYKT---A--Q----YTSADRDA-TYSF
A0A428KI59      GQPIE-AAGF------------------T-LQVYKT---P--Q----HASADPDA-NYSF
W8F1I6          GQPIE-AAGF------------------T-LQVYKT---P--Q----HANADPEA-NYSF
A0A246FQC0      DEPFT-AAGF------------------R-LVISKA---A--N----YNESVLEE-QYSF
A0A372E5P8      GQPFT-AAGF------------------R-LTIRQT---K--D----YNLAALDG-QYSF
A0A1H3EMW1      GQPFT-VAGF------------------R-LTVRPT---R--E----YSPEALDG-EYSF
A0A1H9ZSN3      GQPFT-VAGF------------------R-LTIRKA---A--D----SGAAAPEG-QYSF
A0A5N1J2M4      GEIIS-NNDL------------------D-LKVLKT--NT--F-----SNQVINQ-HYYF
A0A519S476      GTWAK-LPGV------------------E-LVLEAV--PG--R----PLPTAEAA-QYHF
A0A4Q3JRW8      GQWAS-FPGM------------------Q-LLLEDV--PG--R----ALPVGDDP-QYHF
A0A519M923      GQWVT-FPGM------------------Q-LRLTPV--AG--R----ALPTGDAS-PYYF
A0A4Z0ENW1      GQLVK-LPGI------------------S-LQLL----EI--L-----VPTQLDA-TYYF
A0A519UDB4      GQFVK-LPGI------------------S-FRLLLTSPEG--L-----NENFSEN-PYHF
A0A3S0QKV1      EQPVT-TPGF------------------N-LRLVPT--KY--F-----SGQLADA-TYYF
A0A328BL48      GETLT-TPGF------------------T-LTLVRT--RF--F-----NEQTPET-KFFF
A0A5R8WLY4      GEPLT-TPGF------------------T-LNLTRT--RF--F-----NEQTPET-KYFF
A0A1I5WSL8      GQTID-LSGI------------------T-LQIVGT--PA--L-----KGDVQDE-NYHF
A0A0U3JVM7      GQEIK-LPGI------------------T-LAVLGT--NE--L-----TNAAQDA-SYHF
A0A1G1SSV2      GQQIT-FPGI------------------Q-LQVLET--ES--F----AANNTADA-SYHF
A0A1G1SXV7      GQQIK-FPGI------------------Q-LQVLGT--KN--L----VTDTPDDA-SYHF
A0A0W8EDI5      NQPLK-IGNS------------------F-IVLKPT--E---------QAIQPNI-PYYF
A0A3B7RBP8      NQTLN-IEGS------------------S-ISVYST--N---------KSPQAGV-NYYF
A0A3R9P8H7      GTPFT-AGGF------------------R-MEVRKT--PQ--F-----NDKAFEG-EYFF
A0A238WIA7      DAPVE-TTGF------------------R-LRLYRT--AF--Y-----QPSDLER-NLFF
A0A212UCJ7      GNQIE-TLGF------------------W-FRIYPT--SL--F-----RPSDTER-NFYF
A0A4Z0MQE1      GDPIE-TAGF------------------T-FKILQT--PL--F-----RPVDTDR-SFYF
A0A4Z0PCF4      NEVIE-TAGF------------------R-FKIQQT--SR--F-----RPTDVER-SFYF
A0A5D6VDG1      DVPIE-LPGI------------------T-LYLSKN--KN--F-----TEDALNR-SFQF
A0A243WHR7      GQPIV-TPAM------------------E-LVLAST--PW--M-----NESVVGK-KYFF
A0A5B8A0P6      GQTIS-TPDM------------------V-LAITTT--PA--F-----NDQAINK-KYYF
A0A076HRT9      NQPIR-LGGM------------------T-LRILPE--GK--I-----DASVIER-NYFF
A0A4Z0PVM7      GQPVV-VPGL------------------E-LRITTT--DL--M-----NQEARDK-NYHF
A0A1M6DHW8      GQPIV-LPGM------------------E-LLFIGT--SF--L-----NAEALDK-KYHF
A0A4Q5LC61      GQPIV-IPGM------------------E-MRILAT--PL--L-----NAEAQDK-KYHF
A0A2A8CVM9      ------------------------------------------------------------
A0A3C0ZQC7      ----------------------------------------------------------ED
A0A2E3R1D0      ------------------------------------------------------------
A0A2T2USC0      ------------------------------------------------------------
A0A2T2V0F3      ------------------------------------------------------------
A0A2T2S682      ------------------------------------------------------------
D5H561          --------------------------------------------------------PVDT
A0A2H3NWA9      ------------------------------------------------------------
A0A2A8CVB6      ------------------------------------------------------------
A0A2P6C1S6      ------------------------------------------------------------
A0A2T2UTM4      ------------------------------------------------------------
R5RVP0          RDTIS-TPVG------------------K-IVIVPT---E--F----IDK--WKK-PMRV
R6A0L2          GQMTQ-TPYG------------------P-LCVVRG---P--G----F-GRWTDE-TIEV
R7LG80          GQTVK-TPAG------------------R-LSVVRS---K--M----F-NKWEDE-EITV
A0A2L2WX98      GETKK-TPLG------------------N-LHLIAD---T--Y----IDKMPTGE-TVTV
A0A285T4L1      NDTLT-IGSE------------------R-ILITGT---D--R----WGQAWTER-DIRV
G5GD56          GVMVK-TPIG------------------D-LAINKT---T--F----FSRFPVGK-TIQI
R5KD55          GQTVN-TPLG------------------R-LTIERQ---P--H----YPSAVADNDEIDV
A0A174QNT3      NDTLF-TPVG------------------R-IIVTPK---A--E----YVRLYIGK-DVLV
A0A4S2FGS1      NDTLS-TPAG------------------R-ILVLPH---V--E----SIPHYQGK-EIRV
R9I0H0          NDTLS-TPAG------------------R-ILVLPH---A--E----SIPHYQGK-EIRV
K5BUT9          NDTIR-TEAG------------------R-IVVQLR---P--E----NLSAYLSQ-PISV
A0A174FPA3      NDTIR-TEAG------------------R-IVVQLR---P--E----NLSAYLSQ-PISV
R6S9Y6          NDTIR-TEAG------------------R-IVVQLR---P--E----NLSAYLSQ-PISV
A0A642LIH6      NDTIR-TEAG------------------R-IVVQLR---P--E----NLSAYLSQ-PISV
C9KX15          NDTIR-TEAG------------------R-IVVQLR---P--E----NLSAYLSQ-PISV
R6DAG6          GDTIQ-TEAG------------------R-IVVNLK---P--E----NLSVYIGK-PVSV
A0A3L8AAP1      GDTVQ-TEAG------------------R-IVVNLK---P--E----NLSAYIGK-PVSV
A0A4S2AYX2      GDTVQ-TEAG------------------R-IVVNLK---P--E----NLSAYIGK-PVSV
A0A4Y9H477      GDTVQ-TEAG------------------R-IVVNLK---P--E----NLSAYIGK-PVSV
A0A0E2M2Y7      GRPIA-TPVG------------------E-LQIDKT---I--F----FADSWKGG-ILYV
A0A0K2J6Z0      GRPIA-TPVG------------------E-LQIDKT---I--F----FADSWKGG-ILYV
B2RKZ8          GRPIA-TPVG------------------E-LQIDKT---I--F----FADSWKGG-ILYV
A0A212GC82      GRPIA-TPVG------------------E-LQIDKT---I--F----FADSWKGG-ILYV
A0A254MU12      GRPIA-TPVG------------------E-LQIDKT---I--F----FADSWKGG-ILYV
R6CQ93          NDTLS-IGGE------------------K-ILVTST---D--H----WSKSWVGR-DIHV
A0A3D1NQW3      GDTIS-TPVG------------------Q-MIIRPT---L--Y----MSPDYYEKAPIRV
B0MT10          GDTIS-TPVG------------------Q-MIIRPT---L--Y----MSPDYYEKAPIRV
R7JGW9          GDTIS-TPVG------------------Q-MIIRPT---L--Y----MSPDYYEKAPIRV
A0A414Q925      GDTVN-TPVG------------------K-MVVAST---L--F----TDENSIGK-TVYV
A0A415PUS9      GDTVN-TPVG------------------K-MVVAST---L--F----TDENSIGK-TVYV
A0A108TCU0      GDTVN-TPVG------------------K-MVVAST---L--F----TDENSIGK-TVYV
A0A413BA42      GDTVN-TPVG------------------K-MVVAST---L--F----TDENSIGK-TVYV
S3Y344          GDTVN-TPVG------------------K-MVVAST---L--F----TDENSIGK-TVYV
A0A4Q5G8Y8      GDTVN-TPVG------------------K-MVVAST---L--F----TDENSIGK-TVYV
A0A412TGL3      GDTVN-TPVG------------------K-MVVAST---L--F----TDENSIGK-TVYV
A0A413VJ33      GDTVN-TPVG------------------K-MVVAST---L--F----MDENSIGK-TVYV
A0A414L0W6      GDTVN-TPVG------------------K-MVVAST---L--F----TDENSIGK-TVYV
A0A412DP39      GDTVN-TPVG------------------K-MVVAST---L--F----TDENSIGK-TVYV
A0A413ZSE8      GDTVN-TPVG------------------K-MVVAST---L--F----TDENSIGK-TVYV
B0NP84          GDTVN-TPVG------------------K-MVVAST---L--F----TDENSIGK-TVYV
R6AK43          GDTVN-TPVG------------------K-MVVAST---L--F----TDENSIGK-TVYV
A0A412N2D9      GDTVS-TPVG------------------K-IAVQPT---L--F----TNESYIGK-SVYV
A0A1Y4JYS9      GDTVN-TPVG------------------K-IAVQPT---L--F----TNESYIGK-SVYV
R6LHA4          GDTVS-TPVG------------------K-IAVQPT---L--F----TNESYIGK-SVYV
A0A3D2BF46      NDTIT-TPCG------------------L-LVVTPT---L--Y----MSDDYFGD-PISV
A0A4Y1WUN1      NDTIT-TPCG------------------L-LVVTPT---L--Y----MSDDYFGD-PISV
A0A4Y1XL94      NDTIT-TPCG------------------L-LVVTPT---L--Y----MSDDYFGD-PISV
A0A358R538      GDTAA-TPVG------------------K-VVVERT---P--Y----LTPAYEGV-PVRV
A0A1Y4AAB8      GDTVS-TPLG------------------R-MIIRKT---L--Y----LSPADEGT-AIQV
A0A1Y3WWY9      GDTIP-TPIG------------------E-IVVHKT---L--Y----MNPKFNGV-PIRV
A0A1Y4U5L4      GDTIP-TPIG------------------E-IVVHKT---L--Y----MNPEFNGV-PIRV
A0A1Y3VCJ1      GDTVA-SPIG------------------Q-IIVRKT---L--Y----MEPSYRET-PIRV
A0A1Y3QTW7      GDTIP-TPLG------------------Q-MVVHKT---P--F----MDSTYVDR-PITV
R6XWY7          GDTIP-TPLG------------------Q-MVVHKT---P--F----MDSTYVDR-PITV
A0A4Y1X9Y9      GDTIP-TPLG------------------Q-MVVHKT---P--F----MDSTYVDR-PITV
A0A4Y1WM66      GDTIP-TPLG------------------Q-MVVHKT---P--F----MDSTYVDR-PITV
A0A174AVF1      GDTIP-TPLG------------------Q-MVVHKT---P--F----MDSTYVDR-PITV
A0A656Q4F4      GDTIP-TPLG------------------Q-MVVHKT---P--F----MDSTYVDR-PITV
A0A1Q6EIY0      GDTVA-TPVG------------------Q-VVVHKT---L--F----MDSTYLKK-PITV
A0A5B5VN71      GDTVA-TPVG------------------Q-VVVHKT---L--F----MDSTYLKK-PITV
E4M8L3          GDTVA-TPVG------------------Q-VVVHKT---L--F----MDSTYLKK-PITV
I3YQ50          GDTVA-TPVG------------------Q-VVVHKT---L--F----MDSTYLKK-PITV
R5UEY8          GDTVA-TPVG------------------Q-VVVHKT---L--F----MDSTYLKK-PITV
A0A1H4D866      GDTIP-TPVG------------------Q-VIVRKS---L--Y----MKPEYTGV-PIRV
A0A5B3G4Y7      GDTIP-TPVG------------------Q-VVVQKS---L--Y----MAPDYIGV-PIRV
A0A374A9J5      GDTIP-TPVG------------------Q-VVVQKS---L--Y----MAPDYIGV-PIRV
A0A5B3GQN5      GDTIP-TPVG------------------Q-VVVQKS---L--Y----MAPDYIGV-PIRV
A0A1Q6E9S3      GDTIP-TPVG------------------Q-VVVQKS---L--Y----MAPDYIGV-PIRV
D4IJ36          GDTIP-TPVG------------------Q-VVVQKS---L--Y----MAPDYIGV-PIRV
A0A3E5HPT8      NDTVD-TPLG------------------K-LIVFAA---E--N----YSESYFDR-PIKV
C6IJ48          NDTVD-TPLG------------------K-LIVFTA---E--N----YSESYFDR-PIKV
Q8A3U2          NDTVD-TPLG------------------K-LIVFTA---E--N----YSESYFDR-PIKV
A0A3R6S1H6      KDTVE-TPVG------------------K-VVVTPT---L--Y----YSKMYYSV-PVTV
A0A3R6SD81      KDTVE-TPVG------------------K-VVVTPT---L--Y----YSKMYYSV-PVTV
A0A354WXN6      GDSVD-TPVG------------------P-LKIEAS---L--D----YSERYWNK-DISI
R5IP14          GDTVS-TPVG------------------V-LVVNNT---G--I----PLTKFKKK-VITV
A0A316SZX7      YDTIS-TPIG------------------K-LVIKPT---P--Y----FDS--WKN-EIKI
A0A1Y4AIY1      NDTVT-TPVG------------------R-IVVQPS---L--Y----YTDTYYNK-EVHV
F3ZRU7          NDTVD-SPLG--------------------LLLVKT---T--G----LGKAYEGE-TIQI
A0A0J6CIR2      NDTVS-TPVG------------------K-LVVTPT---L--Y----YADKYFGK-AVTI
A0A3D8HG59      NDTVQ-TPVG------------------R-VVVTPT---L--F----YTTAYFGT-PVRV
A0A3R6S408      NDTVQ-TPVG------------------R-VVVTPT---L--F----YTTAYFGT-PVRV
A0A1C5Q1F3      NDTVA-TPVG------------------K-LVVTPT---L--Y----YTQDYYQV-PVTV
R7A239          NDTVA-TPVG------------------K-LVVTPT---L--Y----YTQDYYQV-PVTV
A0A3R6HIK7      NDTVQ-TPVG------------------R-VVVVPS---L--Y----YADNYYNI-PIQV
K5ZVW7          NDTVQ-TPVG------------------R-VVVVPS---L--Y----YADNYYNV-PIQV
A0A1Y4D5Z0      NDTVT-TPVG------------------K-LVVVPS---L--Y----YTDLCYGK-SITV
A0A413VXJ7      HDTIQ-TPVG------------------A-MVVMPT---L--Y----YSDNFYEK-PISV
I9RSN9          HDTIQ-TPVG------------------A-MVVMPT---L--Y----YSDNFYEK-PISV
U6RJK5          HDTIQ-TPVG------------------A-MVVMPT---L--Y----YSDNFYEK-PISV
A0A1Q6GA32      HDTIQ-TPVG------------------A-MVVMPT---L--Y----YSDNFYEK-PISV
I9RPU6          NDTVS-TPIG------------------P-MVITPT---L--Y----YTDAFYGK-PVNV
I8YFS5          NDTIS-TPVG------------------T-MVVTPT---L--Y----YTDTYYGN-PVFV
A0A4Q5F7I7      NDTIL-TPVG------------------T-MVVTPT---L--Y----YTDTYYGK-PVYI
I8Y597          NDTIS-TPVG------------------T-MVVTPT---L--Y----YTDTYYGK-PVYI
A0A1Q6GBF5      NDTVS-TPIG------------------T-MVVTPT---L--Y----YTDVFYDK-PVHV
I8YFZ3          NDTVS-TPIG------------------P-MVITPT---L--Y----YTDVFYGR-SVNV
A0A4V1YNX8      NDTVS-TPIG------------------P-MIITPT---L--Y----YTDVFYGK-PVSV
A0A1Q6GDH2      NDTVS-TPIG------------------P-MVITPT---L--Y----YTDAFYGK-PVNV
U6RSB0          NDTVS-TPIG------------------P-MVVTPT---L--Y----YTDVFYGK-PVNV
I9GXM2          NDTVS-TPIG------------------P-MVITPT---L--Y----YTDVFYGK-PVNV
I9SIK1          NDTVS-TPIG------------------P-MVITPT---L--Y----YTDVFYGK-PVNV
A0A4Q5FNG1      NDTVS-TPIG------------------P-MVITPT---L--Y----YTDVFYGK-PVNV
I9TP59          NDTVS-TPIG------------------P-MVITPT---L--Y----YTDVFYGK-PVNV
R5S343          NDTVD-TPSG------------------R-AVVAPT---G--Y----YNKNDLNR-TVMI
A0A1M6K7I9      GDTIK-TAIG------------------N-IVVTPT---L--Y----YTNEYYGD-KILV
A0A5M6A8C8      GDTIK-TALG------------------N-IVVTPT---L--Y----YTNEYYGD-KIQV
A0A4V1YPN7      NDTVS-TPIG------------------T-VVVTPT---L--Y----YTDTFYDN-PIYV
A0A4Q5F874      NDTVS-TPVG------------------T-VVITPS---L--Y----YTDAFYAK-PIYV
A0A641LV22      NDTVS-TPVG------------------T-VVITPS---L--Y----YTDAFYAK-PIYV
A0A3R5ZMK1      NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
A0A3E4ZTK7      NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-TVQV
A0A1Y3ZIA4      NDTVT-TPIG------------------R-VVVVPS---L--Y----YGDKYFNT-TVQV
K5Y1A4          NDTVT-TPIG------------------R-VVVVPS---L--Y----YGDKYFNT-TVQV
A0A4Q5CIT0      NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
A0A3R6K8X4      NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
A0A414GI87      NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
A0A415BDM7      NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
A0A412DM15      NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
A7AEU7          NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
A0A1Q6I3T6      NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
A0A414XX40      NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
A0A3R6BKI7      NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
A0A414LPI6      NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
A0A412M2W1      NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
K5ZX55          NDTVT-TPVG------------------R-VVVVPS---L--Y----YGDKYFNT-VVQV
A0A5F0U645      NDTVS-TPIG------------------K-VVVTPS---L--Y----YTDLYYGS-EITV
K5ZBN2          NDTVS-TPIG------------------K-VVVTPS---L--Y----YTDLYYGS-EITV
A0A0J6CKW3      NDTVS-TPIG------------------K-VVVTPS---L--Y----YTDLYYGS-EITV
A0A0F5IQM7      NDTVS-TPIG------------------K-VVVTPS---L--Y----YTDLYYGS-EITV
A0A496CDT3      NDTVS-TPIG------------------K-VVVTPS---L--Y----YTDLYYGS-EITV
S0GLB0          NDTVS-TPIG------------------K-VVVTPS---L--Y----YTDLYYGS-EITV
A0A3R6NLC1      NDTVS-TPIG------------------K-VVVTPS---L--Y----YTDLYYGS-EITV
A0A416WYC9      NDTVS-TPIG------------------K-VVVTPS---L--Y----YTDLYYGS-EITV
A0A0F5IT40      NDTVS-TPVG------------------K-LVVTPT---L--Y----YADKYFGK-AVTI
A0A496CX20      NDTVS-TPVG------------------K-LVVTPT---L--Y----YADKYFGK-AVTI
A0A5F0UBI0      NDTVS-TPVG------------------K-LVVTPT---L--Y----YADKYFGK-AVTI
S0GSI7          NDTVS-TPVG------------------K-LVVTPT---L--Y----YADKYFGK-AVTI
K5YB65          NDTVS-TPVG------------------K-LVVTPT---L--Y----YADKYFGK-AVTI
A0A0F5IWP9      NDTVI-TSIG------------------K-LVVTPT---L--Y----YSDKYFGK-PVAV
A0A0F5IZT8      NDTVI-TSIG------------------K-LVVTPT---L--Y----YSDKYFGK-PVAV
A0A417LKQ2      NDTVT-TPVG------------------K-LVVTPT---L--Y----YSDKYFGK-PVAV
A0A416TME1      NDTVA-TPAG------------------K-LVVTPT---L--Y----YSDKYFGK-SVVV
A0A416XPE8      NDTVA-TPAG------------------K-LVVTPT---L--Y----YSDKYFGK-SVVV
A0A5C8KAD6      NEWVD-TPYG------------------E-MKFSKN---K--NML------FAATNPLYF
A0A5N1J695      DEWVR-TPYG------------------I-MLFQRN---E--KQS------AAPIGPLYF
A0A1H4ADG3      SVPVV-LPIG------------------Q-LTLEKN---E--LTN-----DWDGSQNIKM
A0A5B8VUR8      DEPIQ-LPIG------------------K-VTLVKN---Q--AMS-----SWDPARSIKM
A0A2A4G4B1      YENVR-FRII------------------PLLDINAL---K--GQS------------YQI
A0A3N2M1H3      KESVK-TPIG------------------I-VKVTPN---P--EY---DGLPITESIELKV
A0A4S2G8T2      KESVK-TPIG------------------I-VKVTPN---P--EY---DGLPITESIELKV
A0A212K7W5      SESVN-TPLG------------------S-IRINPT---A--FYS--KVYYNQQ---ILF
F5IU11          SEPVN-TPLG------------------N-ITIHPT---A--FYS--KGYYDQK---ILF
A0A3N2N6F7      GDTVS-TSFG------------------R-MVISAG---P--NFS--P----DFDHDIRF
A0A4P7VVU7      GDTVA-TSFG------------------P-ITINPG---P--AYA--K----RFGNTIKI
A0A2V1ILM4      GDTVA-TSFG------------------P-ITINPG---P--AYA--K----RFGNTIKI
A0A3N2L0E8      GDTVA-TSFG------------------P-ITINPG---P--AYA--K----RFGNTIKI
A0A3N2LFC5      GDTVA-TSFG------------------P-ITINPG---P--AYA--K----RFGNTIKI
A0A553LCN8      GDTLQ-TEAG------------------R-MIVNLK---P--ENL-----STYIGKPVLV
K0XJ09          GDTII-SAAG------------------R-FIVEDI---P--DKI-----SAYYNVPVEV
R5EUZ0          GDTII-SAAG------------------R-FIVEDI---P--DKI-----SAYYNVPVEV
W0EQS0          GDTLV-SEAG------------------R-IVVEAV---P--EYL-----PAYYNIPVEV
A0A1Y3WE15      GDTLV-TNAG------------------R-MVVTAV---P--EFL-----PNYYTLLIEV
A0A1Y4GUK3      GDTLV-SDAG------------------R-IVVESV---P--EFL-----PAYYNVPVEV
A0A352Z1R7      ---MQ-AKGF------------------S-LLLNDL---K--GEK-------GD--NFRL
A0A0A2F501      GDTIS-APIG------------------K-LVIVRS---E--SYL--ADKSKTRPSQIYV
R5B7P0          GDTLQ-TPVG------------------R-IIVQKT---K--DYS--G-EAMKK--PVNV
R5B0L5          GDTIR-TQSG------------------N-LVVSLT---G--RGN--P---SGM--TIYV
A0A374THP7      GQIIH-TPLG------------------K-IKVDKA---P--SYS--QFVKNGDAPVLYV
A0A3R5XWG1      GKLVQ-TPLG------------------K-VKLEAA---P--SYA--AFIKGGDAPALYV
A0A5P0Y910      GKLVQ-TPLG------------------K-VKLEAA---P--SYA--AFIKGGDAPALYV
A0A5P0XQC0      GKLVQ-TPLG------------------K-VKLEAA---P--SYA--AFIKGGDAPALYV
A0A414YFM3      GKLVQ-TPLG------------------K-VKLEAA---P--SYA--AFIKGGDAPALYV
A0A5P0VXP6      GKLVQ-TPLG------------------K-VKLEAA---P--SYA--AFIKGSDAPALYV
A0A5P0W892      GKLVQ-TPLG------------------K-VKLEAA---P--SYA--AFIKGGDAPALYV
A0A0A2EVS5      VDSIP-TPMG------------------I-VRVGLN---S--AYS--DEKSIQTPMTIHV
A0A1T4NAJ7      VDSIP-TPMG------------------I-VRVGLN---S--AYS--DEMSIQTPMTIHV
A0A255T941      GKVVM-TPIG------------------Q-MTVHGT---K--TAR--E-DFIGE--KITY
A0A3N2KCL3      NDTIM-TAVG------------------P-MVVVAA---E--GYK--P--GEAV--ELEV
A0A4P7VSV0      NDTIM-TAVG------------------P-MVVVAA---E--GYK--P--GEAV--ELEV
A0A2V1IJY1      NDTLM-TVVG------------------P-MVVVAA---E--GYK--P--GEAV--ELNV
A0A4P7VXK7      NDTLM-TVVG------------------P-MVVVAA---E--GYK--P--GEAV--ELNV
A0A1Y4CHN5      NDTIE-TPVG------------------R-IVVSTT---P--YYS--G--TFDS--DVYV
A0A1M6I2S6      GDSIR-MEVG------------------T-FVINPT---K--YWN--D-SFVGT--SIRY
A0A1Y3V692      GDSIR-MEVG------------------T-FVINPT---K--YWN--D-SFVGT--SIRY
F3PXM2          GDTLR-TSVG------------------T-LLIDAT---P--YAT--D-DFMGT--SIHY
A0A3E4ZNL4      GDSIQ-TSAG------------------T-LAVSLT---S--QYN--D-SFIGS--TIHY
A0A174AHH7      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIQY
A0A174JCE8      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIQY
A0A3E4JMC4      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIQY
A0A412SND6      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIQY
A0A414IEQ9      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIQY
A0A415UKN5      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIQY
A0A0M1W8D8      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIQY
A0A3R6GKX5      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-FFTGS--TIQY
A7V4S1          GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-FFTGS--TIQY
B0NU19          GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-FFTGS--TIQY
D4V601          GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-FFTGS--TIQY
A0A4Q0U3M9      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-FFTGS--TIQY
A0A4R4H1Q2      GDSIQ-TSAG------------------T-LAISLT---S--QYE--I-FFTGS--TIQY
A0A397WLT5      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-FFTGS--TIQY
A0A3R6GM96      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-FFTGS--TIQY
A0A015XH67      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-FFTGS--TIQY
A0A078RZN2      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-FFTGS--TIQY
A0A4R4I3T9      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-FFTGS--TIQY
A6L0K5          GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-FFTGS--TIQY
A7ACT5          GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-FFTGS--TIQY
A6KY94          GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIRY
A0A173UQR8      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIRY
A0A3R6HK75      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIRY
A0A412B7D1      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIRY
A0A412VNY9      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIRY
A0A414LTU9      GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIRY
I9Q4U4          GDSIQ-TSAG------------------T-LAISLT---S--QYE--N-SFTGS--TIRY
A0A373ISF0      GDSIQ-TVAG------------------T-LFISPT---K--FYS--D-ACIGT--SIRY
U6RF62          GDSIQ-TAAG------------------T-LFISPT---K--FYS--D-ACIGT--SIRY
A0A662ZZD5      GDSIR-TEIG------------------T-LVINFT---K--YWN--D-SFVGT--SIRY
A0A395YYT3      GDSIR-TEIG------------------T-LVINFT---K--YWN--D-SFVGT--SIRY
A0A642JYJ3      GDSIR-TEIG------------------T-LVINFT---K--YWN--D-SFVGT--SIRY
A0A015UXN7      GDSIR-TEIG------------------T-LVINFT---K--YWN--D-SFVGT--SIRY
A0A5M5W148      GDSIR-TEIG------------------T-LVINFT---K--YWN--D-SFVGT--SIRY
A0A3A5TI83      GDSIR-TEIG------------------T-LVINFT---K--YWN--D-SFVGT--SIRY
A0A415NEB6      GDSIR-TEIG------------------T-LVINFT---K--YWN--D-SFVGT--SIRY
A7AJ60          GDSIR-TEIG------------------T-LVINFT---K--YWN--D-SFVGT--SIRY
A0A016E4F9      GDSIR-MEIG------------------T-FVINLT---K--YWN--D-SFVGT--SIHY
A0A4Q5CFJ7      GDSIR-MEIG------------------T-FVINPT---K--YWN--D-SFVGT--SIRY
A0A108TH71      GDSIQ-TSAG------------------I-MIVSPT---Q--EFT--D-VFIGT--SIRY
I8VXH0          GDSIQ-TSAG------------------I-MIVSPT---Q--EFT--D-VFIGT--SIRY
A0A412S0N6      GDSIQ-TSAG------------------I-MIVSPT---Q--EFT--D-VFIGT--SIRY
A0A412IIJ0      GDSIQ-TSAG------------------I-MIVSPT---Q--EFT--D-AFIGT--SIRY
A0A0P0FM97      GDSIQ-TSAG------------------I-MIVSPT---Q--EFT--D-AFIGT--SIRY
R6KTP3          GDSIQ-TSAG------------------I-MIVSPT---Q--EFT--D-AFIGT--SIRY
A0A139LU87      GDSIQ-TSAG------------------I-MIVSPT---Q--EFT--D-AFIGT--SIRY
A0A1C6B3Y5      GDSIQ-TSAG------------------I-MIVSPT---Q--EFT--D-AFIGT--SIRY
E2NMQ4          GDSIQ-TSAG------------------I-MIVSPT---Q--EFT--D-AFIGT--SIRY
A0A412YDB9      GDSIR-TSAG------------------T-MILHPA---Q--KNA--N-AFIDT--PIQY
R7DY01          GDSIR-TSAG------------------T-MILHPA---Q--KNA--N-AFIDT--PIQY
A0A414LGK8      GDSIR-TSAG------------------T-MILHPA---Q--KNA--D-AFINT--PIQY
A0A415IPQ4      GDSIR-TSAG------------------I-IIISPT---E--KFT--D-AFTGT--SILY
A0A3E5BRW7      GDSIH-TSVG------------------T-MIISLT---Q--EFT--D-ALTDT--PVRY
K9DXS6          GDSIH-TSVG------------------T-MIISLT---Q--EFT--D-ALTDT--PVRY
A0A1M6KFV3      GDSIH-TPAG------------------T-MIISPT---Q--APS--D-AFMGV--PIRY
A0A1Q6G7L3      GDSIH-TPAG------------------T-MIISST---Q--ASS--D-AFMGV--PIRY
A0A413H235      GDSIH-TPAG------------------T-MIISST---Q--ASS--D-AFMGV--PIRY
A0A1M5B2J8      GDTIQ-SPFG------------------K-MAVTAT---A--HYR--K--GQET--EIEV
A0A255RCT5      GDTVQ-SPFG------------------K-MSVTAT---A--HYR--K--GQEA--DVEV
A0A1Y4GLF5      ADTIA-TPLG------------------R-MVVNAT---A--NYV--D--A-PC--TLYV
A0A1H3XSC0      SDTIT-TPLG------------------I-LKIETT---P--YYK--S--KEPY--TLYV
A6LE40          LDSIP-TPLG------------------K-IIIHTT---P--NYV--K--GEAY--ILYI
A0A4Y1VPX5      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K--GEAY--TLYV
B3JI46          LDSIT-TPLG------------------K-IIIHTT---P--NYV--K--GEAY--TLYV
R6NN15          NDSLV-TPIG------------------K-IVIRPA---A--AFV--DWQKSSE--PLTV
A0A358R8U0      TDTLT-TPLG------------------R-VEITPT---P--YYD--I--DRGC--QLKV
R6WSB6          TDTLT-TPLG------------------R-VEITPT---P--YYD--I--DRGC--QLKV
A0A4Q5ENK6      NDSIQ-SPLG------------------P-IVITPS---A--TYS--D--KTEE--VIYV
A0A401LPX7      NDSIQ-SPLG------------------P-IVVIPS---A--AYS--G--KTES--TIYV
A0A3A5Z900      NDSIQ-SPLG------------------P-IVVIPS---A--AYS--G--KIES--TIYV
A0A3R6EGW5      NDSIQ-SPLG------------------P-IVVIPS---A--AYS--D--KTVS--TIYV
A0A285TGL6      NDSIQ-SPLG------------------P-IVVIPS---A--AYS--D--KTVS--TIYV
A0A3A5RFX4      NDSIQ-SPLG------------------P-IVVIPS---A--AYS--D--KTVS--TIYV
A0A1Q6IUW9      NDSIQ-SPLG------------------P-IVVIPS---A--AYS--D--KTVS--TIYV
A0A3R6NPG7      NDSIQ-SPLG------------------P-IVVIPS---A--AYS--D--KTVS--TIYV
A0A413XDP6      NDSIQ-SPLG------------------P-IVVIPS---A--AYS--D--KTVS--TIYV
K6AP24          NDSIQ-SPLG------------------P-IVVIPS---A--AYS--D--KTVS--TIYV
A0A662ZYI7      NDSIQ-SPLG------------------P-IVVIPS---A--AYS--D--KTVS--TIYV
A0A078RYI7      NDSIQ-SPLG------------------P-IVVIPS---A--AYS--D--KTVS--TIYV
C7XEQ8          NDSIQ-SPLG------------------P-IVVIPS---A--AYS--D--KTVS--TIYV
D7INX6          NDSIQ-SPLG------------------P-IVVIPS---A--AYS--D--KTVS--TIYV
K5ZG55          NDSIQ-SPLG------------------P-IVVIPS---A--AYS--D--KTVS--TIYV
A0A3N2N9B8      GDTIS-TPAG------------------L-VVINPS---A--YYL--P----KQPIALKV
A0A3N2NMI0      GDSIA-TPVG------------------I-VIVNPS---P--AYT--P----GTAIELEV
A0A359I8H7      AGPIE-TPVG------------------K-VSIIAN---G--NYTAPKGKKNKPVTKIIV
A0A3N2KA63      AGPIE-TPVG------------------K-VSITAN---G--NYTAPKGKKNKPVTEIIV
A0A4Q0IMT7      AGPIE-TPVG------------------K-VSITAN---G--NYTAPKGKKNKPVTEIIV
A0A3B9FAU3      STIIG-TPVG------------------N-VLVTPT---Q--YYG--SFVT-HTKDPILV
A0A3C1E5L7      STIIG-TPVG------------------N-VLVTPT---Q--YYG--SFVT-HTKDPILV
A0A4Q0UAV1      GRTYK-TPVG------------------P-FRINTT---E--YFT--KEYINEPVTFIHN
A0A354SN68      GDTLL-TPIG------------------K-IFLQKS---N--SFD--K---AFITSTICV
A0A3N2N595      NDTIK-TDAG------------------P-IVILPT---D--YYK--P----GDLIDLEI
A0A0A2DUD9      GKATE-TPLG------------------K-VLVNKN---Q--GDD--L----DLVNGLII
A0A3P1ZBJ5      KQVVK-TPVG------------------D-ILVTPT---K--NFE--L-----LKKSIQV
R5FHS9          NQTVH-TPIG------------------R-VTIKPS---H--YYN--S-WPGGLYANLYV
A0A413TW79      GQTVR-TVMG------------------Y-VCVDQA---P--GYS--AFVNGYESRKLHV
A0A3E5E9M7      GQTVR-TAMG------------------Y-VCVDQA---P--GYS--AFVNGHESRKLHV
A0A3E4SK73      GQTVR-TAMG------------------Y-VCVDQA---P--GYS--AFVNGHESRKLHV
A0A415GGC6      GQTVR-TAMG------------------Y-VCVDQA---P--GYS--AFVNGYESRKLHV
A0A413DBH9      GQTVR-TAMG------------------Y-VCVDQA---P--GYS--AFINGHESRKLHV
A0A495WI87      TDTIM-TPVG------------------K-VTVCPT---P--YYT--S----QFSQPIYV
A0A354M4S6      RDTIM-TPVG------------------K-VTVCPT---P--YYT--S----QFSQPIYV
R7DH52          RDTIM-TPVG------------------K-VTICPT---P--YYT--S----QFSQPIYV
A0A4Q5E7L5      LDSIP-TPLG------------------K-VIIHTT---P--NYV--K----GEAYTLYV
A0A4P8LP09      LDSIT-TPLG------------------K-IVVHTT---P--NYV--E----GEAYTLYV
A0A4R4GZU7      LDSIT-TPLG------------------K-IVVHTT---P--NYV--E----GEAYTLYV
A0A016CWA4      LDSIT-TPLG------------------K-IVVHTT---P--NYV--E----GEAYTLYV
A0A1C6H117      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A415TAH7      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A0M1W0V2      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A139KA16      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A174VQ92      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A1Q6HCG0      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A1Y4JYM9      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A3A5QW67      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A3A5RQE6      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A3A6BP07      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A3E5E153      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A3Q9IP20      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A412WV15      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A413ICP6      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A414KYB9      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A5B3FWR2      LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
E5WX00          LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
K0X3P3          LDSIT-TPLG------------------K-IIIHAT---P--NYV--K----GETYTLYV
A0A3A5Z014      LDSIP-TPLG------------------K-IIINTT---P--NYV--K----GESYILYI
A0A1M4YZ07      LDSIP-TPLG------------------K-IIIHTT---P--NYV--K----GKAYTLYV
A0A078S3Q8      LDSIP-TPLG------------------K-IIINTT---P--NYV--K----GKAYTLYV
A0A069SJV7      LDSIP-TPLG------------------K-IIINTT---P--NYV--K----GKAYTLYV
A0A3E5DXI5      LDSIP-TPLG------------------K-IIINTT---P--NYV--K----GKAYTLYV
A0A3E5EM98      LDSIP-TPLG------------------K-IIINTT---P--NYV--K----GKAYTLYV
A0A3E5F453      LDSIP-TPLG------------------K-IIINTT---P--NYV--K----GKAYTLYV
I9T3G6          LDSIP-TPLG------------------K-IIINTT---P--NYV--K----GKAYTLYV
A0A4Q5E5M7      LDSIT-TPLG------------------K-IIIHIT---P--NYV--K----GEAYTLYI
A0A0P0FQW1      LDSIT-TPLG------------------K-IIIHIT---P--NYV--K----GEAYTLYI
A0A5M5C0W6      LDSIT-TPLG------------------K-IIIHIT---P--NYV--K----GEAYTLYI
A0A642LZ22      LDSIT-TPLG------------------K-IIIHIT---P--NYV--K----GEAYTLYI
A0A5M5YM86      LDSIT-TPLG------------------K-IIIHIT---P--NYV--K----GEAYTLYI
A0A642LE65      LDSIT-TPLG------------------K-IIIHIT---P--NYV--K----GEAYTLYI
A0A5M5Y0P8      LDSIT-TPLG------------------K-IIIHIT---P--NYV--K----GEAYTLYI
A0A642NJ89      LDSIT-TPLG------------------K-IIIHIT---P--NYV--K----GEAYTLYI
C3RFN5          FDSIP-TPLG------------------K-IIINTT---P--NYV--K----GKAYTLYV
A0A3E4SYU0      LDSIP-TPLG------------------K-IIINTT---P--NYV--K----GESYTLYV
A6LGY1          FDSIP-TPLG------------------K-IIIHTT---P--NYV--K----GKAYTLYV
K5ZSH4          FDSIP-TPLG------------------K-IIINTT---P--NYV--K----GKAYTLYV
A0A078T2W6      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A3R6EAF7      LDSIP-TPLG------------------K-IIINTT---P--NYV--K----GESYTLYV
A0A5C6L2P1      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A412MJT7      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A3E4WKT5      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A3A5YY33      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A078TAH2      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A1E9CFZ7      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A373FYU5      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A3A5TZ72      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A3A5XBP2      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A3A6MEG9      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A3E4JP35      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A3E4KP40      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A3E4NX82      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A3E4XFU8      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A412RG70      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A412TD37      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A413GAA4      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A414M7I4      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A496BTA0      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A496D2V6      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A4Q5EN83      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A4Q5G1P5      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A5C6KCA6      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A5M5AHM5      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A641WNS6      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
E5UZA2          LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A069SMG6      LDSIT-TPLG------------------K-IIIHTT---P--NYV--K----GEAYTLYV
A0A1Y4PQK7      PCTLN-TPLG------------------K-VTLETT---S--GYV--R----GTEYKVRV
A0A1Y4IH41      PGTLN-TPLG------------------K-VTLEAT---S--GYV--R----GTEYKVHV
A0A3A6AAP4      PGTLN-TPLG------------------K-VTLEAT---S--GYV--R----GTEYKVHV
A0A1Y4DYA7      NDTIS-TPVG------------------R-LLIKPT---H--GIK--D----FKET-VYI
A0A1Y3X4I9      NDTVS-TPVG------------------R-LLVKPM---A--GAE--T----WKEA-VYV
A0A1Y4FNK8      NDTAD-TPIG------------------K-LSIKAM---N--DTV--T----YQEP-VYV
A0A355FD59      GTIVD-TPLG------------------K-LSVMPT---S--HYT--N----ETSPLIYV
A0A359CEZ9      GTIVD-TPLG------------------K-LSVMPT---S--HYT--N----ETSPLIYV
A0A353Q7B4      GTIVD-TPLG------------------K-LSVMPT---S--HYT--N----ETSPLIYV
F8X3A5          NDTID-TPLG------------------K-IIVFPT---S--YYT--K----TEMPLIYI
A0A1M3KVR9      NDTID-TPLG------------------K-IIVVPT---S--YYT--K----NEMPLIYI
A0A4Y9IJS3      NDTID-TPLG------------------K-IIVVPT---S--YYT--K----NEMPLIYI
A0A4Q5WS95      DQLVA-TPYG------------------S-LTFSPN---P--RYK--A----GSQGPFYF
A0A501VZX6      GKWVQ-TPYG------------------I-IRFSLN---T--RKE--G----IAKHPLYF
A0A399SH26      NKSIR-MPYG------------------V-IKFIPN---D--HQS--S----QAKEQLYF
A0A501W1A9      NTWAK-TPYG------------------E-LQFIEN---P--QFS--W----AATGRLFF
A0A0E3ZGV6      GTWEK-TPYG------------------V-MLFSEN---E--KQT--S----TTTNPLYF
A0A1I2N4S1      STWVV-TPYG------------------E-MLFEKN---L--LQN--G----SAQHPLFF
A0A2T5YE44      STWVV-TPYG------------------E-MLFEKN---L--LQN--G----SAQNPLFF
A0A1V9FHD0      NTWCN-TPYG------------------V-LKFEKN---A--RQT--T----DSTGQLYF
A0A4V4H170      KKWVS-TPWG------------------E-LKFEHN---D--RQL--S----MAEGPLFF
A0A1V9F098      NQWVS-TKYG------------------E-LKFEKN---E--RQT--E----APGGPLFF
A0A4R2VU64      NQWVT-TPYG------------------E-LKFVEN---Q--KQA--D----TPGGQLYF
A0A4S8HY23      NTWCA-TPYG------------------E-LKFENN---N--RQS--D----TVVAPLFF
A0A1V9F383      RVWCN-TRWG------------------E-LKFIPN---D--RQT--T----APVGPLFF
G8TRZ6          REWCQ-TRWG------------------V-VKFMPN---E--RQT--S----KPVGPLFF
A0A543WA52      NEWIS-DIRW------------------GEIKFIPN---P--NQK--G----NPQDSLYF
A0A1M5BA90      NKWIS-TPFG------------------V-ARITRN---L--NLK--T----ASTNPLYF
A0A512B879      DQWVT-TSFG------------------T-AKFNIN---R--YFK--T----ATTNNLYF
A0A559PPI3      NEWVD-SPFG------------------K-IMFYPN---K--NKV--Q----QAKKPLYF
A0A1T5CS78      NKWFE-ISNG------------------QTIMFVKN---D--NVN--K----KASNPLFF
A0A0Q9Z8F1      NEWFE-FSAG------------------QTIMFVKN---D--HVN--K----KASNPLFF
A0A2N0U0M7      NEWFE-FSAG------------------QTIMFVKN---D--NVN--K----NASDPLFF
                                                                            

A0A1T5MMH4      IINSPDALLGYL-----ISGLSV-EPL---N-------Y-----AAQTIRIAFQDNNPLK
A0A2W4R1L8      VINSPEVLMNYL-----MRNLTV-EPI---N-------F-----NANTIRISFKDHNPLK
A0A2E5CV79      TEPYSDAIGEKF-----SQNVMN-GISIKRR-------N-----ATGVLEITFQSVFADE
A0A2D4ZVH1      --TSIDTVAMRY-----RELIRF-SEP---D-------P-----EADIVSISFESPLPTE
A0A0K8QSK7      EFNTVQQTGKLY-----ASRLTV-AQS---N-------R-----QTSILTLTVQDHNSAK
A0A1V6CN82      RFHTPDELINAY-----RSRMTV-SLR---D-------W-----ETSIVDIDLKDYHPQK
A0A1M4XZ45      RFNTKKSLVDKY-----RKSLEV-TLS---G-------K-----ETSILNLTLRDYNVSK
A0A399D319      RFNSKKALLKRY-----REQLDV-TLN---D-------K-----ETSILNLTLRDFNVKK
A0A1M6GR99      KLSTIKQLVSHY-----EQKLEF-NIP---D-------R-----LGTFIEISMKTNSVQL
A0A1M6TTV4      IINSEDALINYF-----QKNIVV-EPI---N-------F-----NANTIKIALSDPNKYK
A0A4Q8RX32      DVKGKTQLVGEL-----KEQLTI-EPA---N-------V-----DGTVVNVLLKSNNARM
K0X1U5          HVNGYDGEAEIL-----EKRLDI-DLS---D-------K-----KANGISLKIRESNKQR
R5EXK3          HVNGYDGEAEIL-----EKRLDI-DLS---D-------K-----KANCISLKIRESNKQR
A0A401UAP7      MLNDAQALRAYF-----TERLMV-TPK---N-------Y-----NANTIRISFKEFSAEK
A0A1W2GF52      VLNSKESLINYL-----ESHVTV-EPI---N-------F-----NANTIKISLSDFNQTK
A0A2G5L7B8      VINSREALIDYF-----QQNIIV-EPI---N-------F-----NANTIKIALADPNKYK
A0A523GAC0      KINSQNSLLLYL-----ENNITV-EPL---N-------L-----TANTIRISFRDHNRYK
L8JW09          IINSKAAQIKYL-----GSNLTV-EPL---N-------L-----NANTIRIAFKDYNPLK
A0A5C7MX19      RKYDKSFVIADV-----INKVSI-EPL---D-------F-----KTKSFKISYKDKSAVK
A0A364XUP5      IINSRDVLMNYL-----IANLTV-EPL---N-------F-----YAKTIRVAFKDNNPSK
A0A1M5RLA9      VLNTRDALLGYL-----LRSLTA-EPL---N-------Y-----NAHTLRISFKDNNPTK
A0A385SFR9      VLNTRDALLGYL-----LRNLTA-EPL---N-------F-----NANTLRISFKDNNPSK
A0A5M4A9J4      RFNTHGALVDYF-----RHSLTV-ATV---N-------K-----DATLLNLKMESATPSK
A0A5M4B1C7      SFHNHNGLVNVF-----RKNLTI-ETV---N-------K-----DATLLKLSMLSPTPQK
A0A0D3LFR6      IINSDQSLIDYL-----STNLTV-TIL---N-------P-----NAKTIKISLTDYNPYK
M7N6D4          IINSDNALINYF-----RQNLSV-SIL---N-------P-----SAKTIKISLSDHNPFK
A0A1Q3ZMZ7      IIQDPGLLTRQM-----MSSLKI-IPL---N-------P-----EAQTIEIKFESHNANL
A0A2D8JJW3      KDGDIRAAVERL-----QESLNI-NHV---K-------E-----TSHLV-ITVESLDSKE
A0A2W2AFF7      DVQSTDEAVEDY-----RKALTA-NVV---N-------K-----QVTLINLSLQSNIPHQ
A0A2N5YXE2      TINNTKTVLTNI-----ASNLEI-QVL---N-------E-----NAGTILITYNDYNARK
A0A2W1NDY9      KINNYKTLTNVL-----IHSLIV-NIE---N-------A-----DANTIKVSFRSNNNVL
A0A5C8AQR5      VFNERKALIDRL-----LPGLII-VPI---N-------L-----EAKTIEISYQAYNPVL
A0A1G0CI31      TFNNKKTLVTRL-----LPNLEI-TPA---D-------I-----EAKTILIRYQGYNAEL
A0A556N0M0      TFNNQKTLASRL-----ITNLEV-NPI---D-------I-----NAKTIELRYSGNNPDL
F2IKD6          TFNNQKNLAARL-----ISNLEV-NPV---D-------A-----NAKTIELRYTGNNPEL
A0A1I7BM74      VFNNTQSLMARL-----HGDLTI-APL---D-------V-----KAKSILISYRSNNAHL
A0A2G2FJ17      HFNSEDNLASKY-----LSGLAV-SPV---D-------I-----QAKTIEISYRNTNANL
A0A077ENE7      AKSPREAVMSNF-----VGNLSI-KQM---E-------E-----EASLMQVTMTDDSSER
T0NN57          TKYPREAMMENF-----KGKMKI-AQM---D-------E-----DASLLQITMEDQSPER
X5K347          TKYPREAMMENF-----KGKMKI-AQM---D-------E-----DASLLQITMEDQSPER
A0A2I0QZ80      VFNDLNTVSSRF-----HDDLSI-RPI---D-------Q-----KAKTVEISYRSHSPTF
A0A3E1F1A3      VLNEDKVLANNL-----HSGLSV-SLV---D-------N-----NAKTVEVAYRSSSPQL
A0A2U2XBJ3      ELNDKSTMSRRL-----RPGLTV-TPV---D-------A-----NARTVQISFRSHSPLL
A0A4Q4KU94      VLNEKKSIARQL-----RSGLTV-TPV---D-------P-----NARTVELSFRSHSPTL
A0A2U1FKU2      VKEDMRKVVERY-----NQELQV-ALA---D-------K-----KSTIVRLSLNNTDLDR
A0A0A2F954      KKENTRKVAERY-----NQDLQV-SLA---D-------K-----KATIVNLSLKNEDLDR
A0A0A2FW91      TKENTRKVVERY-----NQDLQV-SLA---D-------K-----KATIVNLSLKNEDLDR
A0A2D2N2N1      TKENTRKVVERY-----NQDLQV-SLA---D-------K-----KATIVNLSLKNEDLDR
Q7MWZ2          TKENTRKVVERY-----NQDLQV-SLA---D-------K-----KATIVNLSLKNEDLDR
T2NDT6          TKENTRKVVERY-----NQDLQV-SLA---D-------K-----KATIVNLSLKNEDLDR
W1R7P9          TKENTRKVVERY-----NQDLQV-SLA---D-------K-----KATIVNLSLKNEDLDR
A0A1R4AFZ0      TKENTRKVVERY-----NQDLQV-SLA---D-------K-----KATIVNLSLKNEDLDR
A0A1R4DVZ7      TKENTRKVVERY-----NQDLQV-SLA---D-------K-----KATIVNLSLKNEDLDR
A0A5M4B212      AFHSLDQLTNEY-----MEKLTV-APV---S-------K-----EGTMIKLSTTCENPEK
A0A1T5K9D4      QKIPVSQAAAAY-----SSALSI-SQN---N-------S-----AETVLNLSIQDFSLQR
A0A3D1KEX9      TRIKKEDAITKF-----NKAVTA-SEV---N-------K-----EASLISLTCKDNNKDR
A0A358Y7S2      EFIQREKLIEEI-----KEKLTV-IAV---N-------P-----EAKTIEITYENSNAKL
A0A1X7J248      TISTPESLMSYV-----ESNLSV-APE---N-------L-----NANTIKITFEDYNPYK
E4TQD2          TISTPESLINYV-----ESNLSV-APE---N-------L-----NANTIKITFEDYNPYK
A0A2J6HHN3      VFNNIDNLVYKY-----SRKINI-SVV---S-------D-----AAKTIRISLRDINASK
A0A1Y3WMT8      HINGYDTQTELL-----EKRLEI-DLS---D-------K-----KANGISLKIKDSNRKR
A0A1Y4GQU1      HINGYDVQTELL-----SKRLEI-DLS---D-------K-----KANGISLKIEDSNRRR
A0A1V5W8T5      RILDDKGAFAEH-----ITGLDV-SIL---N-------F-----DAKTIRIYYTSNNAQK
A0A2T8HKA9      TKIPRETMVSYF-----LSRMKI-VQI---E-------D-----DAGLLQLTLEDHSPKR
A0A3B8INU3      VINSNGALLNYI-----GAHLAV-TPL---N-------L-----NANTIRVSFQEYNRQK
A0A414ZBF2      KKGNRKNVSDNY-----NANLQV-EVV---D-------K-----SS-LINLTIEDENIGR
A0A1Q3Q573      KFNDKQTIINDI-----NSKITI-EPI---E-------A-----GNNTLAITYADQNPEK
A0A662BAY3      RFNIRSDLLKQY-----KNDLSV-NML---S-------Q-----ETSIIELSLKTLNVAK
A0A4U3L369      QITSYDNATAAY-----QKNLVI-TVP---D-------D-----KANVIDLSMTSKVPSK
A0A357YNR3      DIYRPADVANMY-----LGNLTV-ELT---S-------K-----TSSVADVSLICSNVAL
A0A5E8AX52      TINSESALISFF-----QSNVTV-QPL---N-------F-----SAKTIKISLRDFNKYK
F4KK08          QKDNFNAVVRNY-----MKALQV-SLQ---Q-------K-----DASVIKLTIQAGNPLL
A0A496LCF9      QFRTRQSLISEF-----FAKLQI-RLI---E-------N-----TS-VLDVSVNSDNPAR
A0A5P2G2A9      VINPIKSEVQGI-----LQNLSA-EIP---N-------K-----QVSAINLTLPVEIPSK
A0A419VXB7      EFNDLEKLTLSY-----LRQLQV-STV---N-------K-----DADVISLQLTGQNPDQ
C3J7R8          EKNTRERSIRSF-----SHIFNV-SSA---S-------K-----QGSIITLTMQHQNPEV
A0A0B0BTJ4      YVRPVRNAAEAY-----AKALHV-AQA---Q-------K-----FSNIVNVSISDHNPQK
A0A3B9CNN6      YVRPVRNAAEAY-----AKALHV-AQA---Q-------K-----FSNIVNVSISDHNPQK
R5X290          YVRPVRNAAEAY-----AKALHV-AQA---Q-------K-----FSNIVNVSISDHNPQK
A0A1Q6E6I7      YVRPVRNAAEAY-----AKALHV-AQA---Q-------K-----FSNIVNVSISDHNPQK
A0A1G8BVM8      SKINKMNLAKSL-----VAKFNI-ESV---D-------K-----QSSLVQLSIIDTHPQR
A0A2G2F510      TFNSIESVTERL-----RKGLKV-VPV---E-------V-----GAKTISISYRGYTPQL
A0A316JZ08      TFNSRQGLVERL-----HGGLDV-IPM---D-------P-----NARTIQVSFKGHNARM
A0A1I1FXP9      TINSRNKLLMQM-----FFNTSA-YIL---N-------Q-----SANTIRIIIKDHHPQK
A0A3N4H5N3      NFVNPVLITEQF-----SKSLTL-EQP---S-------I-----KSSTIYLTMLNTSPAR
A0A2P8EAX2      RLENPIVKTERY-----AKALNF-EQS---S-------V-----KSSTLFIRLLDSSPTR
A0A4V2F6N9      ILENPIVKTERY-----AKALKF-EQS---S-------V-----KSSTLFIRLLDSSPTR
A0A3B9FXJ0      IIRNKLTVAKAM-----EKRIRI-DAE---N-------T-----YGGKIVIEYTDVNDQR
R5GSU5          ------TATEMY-----RSKLSC-GEI---D-------K-----ESSLIVLTFQDTNKKR
A0A2A3UE91      IVHDVDAVTAQL-----QAKVEL-KLL---N-------E-----LAKTILIRVKDVNAAK
A0A0A2G557      IVNSKEKTVADL-----SKKLTI-SQS---G-------K-----QSSVIDLRFKDENTDF
A0A2N2WFW8      VFNSVKDLANSY-----SQKINI-AVL---N-------D-----VAKTIRISIRDMNPRK
A0A1F3IU95      QFNNLTDIAAQY-----SQQVNI-AVI---N-------D-----VAKTIRISLKDYNPRK
A0A3D0VUF6      QFNNLTDIAAQY-----SQQVNI-AVI---N-------D-----VAKTIRISLKDYNPRK
A0A1T4PT95      TISSREEIISDL-----AKRLTI-AQS---S-------K-----GSSIIDLRFRDENPHL
A0A4P5TMD1      VINSRDNLSKDI-----RTKIRI-ELY---P-------P--------TIQFSLQDPVPLK
A0A651GU15      VINNPNSLVSRF-----RSNMEV-RVM---N-------N-----IAQTIQISCKNHNATL
A0A3Q9FR88      QFNSKSSITNFI-----RKNISV-LIF---D-------P-----KANTIQISFKAANREK
A0A553GEX3      QFNSKSSITKFI-----KKNISV-LIF---D-------P-----KANTIQISFKAANREK
A0A150ADJ9      VVNSRPSLVKFL-----KKNISV-QVF---N-------P-----KANTIQISFTAGNREK
A0A1B1FWQ4      TFNSKASIIGFL-----KRNLSV-MIY---D-------P-----KAKTIQISFTARNRKK
A0A1S1Z228      TFNSKSRIIGFL-----KANLSV-MIY---D-------P-----RAKTIQISFTARNRKK
A0A2A4PYG9      IVNNTAAEIDKY-----YHLIDV-RIL---N-------Q-----AAKTIQVTVRENNPQK
A0A1F3K695      IIKNPNNVYLDH-----FSRLEV-AVQ---N-------Q-----LAQTIEIAFSDNNPLK
A0A353KZR1      IIKNPNNVYLDH-----FSRLEV-AVQ---N-------Q-----LAQTIEIAFSDNNPLK
A0A2N2WYB5      IINNPQTLVDLH-----LQTLQV-ALQ---N-------R-----SAQTIQITYSGYNPEK
A0A1F3K4G0      VISNPKNIVENH-----LQNLDI-FLL---N-------R-----SAQTIQISYSGYNAEK
A0A356H8Y3      VISNPKNIVENH-----LQNLDI-FLL---N-------R-----SAQTIQISYSGYNAEK
A0A351HSA6      VISNPKNIVENH-----LQNLDI-FLL---N-------R-----SAQTIQISYSGYNAEK
A0A1F3Q014      TLNDLDAIVNES-----YPKVEV-KLL---N-------D-----QAKTILVSYKGFNPQK
A0A2A4YXP3      RINSYEEMTNAW-----DYKLSV-FPL---N-------N-----AAKTINISFEDHNPKK
A0A2D5KD44      VLNNPQSLVKGI-----LSRLEI-VIL---N-------P-----NAKTLQVGISDNNRLK
A0A1F3R158      TINDIESLTNSY-----ISSLNV-FPL---N-------P-----LAKTISLSFQDNNAVK
A0A2M8ADX2      TINDIENLTNNY-----ISKLNV-FPL---N-------P-----MAKTISISFQDNNATK
A0A1J5B2H0      IINNPSTNLSNY-----VRPLNI-SII---N-------E-----AAKTVSITFRDENAQK
A0A1V5N756      VLKKPSDILSSY-----IPNLSV-FVV---N-------E-----NSQSIMVMYSDRNPVK
A0A1F3SJM1      IFNSVQSVAERM-----RNGVTI-TPI---D-------V-----AAKTISISFRGHNAQL
A0A2G2EB96      IFNGREQLSNRL-----IQDLSV-SSI---D-------P-----YAKTISISFRGYNAVL
A0A2G6PRA9      IFNGREQLSNRL-----IKDLSV-AAI---D-------P-----NAKTISISFRGHNATL
A1ZKR2          KINSRQALISYL-----NNNLQV-GIL---N-------K-----SARIIGINFRDHHPQK
A0A1Q3GX01      KLNSRQTLIDYL-----NKNLQV-GIL---N-------R-----SARIIGVNFRDYNPLK
A0A349DQI4      KLNSRESLIRYL-----NTNLQV-GIL---N-------R-----SARIIGVNFRDFNPLK
A0A2N3IIZ0      VLNSKGKSMNYL-----ANNLEA-FIL---N-------P-----QAKIIAISFKDHNATK
A0A497D5Z2      RFRTNESLADQY-----KKNLTI-ENV---P-------K-----ESSILEISLLEENEQK
A0A662B170      RFRTNESLADQY-----KKNLTI-ENV---P-------K-----ESSILEISLLEENEQK
A0A2A5FYT6      IINDVNQITEQY-----HHRLRV-ELL---N-------A-----AAKTIKISFTDHSGKK
A0A2E6SYP1      MINNEKQIVNHF-----SKGLDV-SIF---N-------V-----RAKTIKIGYSGDHPEK
A0A2E5RLE8      KIVDKNQLISKY-----SKGLQV-NIE---N-------T-----RANTIKISYTGNHPKK
A0A2E7TQF6      KIVDKNQLISKY-----SKGLQV-NIE---N-------T-----RANTIKISYTGNHPKK
A0A2E6GVY9      KIVDKSQLINNY-----SKGLSV-NIE---N-------S-----RANTIKISYTGNHPKK
A0A350JJ90      ILNSAPTLVQKL-----SKNYSV-RIQ---S-------A-----AAKTVQIVVTDNNPAK
A0A3M1CDV2      IIQSKDAVASYL-----QKKLEV-KPL---N-------D-----LAQTISISIKDVNPQK
A0A522EYA6      VVNNIDALANEY-----FSRLSV-KLL---S-------D-----AAKTIQISFQDNNAAK
A0A4P5U6G4      VINNRQTVAKRI-----RDVIRI-------N-------P-----YTPSILISFQDKNPYR
A0A2E2TFD1      TLNNNASIVNRY-----SKSLDL-KVL---S-------Q-----SAKSISISFTDPNPRK
A0A2E4ELE6      RLNSDAEIISKY-----SKSLKV-KLL---N-------Q-----AANSVEISFSDYNPRK
A0A2E3XZI5      IIPTIKQIKKEL-----LGGLEV-NII---D-------R-----SAHTINIIHKHSNTFF
A0A2M7NLQ9      TLNSPEYQIAYI-----ASSLRA-NVL---N-------P-----KAYTIQVSFTDNNPYK
I4AFR0          TLNSHEYQINYI-----ASSIKA-NVV---N-------P-----KAYTIQISFTDNNPYK
A0A2N2Y3E5      IVNNPETQLNKI-----IQNLVV-GVL---N-------F-----EAQTIQITYTDFNPQK
A0A2D9D7T6      VFNKKYDVMRSL-----KKNLTV-SAI---D-------P-----SAKTIQITFDHYNPEL
A0A1F3PPL5      ILKNPTTLLNEH-----ISKLEI-KLQ---N-------P-----EANTIEISYVDNNALK
A0A357QK06      ILKNPTTLLNEH-----ISKLEI-KLQ---N-------P-----EANTIEISYVDNNALK
A0A662AEA4      IINNPDNIYLKH-----IDEIEI-RLL---N-------K-----YANTIEISCTSNNANK
A0A0S2HYK8      VIYNDEQIFTEH-----SKKLNI-KLL---S-------S-----SSNSIEISYQSHNSQQ
A0A2N5ZWN6      IISNMDQIYSEH-----SAKLTI-RLL---N-------S-----SSNSIEITYESNNSQQ
A0A0F2NS19      AINDLEALTNKY-----IQQLGV-FPL---N-------P-----SAKTISISFNDNNALK
A0A2A5H8X6      AINDLEALTNKY-----IQQLGV-FPL---N-------P-----SAKTISISFNDNNALK
A0A2H0GAU8      VINNIDDLTSRY-----ISQLNI-FPL---N-------P-----SAKTINISFQDNNSTK
A0A2M8FTK1      VINNIDDLTSRY-----ISQLNI-FPL---N-------P-----SAKTINISFQDNNSTK
A0A2A5B3B0      KINDYDKLTFAY-----IGKLAV-FPL---N-------N-----AAKTINISFQDNNGEK
A0A5C6RXM7      KLNDNASLANNY-----ISKLSV-FPI---N-------I-----SAKTINISFKDYNAAK
A0A2E0FJ09      LYSDLEKLASEF-----SAMLEV-SIA---N-------S-----NANTIGLSFTHPNQVL
A0A1F3FZ62      IINNPDLIVNEH-----INQIDV-SIL---N-------V-----LAQTVLINVTNQNATK
A0A1F3K211      IINNPDLIVNEH-----INQIDV-SIL---N-------V-----LAQTVLINVTNQNATK
A0A1F3KLL5      IINNPTYLLQAY-----KANLLV-EVL---S-------D-----EAKTISIKYSDYNAQK
A0A359D1M1      IINNPTYLLQAY-----KANLLV-EVL---S-------D-----EAKTISIKYSDYNAQK
A0A2E7CT70      KIPFFQEKRNEI-----INDLEI-SII---D-------P-----AANTIGITYSHTNPKF
A0A2D5V560      RIPSXNELKNSI-----LNGLTI-NIK---N-------Q-----SAHSXQISHQHTNPHF
A0A2D7K5A8      KIPTKKEVINIL-----KNSLTI-TIQ---D-------Q-----SAHSIKISHLHTNPHF
A0A2E1XQ82      KIPNKKEVINII-----KNSLTI-TIQ---D-------Q-----SAHSIKISHQHTNPHF
A0A1V6I2U9      TINNPNTTLKNL-----SKRLNV-QIL---N-------E-----TAGTIKITYQDFNARK
A0A1F3C1M2      IINNPINIIKDN-----LLKLKV-NIL---N-------P-----SAQTVDISFTDNNATK
A0A1F3DS87      IIKNPANIIKEN-----LDKLKI-SIL---N-------P-----SAQTVDISFIDNNATK
A0A2H0B957      TLNDSETVYQKY-----SSRLEV-SLL---N-------Q-----EANTISISITDNNARK
A0A1F3CFW6      IINDTESVYKKY-----SSQLEV-SLL---N-------Q-----EANTIQISFKDNNAQK
A0A2M7E2T8      IINDTESVYKKY-----SSQLEV-SLL---N-------Q-----EANTIQISFKDNNAQK
A0A2M7NC69      IINDTESVYKKY-----SSQLEV-SLL---N-------Q-----EANTIQISFKDNNAQK
A0A5C8A5B4      EIYSLKDLVRVY-----RAMTMAVPLS---D-------------ESNVVNLSIQVEVVEK
A0A4Y9ITE2      VVNNYNQATENL-----QDDIKC-SIP---N-------K-----KARVITISLNSTNVPF
A0A5M8NYX7      VVRHPK-----Y-----IPYIQV-NPL---N-------K-----MTTVVDVTTKTEVPQK
A0A3D5KRY6      IFNDLSRMALAY-----KEKLVV-KAL---S-------AIDPTINSNMITLELKTNQLER
A0A1V5IPN7      --------------------------S---K-------R-----DTDILNLSFESTNRGE
A0A0E3V905      QVTKRATSVKNY-----LTNLHA-IPT---G-------K-----GSTVILLSLEDAVPAK
A0A553ETH6      TINSRAQLISYF-----ERNLVV-EPL---N-------L-----NANTIKIALQDFNRYK
A0A640Q161      LAAKKRKATSLL-----MNALTV-EMV-----------D-----NTQLMRITVTTESPSL
A0A640QU49      LAAKKRKATSLL-----MKALNI-EMV-----------D-----NTQVMRITVTTESPNL
A0A1Q3PII2      KISTEESVLDLY-----TRVLNI-YAP---N-------K-----TASLVNLSWQDVLPRK
A0A351BXT2      TALISVSSLADI-----LSQIVK-IDQ---K-------R-----GLDVVDIIVESPAKYE
A0A2K8Z965      QVSKQTSAAKSY-----LSNLHV-IPT---G-------K-----GSTVILISLEDGVPSK
A0A418M8U8      QAMKRPAAVNGY-----LRTLQA-EPT---S-------K-----ASTVVVLTLEDAVPEK
I2GTA4          QAMKRPAAVNGY-----LKTLQA-EPT---S-------K-----ASTVVVLTLEDAVPEK
A0A2K8ZAJ2      TVSLHNDAVEGY-----LGNLKI-GST---T-------M-----LSTVLVMNLQEAVPSR
A0A368JPA3      QVMSPAQTIRYY-----QSKLTV-APS---G-------K-----ESTVLVLTIEDAVATK
A0A5N1JI29      QVMPQAQTIRYY-----QSKLTV-APS---G-------K-----ESTVLVLTIEDAVPTK
A0A3P1BT12      QVMEHPQAIRYY-----LSKLNV-EPS---S-------K-----TSTVLVLTIEDAVPAK
A0A3P1CI15      QVMTDPQAIRYY-----LSKLTV-EPS---S-------S-----TSSVLVLTIEDAVPAK
A0A4R8CUK1      QVMPDLEAIEYY-----LGKLQV-EPS---S-------D-----ASTVLLLTFEDAVPAK
A0A3D0MYJ7      --------------------------------------K-----NLNIIDISVKSTSFPE
A0A662AH13      --------------------------------------R-----GLDIVTISYESHSPFE
A0A5C7QA01      RKQSLPNAIKSL-----SANYAV-AER---G-------K-----LTGVLGLNYQGADKIH
A0A3D3LS70      --------------------------------------R-----GLDIISIDVDSPSRTE
A0A1G1TM36      RTSSPEAVVQAY-----QKLLDI-ELI---N-------K-----VAPAIRLQIKDQVPQR
A0A1G7ZF38      KISATETILDHY-----DRVLRI-QAP---N-------K-----AASLVNLSIQDVLPRK
C6VS52          RTLAKETVVDHY-----ARTLSI-QAP---N-------K-----IASMVNLSIQDVLARK
A0A0P7X1V8      -----------------YGNLTF-TRA---D-------R-----NSNLLRVSYRSPSPYE
A0A3B0C2S4      VLKSVKDAVFAL-----SEKLQV-QPT---D-------K-----RSEVLSLSIKGQSPER
L8JI02          VIHDLSEVIETY-----QTELEV-YPI---S-------R-----ESNIVELSMRGSVPHK
A6EBM4          RFNTPEDFLDRI-----REGLRI-GEA---G-------K-----NSNILSLQQTDVNPRF
A0A416GA42      LKSTVRNTGNAL-----VARLGV-AKA---S-------K-----ESSMIQLNITDPVPQR
A0A4R5DL69      KISGFESTVSEY-----SRRLSI-SAT---N-------K-----QVSIISLRLTDILPRK
A0A1T3IYP5      AKYPREVIMSQF-----VANLKI-KQM---E-------E-----DASLLQVSMEDQSPER
A0A1M4YED3      FLYNPESLASSY-----ANRVSI-PPN---P-------K-----SSTVLTLYFQDESAYR
A0A3P1Z8V4      HHYSNEIAARIY-----KKALTA-AEY---S-------K-----ESSLLLLTCTDINKHR
A0A2N3U785      EFKDYRRVANYY-----RNALSI-YPI---N-------K-----ETKVIAIELTEPVPEK
A0A0E3ZG78      KFKNVQQLAEHY-----SQAIQI-GPV---N-------K-----SASVLWVGLTDPIPEK
A0A1I6BRK6      YFQDIYQVANHY-----SQAINI-KPV---G-------K-----TTNVLNISLIDPMPER
A0A243WAB1      SFQDIHQVADHY-----NKAIAV-QPV---G-------K-----SASVLSLSLVDPIPEK
A0A126PFG0      VARDPDLVVTAY-----QKALEV-DLI---N-------K-----ISPAISLQIKDEVPQR
A0A3M1N7Z3      VVFAPQATTFAW-----QRRVSV--IP---K-------R-----GTTILQVSVTDISPVR
A0A2H3NSN0      --------------------------------------A-----DQGLIRIVARSQYPEE
A0A2P6C324      --------------------------------------Q-----QQGLINIRVESQDPAE
A0A1M6XHU0      --------------------------------------S-----DQDMIVITAESTTPEE
A0A5S9C8G0      --------------------------------------S-----DQDMIVITAESTTPEE
G2SF81          --------------------------------------S-----DQDMIVITAESTTPEE
A0A5S9EYW1      --------------------------------------S-----DQDMIVITAESTTPEE
D0MHQ9          --------------------------------------S-----DQDMIVITAESTTPEE
A0A4D7K1D4      KINNKESQINFI-----QQNLKV-EAQ---S-------L-----AANTIKITFTDNDKYK
A0A3C1ITV0      GYERPELTAKSC-----QARLTA-ELA---D-------K-----LATVINFSYTDASEKR
R7HN19          GYERPELTAKSC-----QARLTA-ELA---D-------K-----LATVINFSYTDASEKR
A0A060RD97      AVTSVAKAQLDF-----SSRLTV-ARA---D-------K-----VSSVVNLSFIDQSPQR
A0A0D3L8Q3      HFNNIQRLASNY-----SDRLVVEKDK---L-------A-----WSSALILSLVDPVPEK
A0A5B6TJH8      QFQNIQEVASRY-----HNAIEVMQAG---K-------T-----WTNVIKLELTDSKPER
A0A519U664      RFNDIHQVAAHY-----SQAIGIQPVG---K-------S------SNVLTLSLVDPIPEK
A0A519UDD1      RFQDILKVADYY-----NKAIGVQPIN---K-------N------ASILYLSLTDPIPAK
A0A519MA34      RFNDIHQIAAHY-----SQAIGIQPVG---K-------S------SNVLALSLVDPIPEK
A0A519UCX0      QFNDIHQVAVHY-----SQAISVQSVG---K-------S------SNVLNLTLIDPIPEK
R7PCR1          TRISVKDAAKIY-----VKRISA-TPV---D-------K-----QSSLIQLVCQDVNKKR
A0A350IHV0      SWVNAKRLAKAY-----CKKLNV-SLS---G-------K-----ESTVLVLSLEDTFPRR
A0A1G9E2A9      VINSRGALISYL-----AENLTV-NVV---N-------A-----NASTIRIAFKDYTPEK
A0A098LL25      TMNSKEALVKNL-----MDNVSV-SIL---N-------L-----DANTILLSYKNHNYSK
A0A2T2YJE8      IVNSNAAIRQYL-----TSNVAV-NIV---N-------L-----DASTVEISFTDHNPFK
A0A127B287      IVHSSGALKRYL-----NDNLSV-AVL---N-------P-----EAKTISISFKEFNREK
A0A3M9N829      IVHSSQRLKRYI-----DENLST-AIL---N-------P-----ESKTIQISFKDFNRYK
A0A0P0CSF9      IVNSDQRLKGYI-----DTNLTT-AIL---N-------P-----ESKTIQIAFKDFNRFK
A0A5M8QQB8      VINSDQRLKGYI-----DGNLTT-AIL---N-------P-----ESKTIQISFKDFNRFK
A0A3M9MNC3      IVHSNQSLKGYI-----DNNLTT-AIL---N-------P-----ESKTIQISFKDFNRYK
A0A5B6TAX2      IVHSNQALKGYI-----DNNLTT-AIL---N-------P-----ESKTIQISFKDFNRYK
A0A5N1IQ33      VINDDGAMARYF-----DENLVV-EIV---N-------P-----EANTIGISFKDNNALK
A0A512AYT3      VINSDGALNSYF-----NQNLSV-EIV---N-------P-----DAHTIGIFFTDFNPAK
A0A5M6CYN7      VINSDGALNAYF-----NQNLSV-EIV---N-------P-----DAHTVGIFFTDFNPAK
A0A369QP10      TINSTGAIRQYL-----TSNVAV-NIV---N-------L-----DASTVDISFTDHNPFK
A0A126PDF2      TIQDQGTVNAYL-----EKNLAV-DIS---S-------A-----DANTIQISFTDFNPKK
A0A2Z3GKA1      TVQDEGTVNAYL-----EKNLAV-DIS---S-------A-----DANTIQISFTDFNPKK
A0A502GZP7      TIQDEGTVNGYL-----EKNLAV-DIS---S-------A-----DANTIQISFTDFNAKK
A0A519SBU8      VILDDGALNAYL-----DRNLDV-AVV---N-------P-----SANTIQISFTDNNPSK
A0A4Q3JNZ3      VVLSDGDISGYL-----NRNLDV-TVV---N-------P-----SANTIQISFTDNNPEK
A0A519Q9V3      VILDDGAVSDYL-----DTNLDV-AVV---N-------P-----SANTIQISFTDNNPEK
A0A0M3RW20      VVKDNGAINQYI-----DQNLTV-EII---N-------P-----EANTIGISFADHNPLK
A0A495VFX4      VVNDKSSINQYI-----DQNLIV-EII---N-------P-----EANTIGISFSDHNPLK
A0A1S9B3W0      IIKDPGSINGYL-----GSNLGV-SVI---N-------P-----DASTIGISFTDNNPAK
A0A1W1VRL3      VILDEGTLNTYL-----NTNLSV-QIV---N-------P-----DANTVQISFKDFNPAK
A0A1M6R305      TINDEGTINSYL-----DRNLLV-EIV---N-------P-----DANTIQISFQDFTPAK
A0A4Z0PHK3      VINDEGAVNNYL-----NTNLSV-DIV---N-------P-----DANTIQIGFTDFNPAK
A0A2M9B9H9      VINDDGAVNNYL-----NTNLSV-DIV---N-------P-----DANTIQIAFTDFNPAK
A0A4Z0QCY9      VINDDGAVNAYL-----NTNLSV-DIV---N-------P-----DANTIQISFTDFNPAK
A0A418R9X5      IINDQNAINGYL-----NQNLSV-DII---N-------P-----DASTISISFTDYNPSK
A0A428JSJ3      VIQDGGTVNAYL-----TQNLAV-DIV---N-------P-----DASTISISFADHNPVK
A0A428KI59      VINDDGTVNGYL-----NQNLAV-EIV---N-------P-----DASTISIAFTDHNSVK
W8F1I6          VINDDGTVNGYL-----NQNLAV-EIV---N-------P-----DASTISIAFTDHNPVK
A0A246FQC0      RINSNSALNEYF-----DTNLLV-DIV---N-------L-----DANTISISFTDHNPAK
A0A372E5P8      VINSAGALGNYF-----NTNLLV-DIV---N-------L-----DANTISISFTDHNPAK
A0A1H3EMW1      MINSPGALSNYF-----NTNLLV-DIV---N-------V-----DANTISISFTDHNPAK
A0A1H9ZSN3      MVNSPGALSNYF-----NSNLLV-DIV---N-------V-----DANTISISFTDHNPAK
A0A5N1J2M4      TINSPAAVLNYI-----GSNLSA-QVV---N-------F-----DAQTIKISFTDHNPKK
A0A519S476      VILNDGAINAYL-----DKNLDV-KVI---N-------P-----NANTIQISFTDNNPVK
A0A4Q3JRW8      VILNDGAVSGYL-----DRNLDV-AVV---N-------P-----NANTIQISFTDNNPEK
A0A519M923      TILNDGAVNAYL-----DKNLDV-AVV---N-------P-----SANTIQISFTDNNPEK
A0A4Z0ENW1      IILDDNTINSYL-----DRNLKA-EVL---N-------P-----SASTLQISFLDNNRVK
A0A519UDB4      VLLEDNAITAYL-----DRNLTA-EVL---N-------P-----SANTIQISFQDNNRLK
A0A3S0QKV1      TINDAAAINGYL-----SANLTV-SVI---N-------P-----EASTIGISFSDNTPQK
A0A328BL48      VINTPEAINGYL-----AQNLTV-SVI---N-------P-----DANTIGISFTDYNPAK
A0A5R8WLY4      VVNTPEAINSYL-----AQNLAV-SII---N-------P-----DANTIGISFTDYTPTK
A0A1I5WSL8      TILSDGAVNQYL-----DKNLAV-EIV---N-------P-----EANTIQISFNDFNPTK
A0A0U3JVM7      TILDDRTVNEYL-----DKNLTV-EIV---N-------P-----EASTIQISFNDFNPSK
A0A1G1SSV2      TIQDDRSVNAYL-----DKNLTV-EIV---N-------P-----EANTIQIAFNDFNASK
A0A1G1SXV7      TIQDDYTVNAYL-----DKNLTV-EII---N-------P-----EASTIQIAFNDFNPSK
A0A0W8EDI5      IIHDNSSVWSYI-----DQGLTV-EII---N-------P-----EANTIAISFKDHNPKK
A0A3B7RBP8      VIHDDATVWGYI-----GENLTV-EII---N-------P-----EANTIGISFKDHNPGK
A0A3R9P8H7      TINSNGALNAYF-----NKNLLV-DIV---N-------V-----DANTISISFTDHNPTK
A0A238WIA7      IIHDEGTINGYL-----SQNLQV-QVV---N-------P-----DANTISIGFTDYNPLK
A0A212UCJ7      VIRDEGFINQYL-----SSNLQV-QII---N-------P-----DANTISISFTDNNSLK
A0A4Z0MQE1      IIRDEGFINGYL-----SSNLQA-QIV---N-------P-----DANTISIAFTDHNPLK
A0A4Z0PCF4      IIRDDAFINGYL-----SSNLQV-QVV---N-------P-----DANTISISFTDHNPLK
A0A5D6VDG1      VIRDDASINRYF-----DENLTV-EIV---N-------P-----EASTISISFKDHNPRK
A0A243WHR7      VINDDGTISNYL-----NKGLNV-QVV---N-------P-----DANTIQISFTDFNPSK
A0A5B8A0P6      IINDEGTLNSYF-----EKNISV-DII---N-------P-----NANTIQISFQDFNPLK
A0A076HRT9      TINDEAAINAYL-----DRNLLV-EIV---N-------P-----DANTIQISFQDFSPSK
A0A4Z0PVM7      VINDDGAVNAYL-----NTNLSV-DIV---N-------P-----DANTIQISFTDFNPAK
A0A1M6DHW8      VINDEGTLNAYL-----SSNLSV-DII---N-------A-----DANTIQIAFTDFNPAK
A0A4Q5LC61      VINDDGGLNAYL-----SNNLSV-EIV---N-------A-----DANTIQIAFTDFNPAK
A0A2A8CVM9      -----------------TNEVMS-HMM---QRVSFVPMQ-----SQSMIQFTVESGVPEE
A0A3C0ZQC7      ILLTASEIAKRL-----MTAVEF-EPI-----------R-----DSDVIKVTARSVQPKE
A0A2E3R1D0      --LTVQEVAFRL----QRGSIKS-TME---T-------G-----GADAIRVNAVSTDPQE
A0A2T2USC0      ---TVSEIAGDLVSQGGKATMSA-SAA---GGNLAGQYE-----SADAINISVKGVSASE
A0A2T2V0F3      ---TVGEIAGDLVAQGGKATMSA-AAA---GENLGNQYE-----SADAIRISVRGVSASE
A0A2T2S682      ---SRAVLAGLL-----RRRVRA-QSA---G-------R-----EVDAIRITAQGPVPAE
D5H561          TQLSPASVAPAL-----AGRVRF-SRA---G-------A-----ETNVIQIVAQDETPAV
A0A2H3NWA9      ---SAQQLAGRL-----MGRVQA-SPG---G-------E-----EIDAIRLSATSTDPQE
A0A2A8CVB6      ---SQNQIAHRV-----RGSIRA-GTY---G-------E-----QFDAIRIVATGRDAAD
A0A2P6C1S6      ---SISAVAGQV-----QNMISA-QPS---G-------E-----ETDALYISASSHHPNE
A0A2T2UTM4      ---STAEVANQV-----KGMISA-QPS---G-------E-----KTDALYISAKSHHPYE
R5RVP0          SWVNSAKLAKAY-----CKGVTV-ALS---G-------K-----ESTVIVLTMKDRFPSR
R6A0L2          DRLSKEKAAARF-----LKMLSA-SEY---D-------K-----ETSLIVLNCNDTNIER
R7LG80          NRNSVSATADAL-----RKRMDV-AQI---E-------K-----EASLIGLTFQDINPKR
A0A2L2WX98      TRLPKKMAAASY-----CKQFSAGEYD---K-------K-----ESSLIILGCEDINETR
A0A285T4L1      SKNPLNAVAGRF-----QGSMGI-RQE---E-------D-----ESSILVLSLKDDSPLR
G5GD56          HHLPIEMAAKIY-----QEKIKA-SAY---D-------K-----ETSLVVLSAQDINTAR
R5KD55          RKSDNASATGRF-----LGGLSV-EIG---D-------K-----KSTILDLSYNDVSGKR
A0A174QNT3      TRSDLETVTNSM-----MERIQT-SAM---D-------Q-----KSTLVNIVYQDVNIAR
A0A4S2FGS1      TRSDLESATNAV-----MGRIQT-SAM---D-------T-----KSTLVNIVCQDVNIAR
R9I0H0          TRSDLESATNAV-----MARIQT-SAL---A-------S-----QSTLVNIICQDVNIAR
K5BUT9          SRISPEIATNIY-----QSKIAT-SLA---G-------E-----RTTLVQITCSDTNISR
A0A174FPA3      SRISPEIATNIY-----QSKIAT-SLA---G-------E-----RTTLVQITCSDTNISR
R6S9Y6          SRISPEIATNIY-----QSKIAT-SLA---G-------E-----RTTLVQITCSDTNISR
A0A642LIH6      SRISPEIATNIY-----QSKIAT-SLA---G-------E-----RTTLVQITCSDTNISR
C9KX15          SRISPEIATNIY-----QSKIAT-SLA---G-------E-----RTTLVQITCSDTNISR
R6DAG6          TRISPETAAAIY-----KGGIST-SLA---G-------K-----GTTMVQITCTGDNVSR
A0A3L8AAP1      TRISPETAAAIY-----KGGIST-SLA---G-------K-----GTTMVQITCTGDNVSR
A0A4S2AYX2      TRISPETAAAIY-----KGGIST-SLA---G-------K-----GTTMVQITCTGDNVSR
A0A4Y9H477      TRISPETAAAIY-----KGGIST-SLA---G-------K-----GTTMVQITCTGDNVSR
A0A0E2M2Y7      TKENIRKVIQRY-----NKDLQI-SLA---D-------K-----NATIVNLSMKNEDMDC
A0A0K2J6Z0      TKENIRKVIQRY-----NKDLQI-SLA---D-------K-----NATIVNLSMKNEDMDC
B2RKZ8          TKENIRKVIQRY-----NKDLQI-SLA---D-------K-----NATIVNLSMKNEDMDC
A0A212GC82      TKENIRKVIQRY-----NKDLQI-SLA---D-------K-----NATIVNLSMKNEDMDC
A0A254MU12      TKENIRKVIQRY-----NKDLQI-SLA---D-------K-----NATIVNLSMKNEDMDC
R6CQ93          SKIPLNAAAGRF-----LGSMGI-RQE---E-------D-----ESSILVLSLKDDSPLR
A0A3D1NQW3      TKGNLGVVTQFY-----QHEVKS-FVA---N-------K-----QASIITISMKSSVPKK
B0MT10          TKGNLGVVTQFY-----QHEVKS-FVA---N-------K-----QASIITISMKSSVPKK
R7JGW9          TKGNLGVVTQFY-----QHEVKS-FVA---N-------K-----QASIITISMKSSVPKK
A0A414Q925      TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
A0A415PUS9      TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
A0A108TCU0      TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
A0A413BA42      TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
S3Y344          TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
A0A4Q5G8Y8      TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
A0A412TGL3      TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
A0A413VJ33      TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
A0A414L0W6      TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
A0A412DP39      TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
A0A413ZSE8      TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
B0NP84          TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
R6AK43          TKGNMKEVAESY-----NKALNV-GVA---N-------K-----QSSLIALSIEDENVQR
A0A412N2D9      AKGNLKEVAEEY-----NKALNA-GVT---N-------K-----QSSLIALSIEDENVQR
A0A1Y4JYS9      AKGNLKEVAEEY-----NKALNA-GVT---N-------K-----QSSLIALSIEDENVQR
R6LHA4          AKGNLKEVAEEY-----NKALNA-GVT---N-------K-----QSSLIALSIEDENVQR
A0A3D2BF46      SKQIVSSVASGY-----NKRIAI-ELV---E-------K-----QANAISISLDDNIPRR
A0A4Y1WUN1      SKQIVSSVASGY-----NKRIAI-ELV---E-------K-----QANAISISLDDNIPRR
A0A4Y1XL94      SKQIVSSVASGY-----NKRIAI-ELV---E-------K-----QANAISISLDDNIPRR
A0A358R538      RKRSLGSATSAY-----RNAVKC-DVA---N-------K-----QASVVTVTMSNTVPRR
A0A1Y4AAB8      AKSSLEAATSAY-----RAAVKC-AVE---D-------K-----QTSVVGIAMNDAVPKR
A0A1Y3WWY9      GKSSLKALTDTY-----RGAIKC-DVA-----------K-----QGSVVTISMSNSVAKR
A0A1Y4U5L4      GKSSLKALTDAY-----RGAIKC-DVA-----------K-----QGSVVTISMSNSVAKR
A0A1Y3VCJ1      SKGDLKTIANMY-----RGAVKC-EVT---N-------Q-----QASVVTLSMNNAIPKR
A0A1Y3QTW7      TKSSPMVTTNAY-----RATVKS-DVA---N-------K-----QASIVTISMNSSVPKR
R6XWY7          TKSSPMVTTNAY-----RATVKS-DVA---N-------K-----QASIVTISMNSSVPKR
A0A4Y1X9Y9      TKSSPMVTTNAY-----RATVKS-DVA---N-------K-----QASIVTISMNSSVPKR
A0A4Y1WM66      TKSSPMVTTNAY-----RATVKS-DVA---N-------K-----QASIVTISMNSSVPKR
A0A174AVF1      TKSSPMVTTNAY-----RATVKS-DVA---N-------K-----QASIVTISMNSSVPKR
A0A656Q4F4      TKSSPMVTTNAY-----RATVKS-DVA---N-------K-----QASIVTISMNSSVPKR
A0A1Q6EIY0      IKNSLAATTNAY-----RAAVKS-DVA---N-------K-----QASIVTISMNNSVPRR
A0A5B5VN71      IKNSLAATTNAY-----RAAVKS-DVA---N-------K-----QASIVTISMNNSVPRR
E4M8L3          IKNSLAATTNAY-----RAAVKS-DVA---N-------K-----QASIVTISMNNSVPRR
I3YQ50          IKNSLAATTNAY-----RAAVKS-DVA---N-------K-----QASIVTISMNNSVPRR
R5UEY8          IKNSLAATTNAY-----RAAVKS-DVA---N-------K-----QASIVTISMNNSVPRR
A0A1H4D866      VKNSLSRTTNAY-----RNAVKS-DVA---N-------K-----QASVVTISMNNSVPRR
A0A5B3G4Y7      TKSSLGRTTNAY-----RAAVKS-DVA---N-------K-----QASVVTISMNNTVPRR
A0A374A9J5      TKSSLGRTTNAY-----RAAVKS-DVA---N-------K-----QASVVTISMNNTVPRR
A0A5B3GQN5      TKSSLGRTTNAY-----RAAVKS-DVA---N-------K-----QASVVTISMNNTVPRR
A0A1Q6E9S3      TKSSLGRTTNAY-----RAAVKS-DVA---N-------K-----QASVVTISMNNTVPRR
D4IJ36          TKSSLGRTTNAY-----RAAVKS-DVA---N-------K-----QASVVTISMNNTVPRR
A0A3E5HPT8      TSKSREGMVAFW-----LSNLTI-RQM---S-------G-----DAALLSMTMNDLSPTR
C6IJ48          TSKSREGMVAFW-----LSNLTI-RQM---S-------G-----DAALLSMTMNDLSPTR
Q8A3U2          TSKSREGMVAFW-----LSNLTI-RQM---S-------G-----DAALLSMTMNDLSPTR
A0A3R6S1H6      TKYNLLQVAKAC-----NAGLRA-YLA---D-------K-----KASIINLAIEDVSKAR
A0A3R6SD81      TKYNLLQVAKAC-----NAGLRA-YLA---D-------K-----KASIINLAIEDVSKAR
A0A354WXN6      NKRAASAVTNAY-----QAALNA-SLA---S-------K-----TSTIINLTLQDRSIPR
R5IP14          NKRRLKDATTRY-----RRAVSV-SLE---S-------K-----NGGALNITMNDTDIKR
A0A316SZX7      SKNPVKAVAASY-----KGRMNV-SLI---G-------K-----TTSSVSITLQDPNPKR
A0A1Y4AIY1      RKSNLKGIATGY-----QNALVS-ELV---A-------E-----YATIIKLSLSDVSASR
F3ZRU7          HHRGLKNVTLGY-----GNAIQI-ALA---D-------K-----KATIINLSLRDEVPQR
A0A0J6CIR2      SKRNREEIALTY-----SNSLQV-ALA---S-------K-----TATIINLTLQDVSIPR
A0A3D8HG59      TKSDLDETVLHF-----NRILQV-ALA---S-------K-----TATIINLTLQDESIQR
A0A3R6S408      TKSDLDETVLHF-----NRILQV-ALA---S-------K-----TATIINLTLQDESIQR
A0A1C5Q1F3      NKMNLEKVGMAY-----NAALQS-MVA---S-------K-----TSSIIHLSISDVSPRR
R7A239          NKMNLEKVGMAY-----NAALQS-MVA---S-------K-----TSSIIHLSISDVSPRR
A0A3R6HIK7      TKSRLKSVAKRY-----QSALQS-TLA---D-------K-----MSTIINLSLSDVSIAR
K5ZVW7          TKSRLKSVAKRY-----QSALQS-TLA---D-------K-----MSTIINLSLSDVSIAR
A0A1Y4D5Z0      RKSNLSNVARAY-----LNKLQS-TVA---S-------K-----TATIINLSLSDVSISR
A0A413VXJ7      TKSNMERVVDAY-----QSSMEV-SLA---S-------K-----TATIINLTLKDVSIAR
I9RSN9          TKSNMERVVDAY-----QSSMEV-SLA---S-------K-----TATIINLTLKDVSIAR
U6RJK5          TKSNMERVVDAY-----QSSMEV-SLA---S-------K-----TATIINLTLKDVSIAR
A0A1Q6GA32      TKSNMERVVDAY-----QSSMEV-SLA---S-------K-----TATIINLTLKDVSIAR
I9RPU6          VKSNLESVIEGY-----RGRLKV-SLA---S-------K-----TATIINLVLDDVSTAR
I8YFS5          TKANMEKVVEGY-----QSKMKI-SLA---S-------K-----TATIINLVLDDVSTAR
A0A4Q5F7I7      TKSNMEKVVEGY-----LRRINI-SLA---S-------K-----TATIINLVLDDVSTAR
I8Y597          TKSNMEKVVEGY-----LRRINI-SLA---S-------K-----TATIINLVLDDVSTAR
A0A1Q6GBF5      TKSNMESVVENY-----RNRLKV-SLA---S-------K-----TATIINLVLDDVSTAR
I8YFZ3          VKFNMESVVESY-----RNKLKV-SLA---S-------K-----TATIINLVLDDVSIAR
A0A4V1YNX8      VKSNLESVIEGY-----RTRLKV-SLA---S-------K-----TATIINLVLDDVSTAR
A0A1Q6GDH2      VKSNLESVIEGY-----RGRLKV-SLA---S-------K-----TATIINLVLDDVSTAR
U6RSB0          IKSNLESVIEGY-----RARLKV-SLA---S-------K-----TATIINLVLDDVSTAR
I9GXM2          VKSNLESVIEGY-----RGRLKV-SLA---G-------K-----TTTIINLVLDDVSTAR
I9SIK1          VKSNLEGVIEGY-----RGRLKV-SLA---G-------K-----TTTIINLVLDDVSTAR
A0A4Q5FNG1      VKSNLEGVIEGY-----RGRLKV-SLA---G-------K-----TTTIINLVLEDVSTAR
I9TP59          VKSNLEGVIEGY-----RGKLKV-SLA---G-------K-----TTTIINLVLEDVSTAR
R5S343          EKNIVSDVVDAY-----RERMRI-ELA---D-------K-----STTIIYLTLQDVSVAR
A0A1M6K7I9      QKFVTERVVDDC-----MATLSV-SLA---S-------K-----MATIIDLEYKDESIAR
A0A5M6A8C8      QKSVTERVVDDC-----MTTLSV-SLA---S-------K-----MATIIDLEYKDESIAR
A0A4V1YPN7      TKSNMEKVVEKY-----LNEINI-SLA---S-------K-----TATIINLVLKDVSTAR
A0A4Q5F874      VKSNMEKVVEGY-----QNRIKI-SLA---S-------K-----TATIINLVLDDVSTAR
A0A641LV22      VKSNMEKVVEGY-----QNRIKI-SLA---S-------K-----TATIINLVLDDVSTAR
A0A3R5ZMK1      TKSPLQDVALRF-----QGGLQA-TLA---S-------K-----TATIINLTLQDVSIPR
A0A3E4ZTK7      TKSPLQNVAIGF-----QANLQA-TLA---S-------K-----TATIINLTLQDVSIPR
A0A1Y3ZIA4      TKSPLQNVALRF-----QSGLQA-TLA---S-------K-----TATIINLTLQDVSIPR
K5Y1A4          TKSPLQNVALRF-----QSGLQA-TLA---S-------K-----TATIINLTLQDVSIPR
A0A4Q5CIT0      TKSPLQDVALRF-----QGGLQA-TLA---S-------K-----TATIINLTLQDVSIPR
A0A3R6K8X4      TKSPLQDVALRF-----QGGLQA-TLA---N-------K-----ASTIINLTLQDVSIPR
A0A414GI87      TKSPLQDVALRF-----QGGLQA-TLA---N-------K-----ASTIINLTLQDVSIPR
A0A415BDM7      TKSPLQDVALRF-----QGGLQA-TLA---N-------K-----ASTIINLTLQDVSIPR
A0A412DM15      TKSPLQDVALRF-----QGGLQA-TLA---N-------K-----ASTIINLTLQDVSIPR
A7AEU7          TKSPLQDVALRF-----QGGLQA-TLA---N-------K-----ASTIINLTLQDVSIPR
A0A1Q6I3T6      TKSPLQDVALRF-----QGGLQA-TLA---N-------K-----ASTIINLTLQDVSIPR
A0A414XX40      TKSPLQDVALRF-----QGGLQA-TLA---N-------K-----ASTIINLTLQDVSIPR
A0A3R6BKI7      TKSPLQDVALRF-----QGGLQA-TLA---N-------K-----ASTIINLTLQDVSIPR
A0A414LPI6      TKSPLQDVALRF-----QGGLQA-TLA---N-------K-----ASTIINLTLQDVSIPR
A0A412M2W1      TKSPLQDVALRF-----QGGLQA-TLA---S-------K-----TATIINLTLQDVSIPR
K5ZX55          TKSPLQDVALRF-----QGGLQA-TLA---S-------K-----TATIINLTLQDVSIPR
A0A5F0U645      SKSNQDRVALDY-----NESLQV-VLA---S-------K-----TATILNLSLQDVSASR
K5ZBN2          SKSNQDRVALDY-----NESLQV-VLA---S-------K-----TATILNLSLQDVSASR
A0A0J6CKW3      SKSNQDRVALDY-----NESLQV-VLA---S-------K-----TATILNLSLQDVSASR
A0A0F5IQM7      SKSNQDRVALDY-----NESLQV-VLA---S-------K-----TATILNLSLQDVSASR
A0A496CDT3      SKSNQDRVALDY-----NESLQV-VLA---S-------K-----TATILNLSLQDVSASR
S0GLB0          SKSNQDRVALDY-----NESLQV-VLA---S-------K-----TATILNLSLQDVSASR
A0A3R6NLC1      TKSSRDWVALNY-----NEALQV-ALA---S-------K-----TATILNLSLQDASVSR
A0A416WYC9      TKSSRDRVALNY-----NEALQV-ALA---S-------K-----TATILNLSLQDASVSR
A0A0F5IT40      SKRNREEIALTY-----SNSLQV-ALA---S-------K-----TATIINLTLQDVSIPR
A0A496CX20      SKRNREEIALTY-----SNSLQV-ALA---S-------K-----TATIINLTLQDVSIPR
A0A5F0UBI0      SKRNREEIALTY-----SNSLQV-ALA---S-------K-----TATIINLTLQDVSIPR
S0GSI7          SKRNREEIALTY-----SNSLQV-ALA---S-------K-----TATIINLTLQDVSIPR
K5YB65          SKRNREEIALTY-----SNSLQV-ALA---S-------K-----TATIINLTLQDVSIPR
A0A0F5IWP9      VKKNRVDVALGY-----SNTLQV-ALA---S-------K-----TATIINLTLQDVSIPR
A0A0F5IZT8      VKKNRVDVALGY-----SNTLQV-ALA---S-------K-----TAAIINLTLQDVSIPR
A0A417LKQ2      GKKNREDVTLSY-----SNALQV-ALA---S-------K-----TATIINLTLQDVSIPR
A0A416TME1      GKKNREDVALNY-----SNALQV-VLA---S-------K-----TATIINLTLQDVSIPR
A0A416XPE8      GKKNREDVALNY-----SNALQV-VLA---S-------K-----TATIINLTLQDVSIPR
A0A5C8KAD6      TLQDPRKVTDQL-----VAKLTI-VPS---G-------K-----LSTVVDIRLRDEVPER
A0A5N1J695      SLIPTRQVTDGL-----LANLKI-EPA---N-------K-----LSTVINITLEDPVPQR
A0A1H4ADG3      DVSSINAVADGF-----KENINA-EIS---D-------K-----QTSIINLSLNTTIPEQ
A0A5B8VUR8      AVASINAVADSY-----KENINA-DIS---D-------K-----QTGIINLSLNTTIPQQ
A0A2A4G4B1      YCTPISKTVNQI-----INNLQI-NPL---S-------D-----KTHGLTLTMEVEQAER
A0A3N2M1H3      VKKPMQTTVENY-----GEKLNG-DLV---N-------Q-----DAEIIGLTIRDVSVQR
A0A4S2G8T2      VKKPMQTTVENY-----GEKLNG-DLV---N-------Q-----DAEIIGLTIRDVSVQR
A0A212K7W5      VKSNLRSIVNHY-----TNALNV-GLS---N-------E-----DATIIDISLNDVSAQR
F5IU11          TKFNLRGIVNNY-----TNALNV-GLS---N-------E-----NATIINISLNDVSAQR
A0A3N2N6F7      SYWPMPTAISKY-----QAKLTE-TLS---N-------E-----DASVIDFAIKDDNVQR
A0A4P7VVU7      FRYSISDAIEAY-----KARLSE-NLA---D-------D-----NSTVIDFTIKDVSIQR
A0A2V1ILM4      FRYSISDAIEAY-----KARLSE-NLA---D-------D-----NSTVIDFTFKDVSIQR
A0A3N2L0E8      FRYSISDAIEAY-----KARLSE-NLA---D-------D-----NSTVIDFTIKDVSIQR
A0A3N2LFC5      FRYSISDAIEAY-----KARLSE-NLA---D-------D-----NSTVIDFTIKDVSIQR
A0A553LCN8      KRMSPEAATAIY-----KGGIST-SLA---G-------K-----GTTMVQITCVGNNVSR
K0XJ09          SRIDLNTAANIY-----HSFIST-SLA---G-------E-----RTTLVQINCVDSNISR
R5EUZ0          SRIDLNTAANIY-----HSFIST-SLA---G-------E-----RTTLVQINCVDSNISR
W0EQS0          SRISLDAASGMY-----HA--SA-SLA---G-------E-----RTTLVQINCVDSNISR
A0A1Y3WE15      SRMDLNTAANIY-----HSLISA-ALA---G-------E-----RTTLVQINCIDSNTSR
A0A1Y4GUK3      SRMDLNTAADIY-----HSLISA-ALA---G-------E-----RTTLVQINCVDSNISR
A0A352Z1R7      KLLPLQNIAVSL-----KGGFKA-TEV---G-------N-----RTNIVRISYSSTDPVQ
A0A0A2F501      SYQNLYNVQELY-----SSGLKA-SIN---N-------D-----KASIIDIAYQDRSIQR
R5B7P0          RKSGQRGVTQSY-----LNRLQV-NLA---D-------K-----NADVISLSIKDVSTQR
R5B0L5          TKMPLQTAASIF-----SGRLTV-ALK---E-------K-----LGNTINLSVMDYSPER
A0A374THP7      SRSNIYAMTDRI-----KGSLAA-SLS---E-------E-----KSTVIDLTYKDVLPKR
A0A3R5XWG1      SHTDLYSMTNRI-----LGSLTV-GLN---E-------E-----KTTIVNLTYTDVQTKR
A0A5P0Y910      SHTDLYSMTNRI-----LGSLTV-GLN---E-------E-----KTTIVNLTYTDVQTKR
A0A5P0XQC0      SHTDLYSMTNRI-----LGSLTV-GLN---E-------E-----KTTIVNLTYTDVQTKR
A0A414YFM3      SHTDLYSMTNRI-----LGSLTV-GLN---E-------E-----KTTIVNLTYTDVQTKR
A0A5P0VXP6      SHTDLYSMTNRI-----LGSLTV-GLN---E-------E-----KTTIVNLTYTDVQTKR
A0A5P0W892      SHTDLYSMTNRI-----LGSLTV-GLN---E-------E-----KTTIVNLTYTDVQTKR
A0A0A2EVS5      SRSNLSTTMAEC-----QKRLQV-GLI---N-------D-----KTSILELSYTDVSIER
A0A1T4NAJ7      SRSNLSTTMAEC-----QKRLQV-GLI---N-------D-----KTSILELSYTDVSIER
A0A255T941      SKQNIDDLADAL-----STKLVA-ELD---N-------K-----EGTVITLTTEATSPKK
A0A3N2KCL3      VKAPVSATAGGY-----GSRMVI-AMS---G-------D-----KSSVINLTVTDQSTQR
A0A4P7VSV0      VKAPVSATAGGY-----GSRMVI-AMS---G-------D-----KSSVINLTVTDQSTQR
A0A2V1IJY1      VKAPVSATAGGY-----ESRMVI-AMS---G-------D-----KSSVINLTVTDQSTQR
A0A4P7VXK7      VKAPVSATAGGY-----ESRMVI-AMS---G-------D-----KSSVINLTVTDQSTQR
A0A1Y4CHN5      SRSTIYGAVQSY-----SQRLSV-GLA---N-------E-----DATIINLSITDVCIQR
A0A1M6I2S6      NKGSVRAVTDYY-----ATALRA-DLG---N-------E-----DATIINLSIDDVSIPK
A0A1Y3V692      NKGSVRAVTDYY-----ATALRA-DLG---N-------E-----DATIINLSIDDVSIPK
F3PXM2          GKQSVQAVTDYY-----TGALRA-ELG---N-------E-----DATIINLSIDDSSVWK
A0A3E4ZNL4      SKNSADKVADNY-----AQALRA-ELG---N-------E-----DATIINLSIDDASVQK
A0A174AHH7      SKEPADAVADSY-----TQKLRA-DLG---N-------E-----NATIINLSIDDASVQK
A0A174JCE8      SKEPADAVADSY-----TQKLRA-DLG---N-------E-----NATIINLSIDDASVQK
A0A3E4JMC4      SKEPADAVADSY-----TQKLRA-DLG---N-------E-----NATIINLSIDDASVQK
A0A412SND6      SKEPADAVADSY-----TQKLRA-DLG---N-------E-----NATIINLSIDDASVQK
A0A414IEQ9      SKEPADAVADSY-----TQKLRA-DLG---N-------E-----NATIINLSIDDASVQK
A0A415UKN5      SKEPADAVADSY-----TQKLRA-DLG---N-------E-----NATIINLSIDDASVQK
A0A0M1W8D8      SKEPADAVADSY-----TQKLRA-DLG---N-------E-----NATIINLSIDDASVQK
A0A3R6GKX5      SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
A7V4S1          SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
B0NU19          SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
D4V601          SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
A0A4Q0U3M9      SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
A0A4R4H1Q2      SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
A0A397WLT5      SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
A0A3R6GM96      SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
A0A015XH67      SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
A0A078RZN2      SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
A0A4R4I3T9      SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
A6L0K5          SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
A7ACT5          SKEPADMVADSY-----TQKLWA-ELG---N-------E-----DATIINLSIDDASVQK
A6KY94          SKESADMMADSY-----TQKLRA-ELG---N-------E-----DATIINLSIDDASVQK
A0A173UQR8      SKESADMMADSY-----TQKLRA-ELG---N-------E-----DATIINLSIDDASVQK
A0A3R6HK75      SKESADMMADSY-----TQKLRA-ELG---N-------E-----DATIINLSIDDASVQK
A0A412B7D1      SKESADMMADSY-----TQKLRA-ELG---N-------E-----DATIINLSIDDASVQK
A0A412VNY9      SKESADMMADSY-----TQKLRA-ELG---N-------E-----DATIINLSIDDASVQK
A0A414LTU9      SKESADMMADSY-----TQKLRA-ELG---N-------E-----DATIINLSIDDASVQK
I9Q4U4          SKESADMMADSY-----TQKLRA-ELG---N-------E-----DATIINLSIDDASVQK
A0A373ISF0      AIGKADGAADRY-----LNALRV-ELG---S-------K-----EATIINLSINDTSIAR
U6RF62          AIGKADGAADRY-----LNALRV-ELG---S-------K-----EATIINLSINDTSIAR
A0A662ZZD5      RKGNVCAVTDYY-----TAALHA-ELG---N-------E-----DATIINLSINDASIQK
A0A395YYT3      RKGNVCAVTDYY-----TAALHA-ELG---N-------E-----DATIINLSINDASIQK
A0A642JYJ3      RKGNVCAVTDYY-----TAALHA-ELG---N-------E-----DATIINLSINDASIQK
A0A015UXN7      RKGNVCAVTDYY-----TAALHA-ELG---N-------E-----DATIINLSINDASIQK
A0A5M5W148      RKGNVCAVTDYY-----TAALHA-ELG---N-------E-----DATIINLSINDASIQK
A0A3A5TI83      RKGNVCAVTDYY-----TAALHA-ELG---N-------E-----DATIINLSINDASIQK
A0A415NEB6      RKGNVCAVTDYY-----TAALHA-ELG---N-------E-----DATIINLSINDASIQK
A7AJ60          RKGNVCAVTDYY-----TAALHA-ELG---N-------E-----DATIINLSINDASIQK
A0A016E4F9      NKGSVNAVTDYY-----TQNLRA-ELG---N-------E-----DATIINLSIDDASIPK
A0A4Q5CFJ7      NKGSVRAVTDYY-----ATGLRA-DLG---N-------E-----DATIINLSIDDASIQK
A0A108TH71      VRGSVRAAVDTY-----SNALVA-ELG---N-------E-----DATIINLSINDTSIRK
I8VXH0          VRGSVRAAVDTY-----SNALVA-ELG---N-------E-----DATIINLSINDTSIRK
A0A412S0N6      VRGSVRAAVDTY-----SNALVA-ELG---N-------E-----DATIINLSINDTSIRK
A0A412IIJ0      VRGSMRAAVDTY-----SNALVA-ELG---N-------E-----DATIINLSINDTSIRK
A0A0P0FM97      VRGSVRAAVDTY-----SNALVA-ELG---N-------E-----DATIINLSINDTSIRK
R6KTP3          VRGSVRAAVDTY-----SNALVA-ELG---N-------E-----DATIINLSINDTSIRK
A0A139LU87      VRGSVRAAVDTY-----SNALVA-ELG---N-------E-----DATIINLSINDTSIRK
A0A1C6B3Y5      VRGSVRAAVDTY-----SNALVA-ELG---N-------E-----DATIINLSINDTSIRK
E2NMQ4          VRGSVRAAVDTY-----SNALVA-ELG---N-------E-----DATIINLSINDTSIRK
A0A412YDB9      VRGSVSAAADTY-----ANTLVA-ELG---S-------D-----DATIINLSISDASIRK
R7DY01          VRGSVSAAADTY-----ANTLVA-ELG---S-------D-----DATIINLSISDASIRK
A0A414LGK8      VRGSVSATADTY-----ANALVA-ELG---S-------D-----DATIINLSISDASIRK
A0A415IPQ4      SRGSVRAAADTY-----ANALVA-ELG---N-------E-----DATIINLSINDASIQK
A0A3E5BRW7      ARRSVRDVADAY-----TRELVA-ELG---N-------E-----DATIINLSISDASIRK
K9DXS6          ARRSVRDVADAY-----TRELVA-ELG---N-------E-----DATIINLSISDASIRK
A0A1M6KFV3      VRRNVRSVSDAY-----AKELVA-ELG---N-------E-----DATIINLSINDASTRK
A0A1Q6G7L3      VRRSVRSVSDAY-----AKELVA-ELG---N-------E-----DATIINLSINDASTRK
A0A413H235      VRRSVRSVSDAY-----AKELVA-ELG---N-------E-----DATIINLSINDASTRK
A0A1M5B2J8      IRSTIKGAVGDA-----SSRLSV-VQN---D-------E-----KSNIISLSFQDVSIQR
A0A255RCT5      LRSTLKEAVAGA-----SSRLTV-SQD---D-------E-----KSNIISLSFQDVSIQR
A0A1Y4GLF5      DRSTLYSAVNAY-----SANLSV-SLN---N-------E-----KASVIDLSFKDLSTQR
A0A1H3XSC0      FRSSLHGTVGQY-----SSNLSV-ALS---S-------E-----KTSIVNLTFRDHSIQR
A6LE40          SKSSLYNAVNSY-----SSNLSI-SLN---N-------E-----KASVIDLSLKDNSTQR
A0A4Y1VPX5      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
B3JI46          GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
R6NN15          SRSGLNSAVSRY-----SAGLSV-ALQ---S-------E-----KTTIVDLTFKDVCIQR
A0A358R8U0      SRTGLYGAVGSY-----SGNLTV-TLS---D-------K-----KASAIDLTFRDVSTQR
R6WSB6          SRTGLYGAVGSY-----SGNLTV-TLS---D-------K-----KASAIDLTFRDVSTQR
A0A4Q5ENK6      SRQSLAATSANC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
A0A401LPX7      TRQSLSAASAGC-----SANLTI-SQN---D-------E-----KSNIITLSFQDVSTQR
A0A3A5Z900      TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVCTQR
A0A3R6EGW5      TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
A0A285TGL6      TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
A0A3A5RFX4      TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
A0A1Q6IUW9      TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
A0A3R6NPG7      TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
A0A413XDP6      TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
K6AP24          TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
A0A662ZYI7      TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
A0A078RYI7      TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
C7XEQ8          TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
D7INX6          TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
K5ZG55          TRQSLSAASAGC-----SARLNI-SQN---D-------E-----KSNIITLSFQDVSTQR
A0A3N2N9B8      NRLPLDAARASY-----SSRLSV-TQG---S-------D-----NSSLIRLTLSDRSIER
A0A3N2NMI0      NKIPVKTAQAIY-----SSHLGV-SQS---G-------E-----NSSVIRLTLSDRSIQR
A0A359I8H7      ERDGMQSTVETY-----GGLVKA-DLA---D-------K-----DADVIDLSMKDVSTQR
A0A3N2KA63      ERDGMQSTVETY-----SGLVKA-DLA---D-------K-----DADVIDLSMKDVSTQR
A0A4Q0IMT7      ERDGMQSTVETY-----SGLVKA-DLA---D-------K-----DADVIDLSMKDVSTQR
A0A3B9FAU3      TRTDLYTKTEGV-----QRNLSV-ELT---D-------K-----MSTLVRISYKDKEPYR
A0A3C1E5L7      TRTDLYTKTEGV-----QRNLSM-ELA---D-------K-----MSTLVRISYKDKEPYR
A0A4Q0UAV1      TPEAL---AASF-----SGNITF-ELK---E-------F-----STSIINLIMTDESPQR
A0A354SN68      RKCNITSATERV-----QRMYLA-TGR---E-------D-----GSSVVNITCNGEHIGM
A0A3N2N595      DKKPLGWAVATY-----LGNLMV-SLN---N-------K-----EGTVIDLTLNDRSTQR
A0A0A2DUD9      KRSSLYDAVENL-----GKNLTV-NLA---D-------E-----KSTILSLSLLDRSQER
A0A3P1ZBJ5      VKYPLSDVVD-Y-----FGRINV-ELK---E-------K-----ESTMVDISINDVSVER
R5FHS9          THVPMMSAMSSY-----QKGLSV-SLA---D-------N-----KAAVINLEMQDVNIQR
A0A413TW79      TRTNLYAMTDHI-----KASLSA-SIS---E-------E-----KATVIDLTYKDQLTQR
A0A3E5E9M7      TRTNLYAMTDHI-----KASLSA-SIS---E-------E-----KATVIDLTYKDQLTQR
A0A3E4SK73      TRTNLYAMTDHI-----KASLSA-SIS---E-------E-----KATVIDLTYKDQLTQR
A0A415GGC6      TRTNLYAMTDHI-----KASLSA-SIS---E-------E-----KATVIDLTYKDQLTQR
A0A413DBH9      TRTNLYAMTNHI-----KASLSA-SIS---E-------E-----KATVIDLTYKDQLTQR
A0A495WI87      SCSSLYSAVRRY-----APNLSV-VLN---D-------E-----KSTVVDLSFKDVSIQR
A0A354M4S6      SRSGLYSAVRRY-----APNLSV-VLN---D-------E-----KSTVVDLSFKDVSIQR
R7DH52          SRSGLYSAVRRY-----APNLSV-VLN---D-------E-----KSTVVDLSFKDVSIQR
A0A4Q5E7L5      GKSSLYSAVNNC-----SSNLSV-SLN---N-------E-----KASVIDLSYKDNSIQR
A0A4P8LP09      DKSGLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVVDLSFRDNSIQR
A0A4R4GZU7      DKSGLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVVDLSFRDNSIQR
A0A016CWA4      DKSGLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVVDLSFRDNSIQR
A0A1C6H117      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A415TAH7      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A0M1W0V2      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A139KA16      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A174VQ92      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A1Q6HCG0      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A1Y4JYM9      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A3A5QW67      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A3A5RQE6      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A3A6BP07      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A3E5E153      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A3Q9IP20      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A412WV15      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A413ICP6      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A414KYB9      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A5B3FWR2      GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
E5WX00          GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
K0X3P3          GKSSLYDAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFRDNSVQR
A0A3A5Z014      DKSSLYNAVNSC-----SSNLSV-SLN---N-------E-----KSSVIDLAFKDNSIQR
A0A1M4YZ07      GKSNLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
A0A078S3Q8      GKSNLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLAFKDNSTQR
A0A069SJV7      GKSNLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLAFKDNSTQR
A0A3E5DXI5      GKSNLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLAFKDNSTQR
A0A3E5EM98      GKSNLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLAFKDNSTQR
A0A3E5F453      GKSNLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLAFKDNSTQR
I9T3G6          GKSNLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLAFKDNSTQR
A0A4Q5E5M7      GKSSLYNAVNSY-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
A0A0P0FQW1      GKSSLYNAVNSY-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
A0A5M5C0W6      GKSSLYNAVNSY-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
A0A642LZ22      GKSSLYNAVNSY-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
A0A5M5YM86      GKSSLYNAVNSY-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
A0A642LE65      GKSSLYNAVNSY-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
A0A5M5Y0P8      GKSSLYNAVNSY-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
A0A642NJ89      GKSSLYNAVNSY-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
C3RFN5          GKSNLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
A0A3E4SYU0      GKSNLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLAFKDNSTQR
A6LGY1          GKSNLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
K5ZSH4          GKSNLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
A0A078T2W6      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A3R6EAF7      GKSNLYNAVNSC-----SSNLSV-SLN---N-------E-----KASVIDLSFKDNSTQR
A0A5C6L2P1      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A412MJT7      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A3E4WKT5      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVINLSFKDNSTQR
A0A3A5YY33      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A078TAH2      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A1E9CFZ7      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A373FYU5      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A3A5TZ72      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A3A5XBP2      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A3A6MEG9      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A3E4JP35      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A3E4KP40      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A3E4NX82      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A3E4XFU8      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A412RG70      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A412TD37      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A413GAA4      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A414M7I4      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A496BTA0      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A496D2V6      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A4Q5EN83      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A4Q5G1P5      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A5C6KCA6      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A5M5AHM5      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A641WNS6      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
E5UZA2          GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A069SMG6      GKSSLYNAVNSC-----SSNLSV-SLN---S-------E-----KASVIDLSFKDNSTQR
A0A1Y4PQK7      VRSGLYGAVRTC-----SSRLSV-ALN---D-------E-----ESTVLSLSYRDVSPAR
A0A1Y4IH41      VRSGLYGAVGTC-----SSRLSV-ALN---D-------E-----ESTVLSLSYRDVSPAR
A0A3A6AAP4      VRSGLYGAVGTC-----SSRLSV-ALN---D-------E-----ESTVLSLSYRDVSPAR
A0A1Y4DYA7      SHSGLQATTSVY-----SGKLTV-ALK---D-------E-----KSTVINLSIEDVCIQR
A0A1Y3X4I9      SRSGLQSTAAAY-----SDKLNV-ALN---D-------E-----KSTVINLSLEDVCIQR
A0A1Y4FNK8      TRISYQAATSAY-----ASNLSV-ALN---D-------E-----KSTVVNLTFTDVCTQR
A0A355FD59      SRTNLYSATNAC-----KEALTI-SLS---D-------E-----KVTVIDLSYNDVSTQR
A0A359CEZ9      SRTNLYSATNAC-----KEALTI-SLS---D-------E-----KVTVIDLSYNDVSTQR
A0A353Q7B4      SRTNLYSATNAC-----KEALTI-SLS---D-------E-----KVTVIDLSYNDVSTQR
F8X3A5          SRTNLYSATDLF-----KQNLTA-SLS---E-------E-----KATVIDLSYKDVSTQR
A0A1M3KVR9      SRTNLYSATDLF-----KQNLTA-SLS---E-------E-----KATVIDLSYKDVSTQR
A0A4Y9IJS3      SRTNLYSATDLF-----KQNLTA-SLS---E-------E-----KATVIDLSYKDVSTQR
A0A4Q5WS95      RLIDPKSVAAGL-----QKKLDV-APA---G-------K-----LSSIVRLKYNDEVPQR
A0A501VZX6      SLIRPKKIVESL-----EKNIKI-EAE---N-------K-----LSTVVNFTLYDQIPAR
A0A399SH26      QLLPLKAVTASL-----LNNLQV-NAA---N-------K-----LSTVVNLQLKDAVPER
A0A501W1A9      SIKDPRKAARQL-----ASSIQI-ETP---G-------K-----LSSVVNLYIEDQTPER
A0A0E3ZGV6      SIISPTRAANQL-----SGSIFI-ESA---G-------K-----LSSVVNLYLEDKVPER
A0A1I2N4S1      SINNPKAVAKQL-----ISRIYV-ESP---G-------K-----ASSVVNLYIEDNVPER
A0A2T5YE44      SINNPKAVAKQL-----ISRIYV-ESP---G-------K-----ASSVVNLYIEDNVPER
A0A1V9FHD0      DLYKTKNLAPTI-----SLNLVV-TSE---N-------K-----LSSTMDLTYSDAVPQR
A0A4V4H170      RLYKPKNIAPGF-----ISNLGV-KSA---S-------K-----LSTTINLTFRDEVPER
A0A1V9F098      RLSKPKNVAPGY-----IASLEV-KSS---S-------K-----LSSTINLTFRDEVRDR
A0A4R2VU64      QLIKPKNVAPGI-----IASLDA-KPA---S-------K-----LSSTINLTFRDEVPQR
A0A4S8HY23      RLYKPKNRAPAI-----ISNLQV-KSS---S-------K-----LSTTINLTLRDEVPER
A0A1V9F383      ELNKPKDVAPGI-----LLNLQV-NSP---N-------K-----LSTTIDLTLRDPIPRR
G8TRZ6          NLNKTKDVVPGL-----LLNLLV-VSP---N-------K-----LSSTIDLTLRDEIPKR
A0A543WA52      ILVNPKKITDGI-----LSDLEV-SST---N-------K-----LSTVVSISYNDPVPKR
A0A1M5BA90      SLNNPKMVLNSL-----VTNLRV-IAA---S-------K-----LSTVIDLAIMDEVPER
A0A512B879      SLVPPKQALNSL-----ILNLNV-SPI---N-------K-----LSSVIHLTIKDEVTQR
A0A559PPI3      ILINPRSVTQSL-----LKSLEV-APP---E-------K-----LSTVINLYLQDAVPNR
A0A1T5CS78      YLLNPKIISTSL-----LDELDI-STS---N-------K-----LSSVVNLSIKDEVPER
A0A0Q9Z8F1      YLLNPKMISSEL-----IDELDI-STS---N-------K-----LSSVVNLTIRDAVPER
A0A2N0U0M7      YLLNPKMISSEL-----IDELDI-STS---N-------K-----LSSVVNLTIRDAVPER
                                                                  .         

A0A1T5MMH4      AHAIVDAINKTYLHYSYEQKKLTTKQKIDWLNNELQQIELKMEGFEDYFERFTL-KNKTN
A0A2W4R1L8      AQTVVNKIDSLYLIFSNEQKTLANRQKITWLTNELKQIEEKMSQYENYFEDFIL-ANKTS
A0A2E5CV79      ARRISDGIAQVYKNLEKTIGNEDATLRVEFMDDLVNQQEGKLLLAEDSLKQFKI-ENSFF
A0A2D4ZVH1      ASSIINMTMDTYSALSTEQNRTMAVSALEFLRTERTKLESELVSTEDSLQNFMN-RTLLI
A0A0K8QSK7      GNDFLNKLVEVYQRDNLNQKNEVANRTINFIHSQLGEISDSLSISETEMLQFQS-DNRVI
A0A1V6CN82      AVDFLNKLVEVYRIDNVEKKNQYADQTINFIEYLLEGVSDSLAVAEGELLSFQS-RNRIF
A0A1M4XZ45      GVAFLNKLTEVYQLDNLEKKNENANRTIHFISSQLQSISDSLSVSENRMETFQS-ENQVL
A0A399D319      GVDFLNKLTEVYQLDNLEKKNENANRTIQFISSQLQSISDSLSISESRMETFQS-EHQVL
A0A1M6GR99      GEDIINELIQVYSESNLEKKNHLANMTLEYIDEQLDEVSASLNLTENNLQKFMS-QNKLM
A0A1M6TTV4      AKSLLQAIDTIYLNFTKAAKNLAVEQKISFLDRQMKKTQVELEQYEDYFEKFTI-QNRTT
A0A4Q8RX32      GIDFLEQYVVTIIEDNLDRKNYIAHTTIDFIDNQLSQVFDSLNLAEKSLQEFRT-QKQVI
K0X1U5          GKDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVEEELHEAERIVERYKR-ENDLS
R5EXK3          GKDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVKEELHEAERIVERYKR-ENDLS
A0A401UAP7      AMDIVNKIVNIYLGFSNEQKNFANKHKIDWVNNELEQIEEKMSQYEDYFKDFTL-KNKTQ
A0A1W2GF52      ARNLLQAIDTIYLAFTKNAKNQAVEQKIRFLETQMAKTSKELVEYEDYFEKFTI-KNRTT
A0A2G5L7B8      ARSLVQAIDTIYLNYTKAAKNQAVEQKISFLETQMYKSQIELEQFEDYFEKFTI-KNRTT
A0A523GAC0      ARDLVSAIDTIYLTYTKEEKNKANQQKIDFLDDQLLLTQSKLQDYESYFESFTI-RNKTT
L8JW09          ARDLVNAIDTLYLKYSEEEKNLENKQKIEWLNSELRQIETQLEGYEHYFENFTI-KNRTS
A0A5C7MX19      TRDITNMMVRVFVEYDMEKKREGFENVISFLNVQIGQFEEGNTAFEDSISALRV-QFGYM
A0A364XUP5      ARAILQVIDDVYLKYSHEQKNLANKQKIDWLNNELQQIEEKMEGYENYFKHFTL-QNKTN
A0A1M5RLA9      ATAILNKIDSIYLHYSYEQKNLANKQKIDWVSNELVNIEHKMEDFENYFENFTL-QNKTN
A0A385SFR9      ATAILNKIDSIYLHYSYEQKNLANKQKIDWVSNELVNIEHKMEDFENYFENFTL-QNKTN
A0A5M4A9J4      SISFLNKLMEVYQQQNLDKKNEMATRTIQFISSQLGSVSDSLTASERHREQFQS-RNNLL
A0A5M4B1C7      DIDFINQLMEVYQDQNLEKKNAMATRTIQFISSQLSSVSDSLVKSEQRRESFQS-KNKLL
A0A0D3LFR6      ARVVVDAVSNMYLTYKEEEQIKANNQKIAFLNTLVEDAESKLEGYETYFEDFTI-SQRTT
M7N6D4          AKVLVDVLSNMYLGYTEEEKIKSNSKRIAFLDEQVEETEAKLEDFESYFENFTI-DYKTT
A0A1Q3ZMZ7      SRDVVNVIIDEFFAFDEMLKKQSSENVLNFLNNQLDSLAIELNKSRDSIVFFQQ-KNKLN
A0A2D8JJW3      AANIVSCLIDSYVEEEKKHANQKTSDQIIFLKNQILSNSDSLLKMKDEIQKFQQ-AEDIL
A0A2W2AFF7      GEDALNKLINVYLQANVDDKNKIADSTMRFIDDRVALVGEELTGIEKKIEAFKK-ENELT
A0A2N5YXE2      SAEITNTIAEKFIEFDENKKKESANNIITYIDQQMENVFLQLTNTEQNLHDFKQ-QNNIR
A0A2W1NDY9      AQDMVREVVETFFTYDLEKKSKSSESILSFIDEQLDTVYNSLKFSENSIQSFTN-ISKNN
A0A5C8AQR5      CNDIVSAITSAFFEYDESLKKQSSDNILQFIESQLDSLALELKLSKDSLTDYQR-SSNLP
A0A1G0CI31      CHDITNAVAEAFFTYDEEVKRKSAENILQFINKQLDSISGELQISKDSLTLFQR-SAQLN
A0A556N0M0      CKDIIQSVATTFFNYDEEMKRKSADNILSFIQLQLDSISGELKDSKDSLTDFQR-KTRLT
F2IKD6          CRDIIKSVSLTFFNYDEEMKRKGADNILAFIQIQLDSISGELKDSKDSLTDFQR-KSHLT
A0A1I7BM74      SQDICNAVGESFFDYDDHLQQESSEKILKFINAQLDSLNKELILSRNALTEFQR-RENLS
A0A2G2FJ17      AQDITKAIGDAFFEYDERYTKESAENILSFISLQLDSLRKELSASKDSIMYFQR-KENLP
A0A077ENE7      AADILTSLITVYNDVYLQDKSKIAENTADFIKDRLAIIEGELGAVESNVENLKI-ANQGI
T0NN57          AADIITMLITVYNEVSLEDKNKIAVNTASFIKERLAIIESELGAVESDIENLKI-ANKGV
X5K347          AADIITMLITVYNEVSLEDKNKIAVNTASFIKERLAIIESELGAVESDIENLKI-ANKGV
A0A2I0QZ80      AKDIITALTKSFFKYDEGLKKESAENVLGFIASQLDSLTRELSISKDSVMRFQR-NENIT
A0A3E1F1A3      ATDMVKSLVSNFFNYDEDLNKESADNILDFINQQLDSLTQELSVSKDSIMYYQR-RENIT
A0A2U2XBJ3      AKEMIQSLTANFFKYDENIKKESADNVLEFIAVQLDSLTRELKMAKDSIMVYQR-MENIT
A0A4Q4KU94      AMEIVQSLTANFFKYDENIKKESADNILDFIAVQLDSLTQELKVAKDSIMAYQR-QENIT
A0A2U1FKU2      AKDFINTLISSYNDDVMNDKKSVAVSTATFIDERLAMIGGELGSVDTEIETFKK-QNNIT
A0A0A2F954      AKNFIDALIASYNDDVMNDKKSVAISTASFIDERLAMIGGELGSVDTEIETFKK-RNNIT
A0A0A2FW91      AKNFVNTLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGSVDTEIETFKK-SNNIT
A0A2D2N2N1      AKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-RNNIT
Q7MWZ2          AKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-RNNIT
T2NDT6          AKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-RNNIT
W1R7P9          AKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-RNNIT
A0A1R4AFZ0      AKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-RNNIT
A0A1R4DVZ7      AKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-RNNIT
A0A5M4B212      GIDFLNKMMQVYQTRNLDKKNVIATKTIFFITSQLASVSDSLSASQKVRERFQS-HNNLL
A0A1T5K9D4      ANDILTAIVYRYNEEAVKEKNKVAVNTAEFIDSRIKIIRKELSDVEDMMSGYRS-TKKLL
A0A3D1KEX9      AEAILTVLMDLYKRDIVESKNSVAANTAKFVDQRIDLIGSELNDVENKLAKFKQ-NNKIV
A0A358Y7S2      SYDITKTLIEQYLFFQEEMNIKNAKKTIDFIDYQLDSLSRVLEISKEDLANFQK-RERLP
A0A1X7J248      VQEIVETVSELYTEYSKEQKNKANQLKIQFLNKQLKQTESELANYETYIEDFTI-ENKTI
E4TQD2          VQAIVEQVSELYTKYSKEQKNKANQLKIEFLNKQLKQTENELSNYETYIEEFTI-KNKTV
A0A2J6HHN3      ATDIVNAITTEFELFEIEEQKQSSESILEFIDGQLGIVEENLTESEDSLYKVSV-ASPDS
A0A1Y3WMT8      GQDILDTLIECYNEDAVLNKNLKAQNMLSFIDDRLATVENELHEAERVIEQYKR-ENDLS
A0A1Y4GQU1      GQDILDTLIECYNEDAVLNKNLKAENMLAFIDDRLITVENELHEAERVIEQYKR-ENDLS
A0A1V5W8T5      TSDLVNTISEDFLTYNIEKKQERAEKVLAFIEEQMSVVYNKLDESEKQLDQFKK-SNNIT
A0A2T8HKA9      ATDLIKTLIEVYNEQTVEEKNRVAVSTADFIRERIAIIERDLGTVETDLERIKM-DNKGM
A0A3B8INU3      AQDMVGAITSIYQTYTKDQKKQANQQKIEFLDDQLMQTEERLDRYDKYFENFTI-SNQTT
A0A414ZBF2      AEDVLNTLIEAYKNDAIEDKNKVVINTANFIKDRLTIIEADLGVIDTEIEDYKR-ENKLT
A0A1Q3Q573      AKDIANALATEFIDYDLNKKREGMGNILRFIDGQIDSFSREQQAIQDSVAQFKI-NNEIF
A0A662BAY3      GIDFLNTLVAVYQAYTLERKNENASRTINFISTQLQTVSDSLGISENAMQAFQS-KHKLL
A0A4U3L369      GEFILNYFIQRYLRSSLEQRNQIADSTLSFINERLGIVTGELGNVEKQIALYKG-NNKII
A0A357YNR3      GRDFLVKYIQTYNEKGIADQIELADKTSRLIDDQLSKLSGELSDVENQVQIYKQ-SQGIT
A0A5E8AX52      ARDFVTAIDTLYLKYTTEEKNQAIEQKLSFLDEQLGITERKIEEYEDYFENFTI-ENRTT
F4KK08          AEDFLSTLILVYTELERSDKVKIAESTQRFVDDRLAIISSELGQVDAEIEDFKQ-SQQIA
A0A496LCF9      DVDFLTQHAKSFLGDNLDKKNYEADKTIQFINSQLSIISDSLTQSESNLNSFKI-ANNMY
A0A5P2G2A9      GEDVLDTLIKEYIKSNKDQKNAYADSTISFINDRLGLVSGELTNAESGLADYKK-KNNIA
A0A419VXB7      KISYLNELSRVYIQYGLQQKNQISDNTIHFINQQLKDIVDTLKSTSNEFTKYRS-SNKVF
C3J7R8          AEDFLNTLVQIYNENSRMEKVRVAQKTEHFIDGRLAIIGGELGSVDTEIEQFKQ-NNRIA
A0A0B0BTJ4      AAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKS-DNSAV
A0A3B9CNN6      AAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKS-DNSAV
R5X290          AAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKS-DNSAV
A0A1Q6E6I7      AAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKS-DNSAV
A0A1G8BVM8      AEDIINTLVTVYEKNAIDNKNQVLSKTVDFITDKTTILENELRSIDSDIEQYKK-EKNLT
A0A2G2F510      CKDITLAISNSYISFDEDMQRKGSENILGFIDSQLDSLSNELKSSKDSLMIFQR-KSNLP
A0A316JZ08      CRDLSLAIAEAYQEYDEEINRKSSENVLSFINNQLDSLYFELQSSQDSLADFHS-KSSVV
A0A1I1FXP9      AHDIMVTIDSVYLEQTLEQKNKVNEQTLAFLNSQLDTTAQKLAMSEKEVERFIQ-VNRVI
A0A3N4H5N3      GKDIMSSVINGYNFLNLNQKNEVALKTINFIDERLALAREELNQVERDAEQYKQ-RNRIT
A0A2P8EAX2      GKQILNSLIEGYNTSNQNQKNEVALKTIKFLDEKLFLAKKELDSLEMYVERFKQ-RNRVT
A0A4V2F6N9      GKQILNALIDGYNSSNQNQKNEVALKTIKFLDEKLLVAKKELDSLEMYVERFKQ-RNRVT
A0A3B9FXJ0      AKDVVNTIADAIVTNGLERKSVSANSIISFIQSQIDSLENELYIQENILKDFKK-DAQLI
R5GSU5          AEDFLNVLLDVYKEDIIDGKNRIAESTAIFIDSRIKIIGDELNDVEGSLARFKE-RNQIV
A0A2A3UE91      SSDIVNAITEEYLAFDVERKSESSRNIISFIDSQLGNVYDALKDTEGDLQKFKK-DKNIS
A0A0A2G557      AEDFLNTLISQHDATSRSEKLKIAHNTEAFINDRITIISKELGDVDQEIERFKQ-NNQIA
A0A2N2WFW8      AADLVNKVAEEFAAFEVEYQKESSNSILDFIDTQLGLVEDNLDQTEDSMRQGKN-MSFDS
A0A1F3IU95      AADVVNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQTKDSLQQSSA-PSVDS
A0A3D0VUF6      AADVVNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQTKDSLQQSSA-PSVDS
A0A1T4PT95      AEDFLNTLINEHDTTSRLEKLKIARSTEAFINDRITIISKELGDVDHEIERFKQ-NNQIA
A0A4P5TMD1      AVDIINTLQEEFIKYNKERKTESSSLIIDFIDTQIGLLNTELQAYENQLKAFKI-EHSLI
A0A651GU15      ARDFVMAHAHQYLQYDQESRELSASNIIRFIDNQIEEVYNELRETEFELSMFMK-DNKIS
A0A3Q9FR88      AVAVLKAINTAYSQLSRESKALVYERALTYLFKQIDTTKDSLALQEKKMRAISY-GKDLS
A0A553GEX3      AVAVLKAINTAYSQLSRESKALVYERALTYLFKQIDTTKDSLALQEKKMRAISY-GKDLS
A0A150ADJ9      AIAILQSINLAYSQLSREGKALVYERALDYLYNQADLTRDSLSLQEKKLREISY-NKDLS
A0A1B1FWQ4      AERVLEAINKAYSQLSREGKALVYERALEFLYSQIDITKDSLNNLETKMREMSF-NKDLS
A0A1S1Z228      AEAVLEAINKSYGQLSREGKALVYERALGFLYSQIDITKDSLNNLEKTMRELSF-NKDLS
A0A2A4PYG9      AADIVNSMASEFVEYDVEKKAQSATKILEFIDSQLLQVYDKLRSSENKMQGFKR-ENKLS
A0A1F3K695      TAEIANVIAEEFLTYDVEKKKESANQILSFIEEQESTFVKNIDETEKALHDFKK-ENNIN
A0A353KZR1      TAEIANVIAEEFLTYDVEKKKESANQILSFIEEQESTFVKNIDETEKALHDFKK-ENNIN
A0A2N2WYB5      AADIVNTIAEEYLKYDVESKKESAESILAFIEERLKLVYQNLDETEKQLHEFKK-ENKLN
A0A1F3K4G0      ASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFKR-ENKIN
A0A356H8Y3      ASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFKR-ENKIN
A0A351HSA6      ASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFKR-ENKIN
A0A1F3Q014      AADIVSKMTEEYSNFDIERKGESSLKVIEFIDHQIDIVYEQLKSSETSIQEFTK-NNNVT
A0A2A4YXP3      AVDIVTAVANEYIIYDIEERSRSSKNALQFIDEQLDRYYNKLRLSEDKIKDFHQ-GTNYT
A0A2D5KD44      AFDIVNGLIDEFKLYNVEKKKQSSKQILDFLNAQIESVYEKQKVYERQIQRFKR-ENGIT
A0A1F3R158      TADILTSLANEYIIYDIEERSKSSKNVIEFLDDQLDKYYNKVKLSENSIEEFQK-TNKLT
A0A2M8ADX2      TADIITALANEYIVYDIEERSKSSKKVIEFLDDQLDKYYNKVKLSENSIEEFQK-TNKLS
A0A1J5B2H0      TSDIVNTIAEEFVIYDIEKKAESTNKIIEFIDNQINRMYDTLAKSENQLERFKK-TNKID
A0A1V5N756      AADIVDTIISEFNLYDVEKQAMSTDKILKFIDEQLEIFNQKLFETKNDIQEFKK-ENKID
A0A1F3SJM1      CHDVTLAISKAFQEFDEESKRQGADNIIRFIDNQLDSLRKELKSSKDSLMFFQR-SANLP
A0A2G2EB96      CRDVVNAVSKSFIEYDEEQKRKSSDNIISFIDDQLDSLSSEVRIAKDSLIRYQR-KSQLS
A0A2G6PRA9      CRDVVQAVSESFIEYDEEQKRQSSENIISFIDAQLDSLSSEVRIAKDSLIEYQR-RSQLS
A1ZKR2          ARDIVHVIDTIYLHKTLENKKRANTQQKAYLNRRLGEIEDSMRTYEAKIQSFML-KFKTN
A0A1Q3GX01      ASNIVHVIDTIYLQKTLENKKRANIQQKEYLNRRLNEIEDSMRNYEGKIQAFKL-KLKTN
A0A349DQI4      AKHIVHVIDTTYLQKTLENKKRANIQQKKYLNRRLNEIEDSMRNYEAKIQGFKL-KLKTN
A0A2N3IIZ0      ARDVLKSISEVYRVKSVEIKNRANRQKKEYLDAQIEKTEKELNAYEAEMERFII-QNKTN
A0A497D5Z2      GVAFLNKLAEVYEQYNLGKKNENASRTIKFITSQLASISDSLSISEDLMQDFQS-KNKII
A0A662B170      GVAFLNKLAEVYEQYNLGKKNENASRTIKFITSQLASISDSLSISEDLMQDFQS-KNKII
A0A2A5FYT6      AKDISEAIAEGFINIDVERKSQSAEKVLNFIDTQIESVYGRLRTSETSMQSFQK-DNRIT
A0A2E6SYP1      CADIVNSLASAFLISNISKKKESANQMIKFTDDQVVKINKRLEYYRKLLKPYKE-LGSSE
A0A2E5RLE8      CADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQPYKE-IQENN
A0A2E7TQF6      CADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQPYKE-IQENN
A0A2E6GVY9      CADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQPYKD-LQKDN
A0A350JJ90      ASAICEQIAQTYLVFDHERKSESANQVLEFINQQIEEVYSKLKISEDLMSEFSQ-RTKLT
A0A3M1CDV2      TTDIVNTIAEEYLIYDVERKSESSKNILNFINAQLSVVYEELKNSETKLNEFKK-QNNIV
A0A522EYA6      TTDIVNSMAEQFKEYDREKKGESEQKILSFLEDQLAIAFERLRTAETSIYSFKK-ENKVT
A0A4P5U6G4      AADIVNAMNDEFISYDKEKKTESATLILNFIESQINLINAELQAYENQIKAFKI-QNGLI
A0A2E2TFD1      AADLANAISTGFIDYDLTRKIYSSTQVIEFIDSQISEVYGRLKESEVSIQEFKL-SNKVT
A0A2E4ELE6      AADLSNAISGGFIDYDLQRQITSSNQILEFIDHQSSEVFTRLKSSEVSIQEFKI-DNKVS
A0A2E3XZI5      SKDICNSLAEIYIDYDLERKQLSSEKIVKFINNRKDSVQKKLILNEKKIRDFKK-LNDFE
A0A2M7NLQ9      AAIVTNTVVDIYFEKTLENKNKVYRQTINYLEDQVRIVQDSLERIEKRIDNYKQ-ENGIT
I4AFR0          AAIITNTIVDIYFEKTLENKNKVYKQTIDYLDAQTTIVQDSLEQVEKRMDDYKL-ENGIT
A0A2N2Y3E5      TSEIVNTISEQFLKYDVEKKKESADKILDFIENQSDLIYDELDKIEEQLILFRK-QNNIK
A0A2D9D7T6      TRDMTQAIMDVFFLYEEEISKKNTDKILAFVDTQLDSLSTLLQKSKDSITSFQK-KSKLS
A0A1F3PPL5      TSEVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSETERQIHSFKK-ENKIS
A0A357QK06      TSEVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSETERQIHSFKK-ENKIS
A0A662AEA4      TSEMVNTIAEEYMKYDIEKKKESAQNILSFIDLQLKSVYKNLDHTEKQLHEFKK-ENKLN
A0A0S2HYK8      AADLVNAVAREFQRFEVEKKKESIQNILAFIERQLKNVYKTLDTTESKLQEFKK-ENNIP
A0A2N5ZWN6      AADVVNKIAQEFQLFDVEKKKESVKNILDFIERQLKNVYQTLDNTENKLQQFKK-DNNIP
A0A0F2NS19      TSDVITSLANEYILYDIEERSKSSKKIIQFLDDQLDKYYNKVKLSENRIQDFQT-SKKIG
A0A2A5H8X6      TSDIITSLANEYILYDIEERSKSSKKIIQFLDNQLDKYYNKVKLSENRIQDFQT-SKKIG
A0A2H0GAU8      AKDIVTSLANEYILYDLEERSKSSKKVIEFLDDQLDKYYNRVKLSENKIQDFQS-NNKIG
A0A2M8FTK1      AKDIVTSLANEYILYDLEERSKSSKKVIEFLDDQLDKYYNRVKLSENKIQDFQS-NNKIG
A0A2A5B3B0      AKEIITAVANEYIDYDIEERSKSSKKALQFIDQQLDKYYNRVKGAENRIQEFQE-GTNFS
A0A5C6RXM7      ARDMVTAIAEEYIDFDIEERSKSSKKILEFVDIQLDKYYNKLKLSENKIQKFQK-DNNFK
A0A2E0FJ09      TKDVLGALIENFDQFDSIKRSESSNRIVEFIAMQKDSVSKKLKESERMLKDFKD-TNKIR
A0A1F3FZ62      SADIANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKTESDLDMFKR-MNKIP
A0A1F3K211      SADIANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKTESDLDMFKR-MNKIP
A0A1F3KLL5      TTDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDENEKKIHDFKK-SNIDS
A0A359D1M1      TTDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDENEKKIHDFKK-SNIDS
A0A2E7CT70      AQDVCNTISKVYIDYDLKKKALSSINIVQYINAQKDSVDKRLKLSEQEIQIFKK-AN---
A0A2D5V560      SKDICNSIVKNYMDYEIDKKQKSTDNIVSFITRQKDSVRKRLIRNEKDLRIFKK-NN---
A0A2D7K5A8      SKDVCNSFVKIYMNYEINKKQKSTDKIVAFIKIQKDSVKNRLIKSEKDLRIFKK-NN---
A0A2E1XQ82      SKDICNSIVEIYMNYEINKKQKSTDKIVAFIETQKDSVKNRLIKSEKDLRIFKK-NN---
A0A1V6I2U9      STEITNTIAEKFIEFDEAKKKESATNIIKYIDQQMENVFTQLNATEKDLHNFRE-QNNIL
A0A1F3C1M2      TSDVVNTISEEFLKYDVEKKKESDQQILAFIEDQESLLLKNIDQTEREIHDFKQ-LNNIE
A0A1F3DS87      TSDVVNTIAEEFLKYDVEKKKESDQQILAFIEDQESLLLKNIDQTERELHDFKQ-VNKIE
A0A2H0B957      TSEIVNAIAEQFIKYDVEKKKESSQKILDFIEVQNNLIYQQLDSIEQLLIKFSI-THQIQ
A0A1F3CFW6      TSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQFGI-THQIR
A0A2M7E2T8      TSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQFGI-THQIR
A0A2M7NC69      TSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQFGI-THQIR
A0A5C8A5B4      GQAFLNKLMETYIDYELDKQQQKGRKTIDFIDKQIGTVSDSLQKVENSMEQFRGVSGGMI
A0A4Y9ITE2      AEKVVNALVEGYNERGIEENRVKNQITADFIETRLGSIAEELNAAEREVEAYKV-DNNFV
A0A5M8NYX7      GIDVINTLIGIYNQRSIAEKNYVANHTIDFINDRITTITEELSSSEQKVEEYKQ-VQGMT
A0A3D5KRY6      DVDFLDQLSKMYIQYGLEKKNRKASNTITFIDNQIAGVNYSLQSAGNMFTNFRA-ENRTV
A0A1V5IPN7      AMAAVNAIADAVQQQNTQMARLEFTTIREFLGEQLDLISRRLQISEDDLRAFKN-ENKLI
A0A0E3V905      GEAILNQLIREYNEAAIMDKNKVAASTLKFIEDRLNIVSGELASAERNVEQYKS-HQGIT
A0A553ETH6      ARDLVNAIDSLYLNYSKQEKTKENKQKIEWLDNELREIESQLEDYENYFETFTV-ENRTS
A0A640Q161      SAELANAVADVYIENYLQAKLDMTAKATSFLTDSLEGLKKKLDVAERNLARFYE-ENQVV
A0A640QU49      SAELANAVADVYIENYLQAKLDMTAKATSFLTDSIEGLKDKLDIAERNLAKFYE-QNQVV
A0A1Q3PII2      GEAILSQLIARYMKASIAEKNKVADNTIAFINQNLQRISSELAEVETSIEHFRK-HHRVI
A0A351BXT2      AMLIANLYSKVYQSFSLDLSREELTSLTGYLREEKENKFKDLAVAEGELEDYQK-NGGLI
A0A2K8Z965      GEAVINQLITEYDQAAIMDKNKVAANTLKFIEDRLNIVSGELSSVEKNVQSYKS-HQGIT
A0A418M8U8      GEAVLNQLIDEYNQAAIIDKNKVAANTLRFIEDRLAILSGELTTVEKEVERYKA-TQGIT
I2GTA4          GEAVLNQLIEEYNQAAIIDKNKVAANTLRFIEDRLAILSGELTAVEKEVERYKA-TQGIT
A0A2K8ZAJ2      GEAILNQLISEYNKEAVVDKNNQASSTLNFIEDRLALISGELSNVEKEVESYKS-THGIT
A0A368JPA3      GEAILNQMIANYSSASTTEKNRAVANTLSFIQTRLKLVSAELATLEKSIETYKA-VNGIS
A0A5N1JI29      GEAILNQMIANYSSASTNEKNRAVANALSFIQTRLKLVSAELATLEKSIETYKA-VNGIS
A0A3P1BT12      GEAILNQMIANYSSAATDDKNRVVASTLSFIQTRLKLVSGELAGLEKSIETYKS-ANRIS
A0A3P1CI15      GEAILNQMIVNYNSAATVDKNRVVASTLSFIQARLKLVSGELAALEKSIENYKS-VNRIT
A0A4R8CUK1      GEAILNQIIANYHSAAIGDKSRMIANSLVSIQARLKQLSGEQKALEKSIEHYKS-VYRIA
A0A3D0MYJ7      ASLISIIYANSYLSYSLELSKSELTLKRKFLENEKEKKFNELSIAESNLENFQK-QNGIV
A0A662AH13      ARLIANTYADAYEGLSLRYTRQQLTTVVEFLKNQRQVQYNALLDVEEKLKDFQV-EGGII
A0A5C7QA01      ITQVLNAILKAYSVQNIERRTAESAQTLKFLDEQLPELKKQLDNAEREFNKFRQ-QYNTV
A0A3D3LS70      ARLIANVYAAAYLNYNLEFSRKGVKNVGDYLFEIKNKKLNDLNNSEAALQDFQQ-RGGIV
A0A1G1TM36      GIDVLNQLIAAYNNASATEKNKLTANALQFIDSRLGSLRGELNQAESAVTGYRS-QQGLA
A0A1G7ZF38      GEAILNQLIERYQKASIQEKNKVADNTIAFINSNLTHISSELTQVETNIEQFRK-RHRVI
C6VS52          GEAILKQLIVRYQKASIDEKNKVADNTIAFINHNLERVSAELASVETNIEGLRK-QHKLI
A0A0P7X1V8      ASRVVDLAIETYTDVSTRINRSQARNAIDFLDSELDKVSMQLNYSEEQLRDFMN-QNQLV
A0A3B0C2S4      SETVINELINKFNQDGIIDRQLISKRTLEFIDERFAYLSGELDSIEVGKEDFKR-LNNLS
L8JI02          TARFLDQLLHIYLQNELHKKNQLGVKTIQFIDSQLSGVSDSLKRVEGWLENFRA-KSNIQ
A6EBM4          AADILNAILQEYLDYDKLQKTQSATQMIGFINEQLKHLSSAVSGAEKSLETYKQ-QSKVM
A0A416GA42      AEDILNTLVDAYKEDIVNDKNTVARNTERFVVDRLAILEKELGNVDNQIASYRS-ANQLI
A0A4R5DL69      GEALLKKLTENYLSTSITDKNRIADSTIAFIDQNLHLVSLELKDIEEKIESFRR-KNHIT
A0A1T3IYP5      AADVLTALINVYNEVYLQDKNKIAENTANFIKDRLEIIEGELGSVESNIEDLKI-ANQGI
A0A1M4YED3      AKDVLNELMNVYTINGLSEKDALAANTLATIEKRLTFVAKDLDSIERTIQQYKS-QKGIV
A0A3P1Z8V4      AEDVLNEVCNIYKKDIVDNKNRVAQRTAEFIDERLTLISRELSDVEHRLATFKQ-NNSIV
A0A2N3U785      GIDLVYHLISLYNKDKANDKKASAVNSLSFLDERIKFLSSELTDVEENVERYKR-SNEVT
A0A0E3ZG78      AKDIVNKLIEVYNKEAIEDKNLIASYTIDFIDERLRYLTSELSGVEKDVEQYKR-QHELT
A0A1I6BRK6      AKNIVDKLMQVYNDEAIDDKKQLGTSALKFLDERLKFVTTELSTVEKGVASYKS-TNSLT
A0A243WAB1      AKDILDKLMEVYNDEAVVDKNLMATSTLKFLDERLKYITAELSGVEKGVEKYKS-VNGLT
A0A126PFG0      GMDVLNQLMAVYNGAATAAKNKLTANTLHFIDSRLASLRGELSQAEADEAGYRS-QQGLT
A0A3M1N7Z3      ATRFLNALIEQAREHERSIRQLQYTKALGYIDTLVNFFQNQLLVA----------QDTLY
A0A2H3NSN0      AAAVANTYADAYRAYSRESARAGVAAAREFLETQLDRREEDIEEVENEWQQFAR-RHDVA
A0A2P6C324      AALIANSFAQQYRLFSREMARAGVVAAREFLETQLEKRKDDIRAIENEWEAFAR-SNAIV
A0A1M6XHU0      AAVIANRYAEEYEKYSRERSRESLAAAREFVEKQVEQRRQELEALERQWEAFAR-SRQVV
A0A5S9C8G0      AAVIANRYAEEYERYSRERSRESLAAARAFVEKQVEQRRQELEELERQWEAFAR-SRQVV
G2SF81          AAVIANRYAEEYERYSRERSRESLAAAREFVEKQVEQRRQELEELERQWEAFAR-SRQVV
A0A5S9EYW1      AAVIANRYAEEYERFSRERSRESLAAAREFVEKQVEQRRQELEELERQWEAFAR-SRQVV
D0MHQ9          AAVIANRYAEEYERFSRERSRESLAAAREFVEKQVEQRRQELEELERQWEAFAR-SRQVV
A0A4D7K1D4      AYDVVNTIDSLYLEYSREQKMQANKQKIAFLEEQMGNTAQTLENYENYFESFTI-ENQTV
A0A3C1ITV0      AEDVLNTLLDAYNEEWIRYTNKSTDNTAKFIDERLMSIERELGNVDSDIERFKS-SNRLL
R7HN19          AEDVLNTLLDAYNEEWIRYTNKSTDNTAKFIDERLMSIERELGNVDSDIERFKS-SNRLL
A0A060RD97      ATAVLNTLIAEYNTESIMDKNRIARNTDIFIMERLAKLSKDLEGVDTDIADYKQ-QSNVL
A0A0D3L8Q3      GKDILNKLIEVYNKEAVEDKNVIAANTIEFINERLQFLTEELTDVEKDVEEYKR-ERRLT
A0A5B6TJH8      AKDILNKLVEVYNKESIEDKNVLATNTLAFIDERLKYLTTELTGVEKNVEQYKS-QNEVT
A0A519U664      AKNIINKLMYVYNRESIEDKNLMAVSTLKFLDERLRLITAELSGVEKGVEKFKS-QNALT
A0A519UDD1      AKDILNKLMEVYNKEAIEDKNLLATNTLRFLDDRLAYLTSDLSSVEKLVEQYKS-TKGLT
A0A519MA34      AKNIINTLMHVYNSEAIEDKNLMAVGTLKFLDERLRLITAELSGVEKGVEKYKS-QNALT
A0A519UCX0      AKNIINKLMHVYNNEAIEDKNLMAVSTLKFLDERLRLITAELSGVEKGVEKFKS-VNALT
R7PCR1          AEVLLSTLLDVYREDIIESKNRVAENTSKFIEERIGLIEQDLIKVEGSLARFKE-KYNIV
A0A350IHV0      AEDILNTLIDVYNEQWVANKNRSARNTTAFINDRLVVIENELGGVEESLKQYKE-THKIT
A0A1G9E2A9      ARDIVNKIDSIYLVQTIENKNLATEQTLKFLDDQLDSTAQKLAQQEESIEDFVR-ENRTL
A0A098LL25      ATDIVNTIDSVYLEQTLENKSKSHEQTIKFLEASLLKTEENLAKAEKDLETFVR-NNRTV
A0A2T2YJE8      AHEIVNSIDSVYLEQKIALKDLATRQTLSFLDEQLKETNENLGNSEIQMENFVK-ENKTY
A0A127B287      ARDVVNKIDTVYLQQKLARSNQASQQTIDFLSNQLQETQDNLQKAEIDMEYFVK-QNKSY
A0A3M9N829      ARDIVNNIDTVYLQHKLERSNQASRQTLNFLTEQLKETENSLKKVEDEIESFVR-QNKSY
A0A0P0CSF9      ARDIVNNIDTVYLQYKLERSNQASKQTLNFLNEQLKETEDSLRKAENDIERFVR-QNMSY
A0A5M8QQB8      ARDIVNNIDAVYLQHKLERSNQASKQTLSFLNEQLKETEDSLRKAENDIEQFVR-QNKSY
A0A3M9MNC3      AHDIVTNIDAVYLQHKIERSNQASRQTLTFLNDQLKETEDSLRKAENDIERFVR-QNKSY
A0A5B6TAX2      AHDIVNNIDAVYLQHKIERSNQASRQTLSFLNDQLKETEDSLRKAENDIERFVR-QTKSY
A0A5N1IQ33      AHDIVDKIDTLYLQEKLAKNSLASQQTLAFLEGQLDENSRKLQQAEVALQDFVR-RNKTF
A0A512AYT3      ARDIVTEIDTAYLEQKIHQKNLASSQRQKFLDQLLKETETNLQNSEENMESFVR-QNRTY
A0A5M6CYN7      ARDIVNKIDSAYLEQKIRQKNLATSQIEQFLNEQLKETQDNLANSEGKMENFVR-ENRTY
A0A369QP10      AHEIVNSIDSVYLEQKIALKDMATRQTLSFLDEQLKETNENLGNSEIQMENFVK-QNKTY
A0A126PDF2      AQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERAENRYQGFVE-KTKTY
A0A2Z3GKA1      AQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERAENRYQGFVE-KTKTY
A0A502GZP7      AQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLDVNYDNLQRAENRYQGFVE-KTKTY
A0A519SBU8      AAHIINNIDTVYLKEKLDRKRQSSALTLSYINQVIADNDKLLRQAEDTQQEFVR-QNKTY
A0A4Q3JNZ3      AAHIINNIDTVYLQEKLERKTKNSELSLGFIDRVIAENDKKWQAAEEAQKEFVR-RNKTY
A0A519Q9V3      AAHIINNIDTVYLQEKLDRKKQSSALSLKFIDQVIADNDKRWRAAEEAQKEFVR-RNKTY
A0A0M3RW20      AKDIVNRIDTVYLVEKLAKNSQGQQQTLQYLDEQLDITRDSLQRAELALQRFVK-ANKTY
A0A495VFX4      AQDIVNRIDTVYLVEKLAKNSQGQQQTLEYLDEQLDVTRDSLQRAELALQRFVK-ANKTY
A0A1S9B3W0      ARDIVNKIDSVYLQVKLARTNQATQQTLTFLDGQLVENRDKLQNAEEALQNFVK-QNKTY
A0A1W1VRL3      AQDIVNKIDTVYLQEKLAQKKKASDQSLQFLSEQADAFNNKLQLAEDNLQSFAR-ENRTY
A0A1M6R305      ARAIVNKIDTVYLQEKIAQKQAATAQTLQFLQQQLAENRQNLAVAEENLQSFAR-QNKTY
A0A4Z0PHK3      ARAIVNKIDTVYLQEKLAKKQEATAQTLQFLDKTLTENQQQLQGAEENLQAFVR-ENKTY
A0A2M9B9H9      ARDIVNKIDTVYLQEKLAKKQEATAQTLQFLDKTLTENQQKLQSAEENLQAFVR-QNKTY
A0A4Z0QCY9      AREIVNKIDTVYLQEKLAKKQEATAQTLKFLDRTLAENQDKLQDAEANLQAFVQ-QNKTY
A0A418R9X5      ASDIVNYVDSVYLVEKILRKQETMARATNYIDRQLGVNSDKLSQAEAKMQDFVR-KNKVF
A0A428JSJ3      ASDIVNKIDTVYLVEKLLRKQETMARATSYIDQQLGINDNKLGQAESNMQDFVK-RNRVF
A0A428KI59      ARDIVNKIDSVYLVEKLLRKQETMARATNYIDKQIDINDNKLGQAESNMQDFVK-RSRVF
W8F1I6          ARDIVNKIDSVYLVEKLLRKQETMARATNYIDKQIDINDNKLGQAESNMQDFVR-RSRVF
A0A246FQC0      AQAIVNGIDSVYLVEKLVRKQEQATRAMGYINDQLGDNNQKLNQAEEAMQSFVK-RTGSY
A0A372E5P8      ARDIVNAVDAVYLEEKLTRKREQAARALRYINEQLGSNNQSLSQAEENMEAFVK-RTGSY
A0A1H3EMW1      ARDIVDAVDAVYLEEKLVRKREQSARALRYINEQLSNNNESLGQAEENMQSFVK-RTGSY
A0A1H9ZSN3      ARDIVNAVDAVYLEEKLARKREQSARALRYINEQLGSNNQSLSQAEEAMEAFVK-RTGSY
A0A5N1J2M4      AQDIVNRVDSVYLEHKRETKNQSNEQTISFLREQLDATKVSLQEAEANLEAFAK-KNKSY
A0A519S476      AAHIVNNIDTVYLQEKMARKKQGNDSTLSYLDKLIDETDKRFKAAQELQQQFVL-RNKTY
A0A4Q3JRW8      AAHIINNIDTVYLQEKLDRKKQSSALSLQFIDQVIADNDKRWRAAEEAQKEFVR-RNKTY
A0A519M923      AAHIINNIDTVYLQEKLARKKQQSELSLKFIDLVIADNDQRWRAAEEAQKEFVR-RNKTY
A0A4Z0ENW1      AQRIVNALDTVYRDVKLAHKQETTEKSLDYLDKQLQENGKNLANAEDNLKEFVQ-QNRTY
A0A519UDB4      AQRIVNALDSVYREAKVARKQEATEKTLAYLDQQLAANGINLAKAEDNLKTFVE-QNGTY
A0A3S0QKV1      AQAIVNKIDSVYLNVKLDRSSQATQQTLAFLQGQLLDNRAKLQDAEKALEEFVR-QSKTY
A0A328BL48      ARDIVNKIDSVYQQVKLARNYQSTQQSMAFLDSQLNGNRDSLQKAENALQAAVK-RNRTY
A0A5R8WLY4      ARDIVNKIDSVYQQVKLARNSQSTQQSMAFLDSQLNGNRDSLQKAENAFQAAVK-RNRTY
A0A1I5WSL8      AQDIVNKIDSLYLVEKVTRKNEATRNQLKFLDQILDENGQNLERAEDRLQSFVQ-KTGTY
A0A0U3JVM7      AQDIVNKIDSVYLAEKLAQKSETTTRKLRFLDQILDQNGQNLERAEDRLQNFVQ-QTGTY
A0A1G1SSV2      AQDIVNKIDSVYLEEKLAQKSESTISKLRFLDQILDQNGQNLEDAEDRLQKFVQ-KTGTY
A0A1G1SXV7      AQDIVNNIDAVYLEERLAQKQESTISKLRFLDQILDQNGQNLEDAEDRLQNFVQ-KTGTY
A0A0W8EDI5      ARDIVNKIDTLYLQEKLAKNTQATQQALAFLEGQLDQNSQRLQGAEEALQEFVK-RNKTY
A0A3B7RBP8      ARDIVNKIDTLYLQEKLAKNSLATQQTLAFLEGQLDENRNKLQGAEVALQEFVR-RNKTY
A0A3R9P8H7      ARAIVNKIDSVYLVEKLLRKQEQAARAMSYINEQLGENNQKLGQAEENMQAFVK-RNGTY
A0A238WIA7      AHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEENRRLLRQAEEQLQDFMK-RNNLF
A0A212UCJ7      AHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLADQSNDNRQLLRQAEEQLQEFMK-QNRLF
A0A4Z0MQE1      AHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEDNRQLLRQAEEQLQDYMK-QNKLF
A0A4Z0PCF4      AHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSDENRQLLRQAEEQLQNYMK-QNKLF
A0A5D6VDG1      ARDIVNRIDTVYLVAKLTKNTQSQQQIMQYLDKQLELTRDSLQRAEIALQSFAK-RAKMY
A0A243WHR7      AQAIVNKIDTVYLQEKLAQKQEVTQRQLKFLETQIVENKDSLQGAEKNLEKFTD-RTKTY
A0A5B8A0P6      ARDVVNKIDSVYLEEKLAQKQQATAQTLEFLDKTLTENKNKLEAAENNLQGFVR-RNKTY
A0A076HRT9      ARAIVNKIDTVYLQEKIAQKQTATAQTLQFLDQQLTENRQSLAQAEENLQDFAR-QNKTY
A0A4Z0PVM7      ARDIVNKIDTVYLQEKLAKKQEATAQTLQFLEKTLAENQQKLQGAEANLQAFVQ-QNKTY
A0A1M6DHW8      AQDIVNKIDTVYLQEKLTQKQQATAQTLQFLEKTLSENRKQLQLAEENLQSFVR-DNKTY
A0A4Q5LC61      AQDIVNKIDTVYLQEKLAKKQQATAQTLQFLEQTLAENRTQLQNAEENLQSFVR-NNKTY
A0A2A8CVM9      ASTVANLYSSQYEIFSREKARASVTAARDFLETQAEKRREEIRELEQQWETFAQ-NNQVV
A0A3C0ZQC7      AALIANTFAEAYYDRNLFSSRSRSRAAREFLDTQLKVRKSSLDESEGTLQKYME-QKGIV
A0A2E3R1D0      AALISNTYAEAFAQLTQDQSRSGASASREFLEDQVETQNDRLQETDAAVEQYML-REGAV
A0A2T2USC0      AALIANLYAQEYINYNERKSKESARSTRKFLEQQSKKFRNRVNRAEQRLEKFMR-EENAV
A0A2T2V0F3      AALIANLYSQAYIDYNQRKSQESARSTRKFLEQQASKFKNRVDRAEQELESFMQ-EEKAV
A0A2T2S682      AALIADQYAAAYLQRTREKSRESLRAKRDFLDQQSDKFATQVQQADRALAKYMQ-KEEAV
D5H561          ARRLANLFTEAYIELTQKSSRERVKASRTFLEQRSQELERELETIEQRIQRFQR-SEDAV
A0A2H3NWA9      AALLVNLFSEEYVEFSRDRSRQSVQATYDFLKEQSESLRVDMEEAEQNLVDFMQ-REEAV
A0A2A8CVB6      VALVANIYADEYIRRTKEKARESLQASRDFLERQAEKLKAEVQAAEGEIENYMQ-REGAI
A0A2P6C1S6      ASLVANLYAEEYIQRTQERSREDLRASRQFLEEQADTLRQDVQAAEQKIEEYMQ-RENAV
A0A2T2UTM4      VSLIVNLYAEEYIQRTKEKSREDLKASREFLEEQADTLRQEVQAAEQKIENYMQ-EEKAI
R5RVP0          ADAVLRTLIDVYNEHWVENKNRSARNTTAFINDRLIVIEKELGGVEENLKDYKS-SHKIT
R6A0L2          ADQVLATLYDTYKEDVVENKNRVALNTAKFIDDRIQIIGRELSSVENQLASFKK-RNQLV
R7LG80          AVDVLNTLYNTYKEDVVENKNRVALNTARFIDERLKLIGTELSDVENNLASFKK-RNSVL
A0A2L2WX98      AEDIINVVFDAYKRDIVANKNRVANNTAIFIDERIRIIDGERIASRDQMAKFLS-DNKLT
A0A285T4L1      AEDVLNTLVNVYNEEALNDKNQVAVNTSEFINERLLIIERELGGVETELEAFKQ-SNQLM
G5GD56          AEDLLNTVYEAYKHDVVDNKNRVASSTANFIDRRVALIGQELTQVENRLASFKQ-QNRVI
R5KD55          AEDILSAVIDIYNKVWMKNRNEVSAGATKFLDERLAIIERELDNVDNDISRYKS-KNLLP
A0A174QNT3      ADAILATILQVYNETIVEDKNRIASNTARFIDDRIVIISHELGEVEDQLTIFKQ-EHRIV
A0A4S2FGS1      ADAILTSILQVYNETIVEDKNRIASNTARFIDERIVIISRELGDVENKLTTFKQ-EHRIV
R9I0H0          ADAILTSILQVYNETIVEDKNRIASNTARFIDERIVIISRELGDVENKLTTFKQ-EHRIV
K5BUT9          ADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQ-RNQIV
A0A174FPA3      ADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQ-RNQIV
R6S9Y6          ADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQ-RNQIV
A0A642LIH6      ADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQ-RNQIV
C9KX15          ADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQ-RNQIV
R6DAG6          ADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFKQ-RNRII
A0A3L8AAP1      ADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFKQ-RNRII
A0A4S2AYX2      ADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFKQ-RNRII
A0A4Y9H477      ADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFKQ-RNRII
A0A0E2M2Y7      AKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-SNNIT
A0A0K2J6Z0      AKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-SNNIT
B2RKZ8          AKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-SNNIT
A0A212GC82      AKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-SNNIT
A0A254MU12      AKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-SNNIT
R6CQ93          AEDVLNTLVNVYNEEAVNDKNLVAVNTSKFINERLIIIQRELGGVETELESFKQ-SNQLM
A0A3D1NQW3      AEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEKFKK-DNKIY
B0MT10          AEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEKFKK-DNKIY
R7JGW9          AEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEKFKK-DNKIY
A0A414Q925      AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
A0A415PUS9      AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
A0A108TCU0      AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
A0A413BA42      AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
S3Y344          AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
A0A4Q5G8Y8      AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
A0A412TGL3      AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
A0A413VJ33      AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
A0A414L0W6      AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
A0A412DP39      AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
A0A413ZSE8      AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
B0NP84          AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
R6AK43          AEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KNRLT
A0A412N2D9      AEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATVDAEIENYKK-KNKLT
A0A1Y4JYS9      AEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATVDAEIENYKK-KNKLT
R6LHA4          AEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIETDLATVDAEIENYKK-KNKLT
A0A3D2BF46      AEDVINTLIARYNDESINDKNRIADYTADFIDKRLRIIGSELDAVDRKISTYKK-DNEMY
A0A4Y1WUN1      AEDVINTLIARYNDESINDKNRIADYTADFIDKRLRIIGSELDAVDRKISTYKK-DNEMY
A0A4Y1XL94      AEDVINTLIARYNDESINDKNRIADYTADFIDKRLRIIGSELDAVDRKISTYKK-DNEMY
A0A358R538      AEEVIDALVAVYNEDAVEDKRRISVVTSDFIRARLDVIGRELGDVDRGIEELKR-SNRMI
A0A1Y4AAB8      AEDVINTLITVYNNDAIADKRRISEETADFIHSRLEIIGSELNDVDRDIENFKR-DNRMV
A0A1Y3WWY9      AEDVINTLIDVYEKDAIDDKRRVSVTTAEFIKSRLEVIGRELGDVDRDIENLKK-DNQMV
A0A1Y4U5L4      AEDVINTLIDVYEKDAIDDKRRVSVTTAEFIKSRLEVIGRELGDVDRDIENLKK-DNQMV
A0A1Y3VCJ1      AEDVLNTLIEVYEQDAINDKRRVSVSTAEFIKSRLEVIGRELGEVDRDIENLKK-DNRMV
A0A1Y3QTW7      AEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SNQMI
R6XWY7          AEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SNQMI
A0A4Y1X9Y9      AEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SNQMI
A0A4Y1WM66      AEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SNQMI
A0A174AVF1      AEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SNQMI
A0A656Q4F4      AEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SNQMI
A0A1Q6EIY0      AEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKK-SNKMI
A0A5B5VN71      AEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKK-SNKMI
E4M8L3          AEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKK-SNKMI
I3YQ50          AEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKK-SNKMI
R5UEY8          AEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKK-SNKMI
A0A1H4D866      AEDILNTLISVYNEDAIDDKRRVSVTTAEFIKARLAVIGRELGDVDRDIEDIKK-DNQMV
A0A5B3G4Y7      AEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKK-DNRMV
A0A374A9J5      AEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKK-DNRMV
A0A5B3GQN5      AEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKK-DNRMV
A0A1Q6E9S3      AEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKK-DNRMV
D4IJ36          AEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKK-DNRMV
A0A3E5HPT8      AADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIEDLKR-ANNGV
C6IJ48          AADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIEDLKR-ANNGV
Q8A3U2          AADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIEDLKR-ANNGV
A0A3R6S1H6      AEDIINTLIVVYNEDAINDKNQVAINTSNFINERLIIIEQELGGVESEIETFKK-ENLLT
A0A3R6SD81      AEDIINTLIVVYNEDAINDKNQVAINTSNFINERLIIIEQELGGVESEIETFKK-ENLLT
A0A354WXN6      ADDVLNTLIAVYKEDVINDKNQVAVNTSNFIAERLLIIEKELGSVDANIESFKR-ENQLT
R5IP14          AEDVINTLIAKYNEDAIADKNRLAVNTARFIDDRLEIISQELGDVDSQIETFKK-ENELT
A0A316SZX7      AEDVINTLIDVYNLDGTNDKKKVAESTANFIDERLLIIGKELGEVDSEIANFKS-TNKLT
A0A1Y4AIY1      AEDVLNTLIAVYNEDAIEDKNRITVSTSEFIAERLVIIEQELGSVDTDIETFKR-EHQLT
F3ZRU7          AEDILNTLIDVYNEEAINDKNQMAMNTSEFINERLIIIEKELGGVDTQIETFKK-TEKLT
A0A0J6CIR2      AEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-ENQLT
A0A3D8HG59      AEDIVNTLIAIYNEDVINDKNQITVNTSDFINDRLIIIEKELGNVDSHIESFKR-ENQLT
A0A3R6S408      AEDIVNTLIAIYNEDVINDKNQITVNTSDFINDRLIIIEKELGNVDSHIESFKR-ENQLT
A0A1C5Q1F3      AEDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGVESQIADYKS-QHNLA
R7A239          AEDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGVESQIADYKS-QHNLA
A0A3R6HIK7      AEDVLNTLIAVYNEDAIEDKNRVTVSTSEFIADRLVIIEQELGSVDANIETFKR-ENQLT
K5ZVW7          AEDVLNTLIAVYNEDAIEDKNRVTVSTSEFIADRLVIIEQELGSVDANIETFKR-ENQLT
A0A1Y4D5Z0      AEDVLNTLIAVYNEAAIDDKNKVTISTSDFIADRLVIIEQELGDVDANIEAFKR-ENQLT
A0A413VXJ7      AEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFKR-ENQLT
I9RSN9          AEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFKR-ENQLT
U6RJK5          AEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFKR-ENQLT
A0A1Q6GA32      AEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFKR-ENQLT
I9RPU6          AEDVLNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-ENQLT
I8YFS5          AEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFKR-ENQLT
A0A4Q5F7I7      AEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFKR-ENQLT
I8Y597          AEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFKR-ENQLT
A0A1Q6GBF5      AEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-ENQLT
I8YFZ3          AEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIENFKR-ENQLT
A0A4V1YNX8      AEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-ENQLT
A0A1Q6GDH2      AEDILNMLISVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-ENQLT
U6RSB0          AEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-ENQLT
I9GXM2          AEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-ENQLT
I9SIK1          AEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-ENQLT
A0A4Q5FNG1      AEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-ENQLT
I9TP59          AEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-ENQLT
R5S343          AEDVINTLIEAYNEDAVNDKNQIAINTASFINERLKIIDRDLGLVDSSIASFKS-EHRLT
A0A1M6K7I9      AEDILNTLISVYNEDAINDKNQIAVNTSNFINERLIIIEKELGTVDADIESYKR-ENQLT
A0A5M6A8C8      AEDILNTLISVYNEDAINDKNQIAVNTSNFINERLIIIEKELGTVDADIESYKR-ENQLT
A0A4V1YPN7      AEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFKR-ENQLT
A0A4Q5F874      SEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-ENQLT
A0A641LV22      SEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-ENQLT
A0A3R5ZMK1      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A0A3E4ZTK7      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGSVDSDIESYKR-EHQLT
A0A1Y3ZIA4      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
K5Y1A4          AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A0A4Q5CIT0      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A0A3R6K8X4      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A0A414GI87      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A0A415BDM7      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A0A412DM15      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A7AEU7          AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A0A1Q6I3T6      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A0A414XX40      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A0A3R6BKI7      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A0A414LPI6      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A0A412M2W1      AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
K5ZX55          AEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EHQLT
A0A5F0U645      AEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-ENQLT
K5ZBN2          AEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-ENQLT
A0A0J6CKW3      AEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-ENQLT
A0A0F5IQM7      AEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-ENQLT
A0A496CDT3      AEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-ENQLT
S0GLB0          AEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-ENQLT
A0A3R6NLC1      AEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSVDAEIEVFKR-ENQLT
A0A416WYC9      AEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSVDAEIEVFKR-ENQLT
A0A0F5IT40      AEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-ENQLT
A0A496CX20      AEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-ENQLT
A0A5F0UBI0      AEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-ENQLT
S0GSI7          AEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-ENQLT
K5YB65          AEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-ENQLT
A0A0F5IWP9      AEDVLNMLIAVYNEDAINDKNQVTVNTSDFINDRLIIIEKELGSVDADIETYKR-ENQLT
A0A0F5IZT8      AEDVLNMLIAVYNEDAINDKNQVTVNTSDFINDRLIIIEKELGSVDADIETYKR-ENQLT
A0A417LKQ2      AEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEKELGSVDADIETYKR-ENQLT
A0A416TME1      AEDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSVDADIETYKR-ENRLT
A0A416XPE8      AEDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSVDADIETYKR-ENRLT
A0A5C8KAD6      SEDILNYLINSYNDMAVLDRNELAANTLDFVESRIQLVEKELKDLENEVVHYKA-TNGAV
A0A5N1J695      GEAILNNLIYAYDQAALNERNTLAANTMAFIEDRIKLIEKDLENVEEKVQQYKS-SQGVV
A0A1H4ADG3      GIDIMNGLIHVYQLSNIEDNNRITDSTIEFLNNRLFTVGAELDSIEGNIQHFKQ-HNELA
A0A5B8VUR8      GIDIINGLIHRYQLSNIVDNNRIADSSIEFINNRLVTVGAELDSIEGNIQHFKQ-SNDLA
A0A2A4G4B1      GQLILEELVATYNKLEQDDKNLISENTAAFIDSRLKGITKELVMVEGHLESFKT-QRVLT
A0A3N2M1H3      AEDILNTVLLVYNENWIEDKNKMAVATSAFIDERLRLIQQELGDVDSNIAKYQT-TTGSP
A0A4S2G8T2      AEDILNTVLLVYNENWIEDKNKMAVATSAFIDERLRLIQQELGDVDSNIAKYQT-TTGSP
A0A212K7W5      AEDILDTLITVYNKNWIQERTQIAVNTSSFIEERLNVIEKELGGVEDSISRFKS-QNLIP
F5IU11          AEDVLDTLITVYNKNWIQDRTQIAVNTSSFIEERLNVIEKELGGVEDSISRFKS-QNLIP
A0A3N2N6F7      GDDFLSALIDIYNEKWVEQKAQMAVATSEFINERLNVIEKELGHVDDNIATFKG-EHLVP
A0A4P7VVU7      ADDFLNTLIDIYNEKWVDDKAK-AKSTSRFIAERLRVIEQELGNVDSDIADFKG-EHLVP
A0A2V1ILM4      ADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADFKG-EHLVP
A0A3N2L0E8      ADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADFKG-EHLVP
A0A3N2LFC5      ADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADFKG-EHLVP
A0A553LCN8      ADAILSALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFKQ-RNRII
K0XJ09          AEAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDVENELTDFKQ-KNRIV
R5EUZ0          AEAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDVENELTDFKQ-KNRIV
W0EQS0          ADAILSTLIDVYRETIIEDKNRIATSTAKFINERVEIISRELGDVENELTDFKQ-KNRIV
A0A1Y3WE15      AEAILNTLIDVYRETIIEDKNRIATSTAQFINERVEIISRELGDVENELTNFKQ-QNRIV
A0A1Y4GUK3      AEAILMALIDVYRETIIEDKNRIATSTAKFINERVEIISRELGDVENELTDFKQ-KNRIV
A0A352Z1R7      ARDLVNTLVQVYLGQNIELKTEEASRTVSFIENQLKGLRGELEGAEQDLETYKS-SSGMF
A0A0A2F501      AEDFLNMLINVYNESWVKDKNQVAISTSLFINERLSVIEQELGHVDKDISSFKS-ANLIP
R5B7P0          AQDILNTLIAVYNENWVRDKNQIANSTSVFINDRLRVIEGELAGVDSDISAYKS-ENMIP
R5B0L5          AVDLLNGVIAVYNEKWLADKNQVSVSTASFINERLAVIENELGHVDSDIASYQS-EHLIP
A0A374THP7      AEDVISTIISVYRKNWLEDKNQMTISTSHFITERLGVIERELGDVDKNISAFKS-SNLLP
A0A3R5XWG1      AEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKS-ANLLP
A0A5P0Y910      AEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKS-ANLLP
A0A5P0XQC0      AEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKS-ANLLP
A0A414YFM3      AEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKS-ANLLP
A0A5P0VXP6      AEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKS-ANLLP
A0A5P0W892      AEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKS-ANLLP
A0A0A2EVS5      AEDFLDTLISVYNENWVKDKNKIAVSTSQFINERLSVIEQELGAVDSDISSFKS-KNLIP
A0A1T4NAJ7      AEDFLDTLISVYNENWVKDKNKIAVSTSQFINERLSVIEQELGAVDSDISSFKS-KNLIP
A0A255T941      AEDILNTLIEVYNENWILDKNQIAISTSQFIGERLGVIEGELGHVDANISSFKS-ANLLP
A0A3N2KCL3      SQALLNTLIGVYNEYWVRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYKS-ANLIP
A0A4P7VSV0      SQALLNTLIGVYNEYWVRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYKS-ANLIP
A0A2V1IJY1      AQALLSTLIGVYNEYWIRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYKS-QHLIP
A0A4P7VXK7      AQALLSTLIGVYNEYWIRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYKS-QHLIP
A0A1Y4CHN5      AEDVLNTLIAVYNENWLKDKNQIAVSTSMFINDRLKVIENELGTVDADIASYKG-ENLLP
A0A1M6I2S6      AEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGYKS-EHLLP
A0A1Y3V692      AEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGYKS-EHLLP
F3PXM2          AEDILNTLIEVYNEYWIRDKNQIAVSTSQFIGDRLGVIENELGHVDANIAGYKS-EHLLP
A0A3E4ZNL4      AEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A174AHH7      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A174JCE8      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A3E4JMC4      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A412SND6      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A414IEQ9      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A415UKN5      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A0M1W8D8      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A3R6GKX5      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EHLLP
A7V4S1          AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EHLLP
B0NU19          AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EHLLP
D4V601          AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EHLLP
A0A4Q0U3M9      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EHLLP
A0A4R4H1Q2      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EHLLP
A0A397WLT5      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EHLLP
A0A3R6GM96      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EHLLP
A0A015XH67      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A078RZN2      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A4R4I3T9      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A6L0K5          AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A7ACT5          AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A6KY94          AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A173UQR8      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A3R6HK75      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A412B7D1      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A412VNY9      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A414LTU9      AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
I9Q4U4          AEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EHLLP
A0A373ISF0      AEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGHVDENISSFKS-EHLLP
U6RF62          AEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGHVDENISSFKS-EHLLP
A0A662ZZD5      AEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EHLLP
A0A395YYT3      AEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EHLLP
A0A642JYJ3      AEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EHLLP
A0A015UXN7      AEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EHLLP
A0A5M5W148      AEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EHLLP
A0A3A5TI83      AEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EHLLP
A0A415NEB6      AEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EHLLP
A7AJ60          AEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EHLLP
A0A016E4F9      AEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGFKS-EHLLP
A0A4Q5CFJ7      AEDILNTLIEIYNEKWIQDKNQIAVSTSQFIGDRLSIIESELGNVDENIAGFKS-EHLLP
A0A108TH71      AEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EHLLP
I8VXH0          AEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EHLLP
A0A412S0N6      AEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EHLLP
A0A412IIJ0      AEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EHLLP
A0A0P0FM97      AEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EHLLP
R6KTP3          AEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EHLLP
A0A139LU87      AEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EHLLP
A0A1C6B3Y5      AEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EHLLP
E2NMQ4          AEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EHLLP
A0A412YDB9      AEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAGYKS-EHLLP
R7DY01          AEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAGYKS-EHLLP
A0A414LGK8      AEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAGYKS-EHLLP
A0A415IPQ4      AEDILNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EHLLP
A0A3E5BRW7      AEDLLNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIENELGHVDENISSYKS-EHLLP
K9DXS6          AEDLLNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIENELGHVDENISSYKS-EHLLP
A0A1M6KFV3      AEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLDVIENELGHVDENISNYKS-EHLLP
A0A1Q6G7L3      AEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLGVIENELGHVDENISNYKS-EHLLP
A0A413H235      AEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLGVIENELGHVDENISNYKS-EHLLP
A0A1M5B2J8      AEEVLNTLISVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDNDISSYKS-QHLLP
A0A255RCT5      AEEVLNTLISVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDNDISSYKS-QHLLP
A0A1Y4GLF5      AEDVLNTLISVYNENWVKDKNQVAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A1H3XSC0      AEDILNTLISVYNENWVKDKNQIAVSTSMFINERLRVIERELGNVDEDISSYKS-EHLLP
A6LE40          AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A4Y1VPX5      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
B3JI46          AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
R6NN15          AEDILNTVIAVYNENWIKDKNQIAVSTSMFINDRLGVIESELGHVDENISTFKS-ENLLP
A0A358R8U0      AEDVLNTMISVYNENWVRDKNQIAVSTSMFINERLGVIERELGNVDENISTYKS-ENLLP
R6WSB6          AEDVLNTMISVYNENWVRDKNQIAVSTSMFINERLGVIERELGNVDENISTYKS-ENLLP
A0A4Q5ENK6      AEDVLNTLIAVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
A0A401LPX7      AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
A0A3A5Z900      AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
A0A3R6EGW5      AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
A0A285TGL6      AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
A0A3A5RFX4      AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
A0A1Q6IUW9      AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
A0A3R6NPG7      AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
A0A413XDP6      AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
K6AP24          AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
A0A662ZYI7      AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
A0A078RYI7      AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
C7XEQ8          AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
D7INX6          AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
K5ZG55          AEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EHLLP
A0A3N2N9B8      ADDVLSTLIDVYKDAWIRDKNEIAVSTSQFINDRLGVIESELGNVDQDISSYKS-AHLIP
A0A3N2NMI0      ADDVLATLIDVYKDSWIRDRNEIAVSTSQFINERLNVIEGELGNVDNDISSFKS-EHLIP
A0A359I8H7      AVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFKR-DHRVP
A0A3N2KA63      AVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFKR-DHRVP
A0A4Q0IMT7      AVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFKR-DHRVP
A0A3B9FAU3      ADDIINTLITVYKESWVREKNMLTIATTKFINERLAIIERELSGIDSDISSYKS-SNLLP
A0A3C1E5L7      ADDIINTLITVYKESWVRDKNMLTIATTKFINERLAIIERELSGIDSDISSYKS-SNLLP
A0A4Q0UAV1      AEDVLNTLLDVYNQRYVIERNQAAQAASQFITDRLNVIENELGDVESNISNYRS-SNLIG
A0A354SN68      LNDILNAVIKAYNKKWVEDRNQVALNTSKFINERLKVIEKDLGLVDEDISSYKS-MNYVP
A0A3N2N595      AQDLLNTLIGVYNEYWISDKNQVAVSTSNFINERLGVIEGELGHVDSDISSYKS-ENLIP
A0A0A2DUD9      ADAILNTLVATYNESWLADRNLSAVSASLFIDERLGLIEKDLGEVDKNITKYKS-QHLLP
A0A3P1ZBJ5      AEDVLKTLIDVYNQNWVEDKNQVAVNTSKFINERLRVIESDLGNVDKNISSYKS-SNLLP
R5FHS9          AEDILNTIIAVYKDRWVRDKNQVAVATSAFIDDRLKKIELELGNVDNSISSFKS-KNLIT
A0A413TW79      AEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKS-RNLLP
A0A3E5E9M7      AEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKS-RNLLP
A0A3E4SK73      AEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKS-RNLLP
A0A415GGC6      AEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKS-RNLLP
A0A413DBH9      AEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKS-RNLLP
A0A495WI87      AEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYKS-EHLLP
A0A354M4S6      AEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYKS-EHLLP
R7DH52          AEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYKS-EHLLP
A0A4Q5E7L5      AEDMLNMLISVYNENWVKDKNQVAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A4P8LP09      AEDVLDMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A4R4GZU7      AEDVLDMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A016CWA4      AEDVLDMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A1C6H117      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A415TAH7      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A0M1W0V2      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A139KA16      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A174VQ92      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A1Q6HCG0      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A1Y4JYM9      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A3A5QW67      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A3A5RQE6      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A3A6BP07      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A3E5E153      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A3Q9IP20      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A412WV15      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A413ICP6      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A414KYB9      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A5B3FWR2      AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
E5WX00          AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
K0X3P3          AEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A3A5Z014      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A1M4YZ07      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A078S3Q8      AEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A069SJV7      AEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A3E5DXI5      AEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A3E5EM98      AEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A3E5F453      AEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
I9T3G6          AEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A4Q5E5M7      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A0P0FQW1      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A5M5C0W6      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A642LZ22      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A5M5YM86      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A642LE65      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A5M5Y0P8      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A642NJ89      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
C3RFN5          AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A3E4SYU0      AEDVLSMLISLYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A6LGY1          AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
K5ZSH4          AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EHLLP
A0A078T2W6      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A3R6EAF7      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A5C6L2P1      AEDVLSMLISVYNENWVKDKNQIAVSSSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A412MJT7      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A3E4WKT5      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A3A5YY33      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A078TAH2      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A1E9CFZ7      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A373FYU5      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A3A5TZ72      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A3A5XBP2      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A3A6MEG9      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A3E4JP35      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A3E4KP40      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A3E4NX82      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A3E4XFU8      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A412RG70      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A412TD37      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A413GAA4      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A414M7I4      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A496BTA0      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A496D2V6      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A4Q5EN83      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A4Q5G1P5      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A5C6KCA6      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A5M5AHM5      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A641WNS6      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
E5UZA2          AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A069SMG6      AEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EHLLP
A0A1Y4PQK7      AEDILNTVISVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYKS-EHLLP
A0A1Y4IH41      AEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYKS-EHLLP
A0A3A6AAP4      AEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYKS-EHLLP
A0A1Y4DYA7      AEDVLNTLIAVYNENWVKDKNQIAVSTSMFINERLEVIEQELGHVDENISSYKS-ENLLP
A0A1Y3X4I9      AEDVLNTLIAVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDENISSYKS-ENLLP
A0A1Y4FNK8      AEDVLNTVIAVYNENWIKDKNQIAVSTSAFISDRLGVIEQELGNVDENISSYKS-EHLLP
A0A355FD59      AEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISSFKS-KNLLP
A0A359CEZ9      AEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISSFKS-KNLLP
A0A353Q7B4      AEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISSFKS-KNLLP
F8X3A5          AEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISSYKR-QNLVP
A0A1M3KVR9      AEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISSYKR-QNLVP
A0A4Y9IJS3      AEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISSYKR-QNLVP
A0A4Q5WS95      GEDILNNLIHDYNAASIDYKNSVARNTISFVDERMRIVQRELNAVEKQIQSYKA-QKGIV
A0A501VZX6      GEDILNTLIYTYNSIAINERNKLAANTLEFVEDRIKLVEEELKDLENKVVKYKS-SEGVV
A0A399SH26      GEAILNLLVHNYNQASVVERNILAENTLAFIEDRMQKVEKELDKLESRVQKYKT-SKGIV
A0A501W1A9      GEDILNSLIKAYQQAALNERNQAVAQTLAFVESRIQLLEKELQGLEEKIVEFRS-TKGAV
A0A0E3ZGV6      GEDILNALIHAYQKAAVTEKNSLVSQTLAFVEERIQLIEKELQNLEDKIVKYKS-TQGAV
A0A1I2N4S1      GEDILNALIDAYLQAAQVDRNALVSQTLAFVEDRIQLIEKELKVLEEQIVKYRA-SNGAV
A0A2T5YE44      GEDILNALIDAYLQAAQVDRNALVSQTLAFVEDRIQLIEKELKVLEEQIVKYRS-SNGAV
A0A1V9FHD0      GEDIMNHLLLAYNQLSIDEQRGTAANTLAFIETRLKSVRHELDSIEGKIQTFRT-NQGVV
A0A4V4H170      GEDILNKLLVAYNRLSIEEKKGTAANTLEFIETRLGRVEKELDSIEHIIQSFRT-DKGVV
A0A1V9F098      GEDVVNKLLVAYNRLSIEEKKGTAANTLEFIETRLAKVEKELDSIEQRIQTFRT-DKGVV
A0A4R2VU64      GEDILNKLLVVYNRLSIEEKKGTATNTLEFIENRLFKVERELDSIEQKIQTFRT-EKGVV
A0A4S8HY23      GEDILNKLLIAYNLLSIEEKEGAAANTLTFIETRLSKVEKELDSIERTVQSFRT-DKGIV
A0A1V9F383      AEDILNKLLIAYHLQSIEEKKGMAANTLEFIEARLLKVERELDSIESVVQTFRT-DKGVV
G8TRZ6          GEDILNRLLTDYTQQSIDEKQDQATNTLNFIEVRLGKVERELDSIESVVQTFRT-DKGVV
A0A543WA52      GEDIINRLIYNYNQKAVTDRNALASSTLAFIEERMGKVGTELAELEMEIQKYRS-SQGVV
A0A1M5BA90      GENILNTLIQAYYRSAAKEKNVLAANTLSFIEGRISNVAKELDSIENRLQKFRN-QKGVV
A0A512B879      GKEILNLLISEYNQAAINDKNLLTSNTLSFVETRIKYVVRELDSIENQLRKFKT-DKGVV
A0A559PPI3      GEDILNGIIAAYNQNGIEDKNILAANTMKFIEARIRNIGNELDTLESENEQYRS-SKGVV
A0A1T5CS78      AENILNRLIYQYNQKIIKDQNELALSTMTFIDERIENVEEELDELEYKIQQYKS-NEGVV
A0A0Q9Z8F1      AENILNRLILEYNRKIIKDQNELAASTMTFIDERIENVEAELDELEYNIQEYKS-NQGVV
A0A2N0U0M7      AENILNRLILEYNRKIIKDQNELAASTMTFIDERIENVEADLDELEYKIEEYKS-NQGVV
                                                                            

A0A1T5MMH4      DLQEDLR-----KTIESINKIDS-----QRYELSRRL------------DE---------
A0A2W4R1L8      NLDEELA-----NTIRLIHEIDS-----QRYQLTTRI------------TG---------
A0A2E5CV79      SSDGEAS-----SVARQISALEN-----DIYNTRSEL------------NM---------
A0A2D4ZVH1      AVDPQTE-----EIISTIANLEV-----EKQKLEVGL------------VA---------
A0A0K8QSK7      DLSAQSQ-----QLLQQMSELDN-----QRVVLESQL------------KY---------
A0A1V6CN82      DIGSQSG-----QLLSEMSELDS-----KKQELETQN------------KY---------
A0A1M4XZ45      DISMQSQ-----QLLEQMRDLDQ-----QRVALETQN------------KY---------
A0A399D319      DISMQSQ-----QLLEQMRELDE-----ELVTLETQN------------KY---------
A0A1M6GR99      NIDEQST-----RLAQQRLDLQN-----QLAELMTQK------------RY---------
A0A1M6TTV4      DLSRDLN-----NTIQLLNQLDS-----QRFKIRNQI------------TA---------
A0A4Q8RX32      DVGMKAS-----QIYDNLNALMA-----EKEEKESHL------------QY---------
K0X1U5          DIDAEAK-----IILEANSQYRK-----LLLEAETQY------------SI---------
R5EXK3          DIDAEAK-----IILEANSQYRK-----LLLEAETQY------------SI---------
A0A401UAP7      DLTADMS-----RTVEQINALDT-----SSFTINSRL------------RL---------
A0A1W2GF52      DLSSDLT-----KTIALLNELDS-----QRYNLREHL------------AE---------
A0A2G5L7B8      DLSQDLN-----YTIRLLNQLDS-----QRFNIRTQI------------AA---------
A0A523GAC0      DIQTDLS-----NTIKAITVLDS-----QNVILEKKL------------TG---------
L8JW09          DLNEDLK-----RTIETINALDS-----QRFQLTKRI------------QA---------
A0A5C7MX19      DKNELQT------MSSEVSSTNI-----IIRMLTQDI------------LS---------
A0A364XUP5      NLDEDLK-----RTVTAISRLDS-----QRYEFASRM------------QE---------
A0A1M5RLA9      NLDEDLK-----KTVSAINRLDS-----QRYELTNRI------------VE---------
A0A385SFR9      NLDEDLK-----KTVSAINRLDS-----QRYELTNKI------------VE---------
A0A5M4A9J4      DLSYQSQ-----QLLDQMVSLQE-----QKEQLSTQK------------SY---------
A0A5M4B1C7      DISYQSQ-----QLLDQMVTLEE-----QKEQLTTQQ------------AY---------
A0A0D3LFR6      NLNKDIS-----NTILLLESVDS-----QRVATRRQL------------NN---------
M7N6D4          NLAGDIN-----RTIIMMEAIDS-----QRVQLRKQL------------SS---------
A0A1Q3ZMZ7      NPDNVAD-----QLIQKIDEANE-----ESYLANNNL------------ST---------
A0A2D8JJW3      SSDGNAN-----EHVEQFLKLKS-----ERVAQQLKL------------DD---------
A0A2W2AFF7      DIGEESK-----ILLGSTSDYMK-----QLTQSEVQL------------SI---------
A0A2N5YXE2      SNTETLLFNKTNLYTTKMSELES-----KLLNVDFEI------------MT---------
A0A2W1NDY9      NPALYKE-----NLLDQIDQLRT-----EVLQADLEY------------DL---------
A0A5C8AQR5      DPEGITS-----ELNGNISKLKD-----QLYTIEDEL------------ST---------
A0A1G0CI31      DPETDGL-----SLTQNMDQFQD-----QLFMLEEER------------SA---------
A0A556N0M0      DPENTNG-----SLTENMDKFQD-----MLFELENEL------------AT---------
F2IKD6          DPEGTGG-----SLSENMDKFQD-----ILFDLENEL------------TT---------
A0A1I7BM74      DLENIES-----NLSAKVNTLEN-----ELEKLKIEH------------QD---------
A0A2G2FJ17      DPENLGE-----SIATKLEKYRF-----DKFELQDEL------------NT---------
A0A077ENE7      DVATAGS-----LYLNEKNQYKS-----EGTKIETDI------------RL---------
T0NN57          DVEAAGG-----MYLSESNQYKT-----EKTKIETDI------------RL---------
X5K347          DVEAAGG-----MYLSESNQYKT-----EKTKIETDI------------RL---------
A0A2I0QZ80      NPEHLSG-----SISSKIEFLRT-----EERNIIEEI------------RV---------
A0A3E1F1A3      NPEYLTS-----SVASKMEKLKA-----EENNALEEM------------RV---------
A0A2U2XBJ3      NPEQIAA-----NTSQKIEKLRT-----EIRQGMEEL------------RV---------
A0A4Q4KU94      NPEFIAS-----TTSQKIEILKL-----EERNGLEEL------------RI---------
A0A2U1FKU2      DITTDVG-----TYLKNSSDLQK-----DQLIVERNL------------SL---------
A0A0A2F954      DISTDVG-----AYLKSSADLQK-----DQLIVERNL------------SL---------
A0A0A2FW91      DISTDVG-----AFLKSNADLQK-----DQLVVERNL------------SL---------
A0A2D2N2N1      DISTDVG-----TYLKSSADLQK-----DQLIVERNL------------SL---------
Q7MWZ2          DISTDVG-----TYLKSSADLQK-----DQLIVERNL------------SL---------
T2NDT6          DISTDVG-----TYLKSSADLQK-----DQLIVERNL------------SL---------
W1R7P9          DISTDVG-----TYLKSSADLQK-----DQLIVERNL------------SL---------
A0A1R4AFZ0      DISTDVG-----TYLKSSADLQK-----DQLIVERNL------------SL---------
A0A1R4DVZ7      DISTDVG-----TYLKSSADLQK-----DQLIVERNL------------SL---------
A0A5M4B212      DVSYQSQ-----QLLDQLVKLED-----QKSLLETQH------------QY---------
A0A1T5K9D4      DANADAA-----EYLSESRSYGS-----DISQVETNL------------SI---------
A0A3D1KEX9      DFTENAR-----TYLQQSALSQQ-----ELNKTQAEL------------SV---------
A0A358Y7S2      NIEKIGD-----NLSENLTNYSK-----VILELEEEL------------ST---------
A0A1X7J248      NPSDDVS-----RLIAEMVKMDS-----ILYGINYQL------------GE---------
E4TQD2          NPSQDVS-----RLISEMVSMDS-----ILYGINYQL------------AE---------
A0A2J6HHN3      LEDKTGL-------KSRMRELDR-----LISKTKYEK------------EV---------
A0A1Y3WMT8      DIDTEAK-----IILEANSEYRK-----LLLEAETQY------------SI---------
A0A1Y4GQU1      DINSEAK-----IILEANSQYRK-----LLLEAETQY------------SI---------
A0A1V5W8T5      GSIFDDK----AAIQNALMDNSQ-----QIKQYDTQL------------QS---------
A0A2T8HKA9      DVNEAAG-----MYITESREYLN-----ASRELETQL------------SL---------
A0A3B8INU3      DLSSDLQ-----KTIQQIWTLDT-----LLGTARSKQ------------KS---------
A0A414ZBF2      DVTSESA-----LLLQNSSRLGG-----ESLSIENEV------------VM---------
A0A1Q3Q573      SDDNSSQ-----GILTSANALQQ-----ALIASENQL------------YL---------
A0A662BAY3      NISIQSE-----QLLDQVNELEK-----EKVVLETKN------------KY---------
A0A4U3L369      SPDVQAQ-----LMASTYDENFK-----LGNQLELQL------------AI---------
A0A357YNR3      DIAAQAN-----LYNNQMANVGQ-----RRMDIESQL------------SI---------
A0A5E8AX52      NIQTDLG-----RTIVLLQSLDS-----QRYDLQNKL------------TN---------
F4KK08          DIQAEAQ-----EYIKGSSEVKT-----RLVELNNSI------------SI---------
A0A496LCF9      GENNTTI------LTSKMDELQQ-----VGKQIRLRD------------EY---------
A0A5P2G2A9      DLEAQAQ-----AVISSSSEYEK-----QLNQAQVQL------------AI---------
A0A419VXB7      DLSQEAT-----LVTGKLSNLDT-----KRSMAEMQL------------EY---------
C3J7R8          DIQQEAR-----SYITGTAEFAR-----QMTEVNNKL------------AV---------
A0A0B0BTJ4      DIISETK-----LSLETSRQYED-----DLLKTEIQL------------EM---------
A0A3B9CNN6      DIISETK-----LSLETSRQYED-----DLLKTEIQL------------EM---------
R5X290          DIISETK-----LSLETSRQYED-----DLLKTEIQL------------EM---------
A0A1Q6E6I7      DIISETK-----LSLETSRQYED-----DLLKTEIQL------------EM---------
A0A1G8BVM8      DIPSVSS-----MYLDASSRINA-----EALGLENQL------------SI---------
A0A2G2F510      NPEEAAS-----NITDNISKLQD-----QLFLIEDEL------------NS---------
A0A316JZ08      DPELSGG-----ELNEKLNDLEL-----QLSDIDKEV------------AS---------
A0A1I1FXP9      DVRDQVA-----EMITHVEKLKK-----DKIELEIQN------------SL---------
A0A3N4H5N3      DIGLDSR-----IFLESTQEMRK-----EISDISSKI------------EI---------
A0A2P8EAX2      DIGLDSR-----IYLESTASTSK-----EISELSNKI------------EI---------
A0A4V2F6N9      DIGLDSR-----IFLESTASTSK-----EISELSNKI------------EI---------
A0A3B9FXJ0      NPSIAEQ-----NLMTKFNELDQ-----NKLDVQLEE------------RS---------
R5GSU5          DFEKSAQ-----SALEEQRTLRL-----SMLQAEVQL------------SV---------
A0A2A3UE91      EKDKIIT-----TELMRYSTIED-----QMLQAQMEE------------TL---------
A0A0A2G557      NIASEAE-----VYIESSKEITK-----QTIEVNNAL------------AV---------
A0A2N2WFW8      TLDRSSL-------QARLFELDN-----LLAANISEL------------ES---------
A0A1F3IU95      SLDRTAL-------QSRLFELDN-----LISENSSEV------------ES---------
A0A3D0VUF6      SLDRTAL-------QSRLFELDN-----LISENSSEV------------ES---------
A0A1T4PT95      NIESEAE-----IYIESSKEITK-----QTIEINNSL------------AI---------
A0A4P5TMD1      STDSKQQ-----EILTALKEINA-----NEEGLNLDE------------KN---------
A0A651GU15      DLNRISE-----FYLSYFQQYDD-----RQMELEYEE------------KL---------
A0A3Q9FR88      SYMEAGP------IVGNIQELEK-----SLSSLKNEK------------KK---------
A0A553GEX3      SYMEAGP------IVGNIQELEK-----SLSSLKNEK------------KK---------
A0A150ADJ9      SYMDAGP------IVNNIQELEK-----SLNELKGER------------KK---------
A0A1B1FWQ4      SYMEAGP------IVGNIQELEK-----SLNSLKSEK------------KK---------
A0A1S1Z228      SYMEAGP------IVGNIQELEK-----SLNQLKSEK------------KK---------
A0A2A4PYG9      QQ-----GDFITVYVXKLDNIEN-----ELMDLELET------------SM---------
A0A1F3K695      ISESELNTLSLNLYASKIEEIET-----EILNLDFEL------------IT---------
A0A353KZR1      ISESELNTLSLNLYASKIEEIET-----EILNLDFEL------------IT---------
A0A2N2WYB5      LDKYPINGSPFPIFTAKISEFED-----ELINIEFEL------------VT---------
A0A1F3K4G0      TDQFKAEGSPFPLFTTKISELED-----ELINIDFEL------------VA---------
A0A356H8Y3      TDQFKAEGSPFPLFTTKISELED-----ELINIDFEL------------VA---------
A0A351HSA6      TDQFKAEGSPFPLFTTKISELED-----ELINIDFEL------------VA---------
A0A1F3Q014      NT--DIENT---AKTTRLNALDD-----QIISLELEE------------NV---------
A0A2A4YXP3      SM--DRSSS---YF-DRSNRLEN-----ELIDVDLQQ------------SV---------
A0A2D5KD44      EI--DQFSK---VYIERMNQIDQ-----AQVELEIEI------------AT---------
A0A1F3R158      DI--DKFSS---LYVDRVNKLEN-----QLVDIDLQK------------NV---------
A0A2M8ADX2      DI--DKFSS---LYIERVNKLEN-----QLVDIDLQK------------SV---------
A0A1J5B2H0      TIKLDVVPT---LF-SRQNELEN-----QFSKLELEE------------NM---------
A0A1V5N756      LI-FQPLPE---VY-SIIKEFNS-----EILKLEIEI------------AK---------
A0A1F3SJM1      DPESISG-----TITENISKLND-----ELYRLEEEQ------------LS---------
A0A2G2EB96      DPENAGI-----SISDNVNKMQD-----QLFELEEEY------------NG---------
A0A2G6PRA9      DPENVGV-----SINENANKLQD-----QLFELEEEY------------NG---------
A1ZKR2          DVNKKLE-----ESVKEIEKLIK-----EKIVFNEQL------------AA---------
A0A1Q3GX01      DVNEKLE-----KSVQEIEELLK-----QKLALSDEL------------AG---------
A0A349DQI4      NINEKLD-----KSVQEIEQLIK-----KKLKFTDEL------------AG---------
A0A2N3IIZ0      NIEGKIS-----ELVNKIQQLTE-----ERYKINAKL------------QT---------
A0A497D5Z2      NISLQTE-----QLLDQINDLDK-----HRVMLETKD------------KY---------
A0A662B170      NISLQTE-----QLLDQINDLDK-----HRVMLETKD------------KY---------
A0A2A5FYT6      GNDGFTG-----IYLERLNLLEN-----EVINLELEE------------SV---------
A0A2E6SYP1      TKDDFDY---NQLTRDLKGKDEN-----EKIELQASL------------SD---------
A0A2E5RLE8      SEYGTDY---GKLALDLAAKDQI-----EKTKTESTL------------ND---------
A0A2E7TQF6      SEYGTDY---GKLALDLAAKDQI-----EKTKTESTL------------ND---------
A0A2E6GVY9      QEIKTDY---GKLALDLASKDQI-----EKTKLETTL------------ID---------
A0A350JJ90      KKKGIAA-----TYITRVNVLEQ-----KKVELELKI------------SL---------
A0A3M1CDV2      STDNNSA--LSTSQSQIYSSVQE-----QLLQIELNE------------KL---------
A0A522EYA6      EVKNMPD-----AGSARLNSLED-----ELISLELRA------------NV---------
A0A4P5U6G4      STESKIS-----EILTALNNIKQ-----KQIMLNIKD------------NM---------
A0A2E2TFD1      GSSELTG-----IYLDRLGNLEE-----ELIKQELEQ------------EI---------
A0A2E4ELE6      KTENFTE-----MYIDRLALLEE-----ELIKLELEK------------DI---------
A0A2E3XZI5      NKTTLIE-----NQTKRIEEIEK-----ELTVINSNI------------NL---------
A0A2M7NLQ9      SQKPEEYQALVQNILNDIRELQE-----KRVEMDNEL------------KL---------
I4AFR0          SQNPQEYQSLVQNILNDIRDLQA-----KRLDIDNEL------------KL---------
A0A2N2Y3E5      TDDEKDL-ATYRSVIERITRVES-----DLEGIKVEV------------DT---------
A0A2D9D7T6      NPDNTTV-----ELSSRINSFKT-----RQLENEEEL------------VT---------
A0A1F3PPL5      PNSDLNL-SAFPIYTSKIHEFDE-----EIMNIEFEL------------VT---------
A0A357QK06      PNSDLNL-SAFPIYTSKIHEFDE-----EIMNIEFEL------------VT---------
A0A662AEA4      YNILSNQ-NSAPIFTTKITEFQN-----EILNIDFQL------------VT---------
A0A0S2HYK8      SEALERT--PFPIFTAKIEEFEE-----QITTLDFEL------------IT---------
A0A2N5ZWN6      SDAFERS--PFPIFTSKIEEFSE-----QITQLDFEI------------FT---------
A0A0F2NS19      NPNEVSS-----IYLDKINRFEN-----QLIDIDFQT------------SV---------
A0A2A5H8X6      NPNEVSS-----IYLDKINRFEN-----QLIDIDFQT------------SV---------
A0A2H0GAU8      NPQEFSS-----IYLDRLNRFEN-----QLIDIDFQR------------NV---------
A0A2M8FTK1      NPQEFSS-----IYLDRLNRFEN-----QLIDIDFQR------------NV---------
A0A2A5B3B0      TLDR-SS-----IYFDRSSKLEN-----DLFNIDLQK------------KI---------
A0A5C6RXM7      GADA-TQ-----KYFDRSTKLED-----QLIDIELQK------------NV---------
A0A2E0FJ09      QVEGMTD-----SYLSRIEEMES-----ELVKLDVDE------------EI---------
A0A1F3FZ62      DRLTDMK--SPPTYFSRVNDLQS-----QLLNIEVEE------------KM---------
A0A1F3K211      DRLTDMK--SPPTYFSRVNDLQS-----QLLNIEVEE------------KM---------
A0A1F3KLL5      ALQNKLS--PLPLFTAKINELQS-----EILKTDFEL------------AT---------
A0A359D1M1      ALQNKLS--PLPLFTAKINELQS-----EILKTDFEL------------AT---------
A0A2E7CT70      NVNSSLM--ANKTQLSKISEVEN-----KLVQNQVDI------------TL---------
A0A2D5V560      KXNXXLL--NISGIKENXEKIEI-----EIAKXQIDI------------DL---------
A0A2D7K5A8      KFKNELI--GITGLKDKAEKIEK-----EIVKIQLDI------------DL---------
A0A2E1XQ82      KFKNELI--NINGFQDKAEEIEK-----EIVKIQLDI------------DL---------
A0A1V6I2U9      NIKDEYLFNKSNIYSSQISDIES-----KILNVDFEI------------MT---------
A0A1F3C1M2      LTNQDNV-KPISIYLTKFTEIET-----EILNIEFEY------------ST---------
A0A1F3DS87      LTNQDNV-KPISIYLTKFTEIET-----EVLNIEFEY------------ST---------
A0A2H0B957      GDKESST-SNVNRYANLLTKIEE-----DIDITDIEI------------SS---------
A0A1F3CFW6      NDNDSKE-TGTERYSILLSKIEE-----ELDNVEIDI------------SN---------
A0A2M7E2T8      NDKDSKE-TGPERYSILLSKIEE-----ELDNVEIDI------------SN---------
A0A2M7NC69      NDKDSKE-TGPERYSILLSKIEE-----ELDNVEIDI------------SN---------
A0A5C8A5B4      NTASTQD-----ALFQERSRLED-----ERSNILKRR------------NY---------
A0A4Y9ITE2      DLVADAQ-----YIFTKKGTIDE-----ALVTAETEY------------EI---------
A0A5M8NYX7      DLTAEAQ-----LFLTSQSEYSK-----KIIELQNQM------------SV---------
A0A3D5KRY6      DLGREAS-----LVVENLKKVEA-----DRANLDLRL------------ES---------
A0A1V5IPN7      EISETTR-----KWIEQTTQVES-----QYEAALTEQ--------AVKAKT---------
A0A0E3V905      DLSVQAQ-----TFLQTVQQNDA-----LMNQVQIQL------------AT---------
A0A553ETH6      DLNEDLK-----NLILIINDIDS-----QRLSIK---------------NK---------
A0A640Q161      NIDGVVG-----LAAEELEQLSK-----QLLDAQTAL--------KLNAVI---------
A0A640QU49      NIDGVVG-----LASDELEQLNK-----QLLDAQTAL--------KLNAVI---------
A0A1Q3PII2      DATEDGR-----QILERFHANAS-----EEKELAVRM------------KI---------
A0A351BXT2      LLDAQVK-----NVVENISVLEA-----QQNAARIEL--------NSKQEE---------
A0A2K8Z965      DLSVQAQ-----SFLETVQQNDA-----SLIQVNVQL------------AA---------
A0A418M8U8      DLSTQAA-----SFLQAIQQNDG-----LLNQVNIQL------------SA---------
I2GTA4          DLSTQSA-----SFLQAIQQNDG-----LLNQVNIQL------------TT---------
A0A2K8ZAJ2      DLSVQAE-----KFLTTVKDNDL-----QLNDVNMRL------------GA---------
A0A368JPA3      GIGSGAQ-----SLLSSLQSNDA-----QLNRVAIQL------------ST---------
A0A5N1JI29      GIGSGPQ-----SLLSSLQSNDA-----QLNRVAIQL------------ST---------
A0A3P1BT12      GIGSDAQ-----ALLSTLQNNDA-----QLNQVAIQL------------ST---------
A0A3P1CI15      GMGSSAQ-----ALLSNLQSNDA-----QLNQVAIQL------------SS---------
A0A4R8CUK1      GMGPGAQ-----WLLDTLQKNDA-----QLSQLAVQL------------SA---------
A0A3D0MYJ7      DVQQNVS-----ELLGKSSEVEN-----IKNLGKIEL--------NAVEIQ---------
A0A662AH13      ALDDQAK-----ALIDILSTFEA-----QRDATFIEM--------VATERT---------
A0A5C7QA01      DVSKESE-----LYLSQSITLET-----KK------------------------------
A0A3D3LS70      FLDDQAK-----SIVEQIATLEA-----QKNASEVEL--------ITSRRT---------
A0A1G1TM36      DVASQSQ-----IVLENTQANDT-----RLNTAQVQL------------AV---------
A0A1G7ZF38      DMAEDGR-----QALQQYHSNAS-----DEKQLAMHL------------KI---------
C6VS52          DIAEDTR-----QALQKLAANTS-----EEREWATHL------------KI---------
A0A0P7X1V8      QLDAQAQ-----QLIETLSTLEA-----ESQGIQVKL-----------------------
A0A3B0C2S4      YIESDVD-----FSLQRKAVAQD-----EVTNLETQI------------SL---------
L8JI02          DISYTAE-----NLSKNLDRLES-----EKADLQVKL------------KY---------
A6EBM4          DISVTSE-----HTLDKVSDLES-----QQSILRIQL------------IA---------
A0A416GA42      D-GTQSG-----LYLQRADQFQN-----EAVQLQTEL------------EL---------
A0A4R5DL69      DMAEQSR-----LLLANSSLYDK-----EKLQVNLEL------------DM---------
A0A1T3IYP5      DIATAGG-----TFLTEKNQYRS-----EGAKVETDI------------RL---------
A0A1M4YED3      DISEQGK-----EFLRTVSDNER-----QATSINMQV------------ST---------
A0A3P1Z8V4      DLTATAT-----AMTQQSIQARQ-----KTIELETEL------------SV---------
A0A2N3U785      NLDSDAR-----MYVEKAADYNR-----QISEWQVQI------------DV---------
A0A0E3ZG78      DVNIQAS-----NYLNIASGYNK-----QLSDWAIQI------------EI---------
A0A1I6BRK6      DIAAQAT-----SYAEQATNYDS-----QIAEWATQS------------EV---------
A0A243WAB1      DISTQAS-----DYTAQASDYNK-----QLSEWGIQI------------DV---------
A0A126PFG0      DIASQSK-----VYLENAQANDS-----RLNEAQVQL------------AV---------
A0A3M1N7Z3      RVETKED-----ILFMEARKDRALSLYQDLNKLDKSL------------SVEYLNAFSEK
A0A2H3NSN0      IDGQDGN-----RVATDYVEMMG-----QRDQLEFQL------------QE---------
A0A2P6C324      TEGLDGQ-----NVAAEYAELQS-----QRDALTFQL------------EQ---------
A0A1M6XHU0      RLGPQGE-----RLVAEVAQLEA-----QRDAARFQL------------EQ---------
A0A5S9C8G0      RLGPQGE-----RLVAEVAQLEA-----QRDAARFQL------------EQ---------
G2SF81          RLGPQGE-----RLVAEVAQLEA-----QRDAARFQL------------EQ---------
A0A5S9EYW1      RLGPQGE-----RLVAEVAQLEA-----QRDAARFQL------------EQ---------
D0MHQ9          RLGPQGE-----RLVAEVAQLEA-----QRDAARFQL------------EQ---------
A0A4D7K1D4      DLQKDMA-----ETIQFLNQLDS-----QKRALKIYQ------------IK---------
A0A3C1ITV0      DMNAETA-----QVTQESSKYSE-----QAFLANNQL------------AV---------
R7HN19          DMNAETA-----QVTQESSKYSE-----QAFLANNQL------------AV---------
A0A060RD97      DFSAAAN-----MYMQTSNEIRR-----DAAEVENQI------------AM---------
A0A0D3L8Q3      NVGTEAQ-----LYLQGRTGYDQ-----QLSEYELQL------------EI---------
A0A5B6TJH8      DVNTQAS-----DYLAQASDYNK-----QLSEWAIQI------------DI---------
A0A519U664      DISSQAS-----GYETQASNYTQ-----QLAEWATQI------------DL---------
A0A519UDD1      DVSTQAS-----VYTSQASTYNT-----QLSELAIQI------------DV---------
A0A519MA34      DIASQAS-----GYETQAASTTQ-----QLSEGATQI------------DL---------
A0A519UCX0      DITSQAS-----DFQAQNSTTTQ-----QLSEWATQI------------DL---------
R7PCR1          DFQKSAE-----AFLQQQGTARN-----LALDYETQL------------SV---------
A0A350IHV0      DIASISE-----AYLKESTDYSA-----KSFEVNNQL------------AI---------
A0A1G9E2A9      SISSTIG-----QTLEQIKNLRF-----ERITYEQQL------------PA---------
A0A098LL25      DVKQDFG-----KSGIKIEELEK-----EKQVLKSRI------------SM---------
A0A2T2YJE8      DVRADVS-----KSITKLEELNK-----ERINLHLQI------------SL---------
A0A127B287      DVKAGLE-----GAMTQIQELEK-----EKYDLRFRN------------SL---------
A0A3M9N829      DIRSSFQ-----EAITEYRELEQ-----KKLEQRFLL------------TL---------
A0A0P0CSF9      DLKANFQ-----EALAQVQELEK-----EKLELRFQL------------SL---------
A0A5M8QQB8      DIKANLQ-----EALSMVQELEK-----EKLELRFQL------------SL---------
A0A3M9MNC3      DIKSNLQ-----EALAQVQELEK-----EKLELRFQL------------SL---------
A0A5B6TAX2      DIKSNLQ-----EALGQVQELEK-----EKLELRFQL------------SL---------
A0A5N1IQ33      DVKNDMG-----TIVEQTAEMQK-----EREELRLKI------------NA---------
A0A512AYT3      DIKAEVG-----TQLAKLETLNN-----ERRELDIQI------------GL---------
A0A5M6CYN7      DVKADVS-----TQISKLEELGK-----ARLDLSMRI------------SL---------
A0A369QP10      DVRADVN-----KQMTKLEDLNK-----QRVDLRMEL------------SL---------
A0A126PDF2      DVKSEVA-----ALASRGEDLEE-----QRLKLNQNL------------VL---------
A0A2Z3GKA1      DVRSEVA-----ALAAKGESLEE-----QRLKLNQNL------------VL---------
A0A502GZP7      DVKSEVA-----DLAAKSEDLEE-----QRLKLNQNM------------VL---------
A0A519SBU8      DIKSEVS-----AIKGQMESLLK-----ERLELEQKQ------------RL---------
A0A4Q3JNZ3      DVKGDMA-----TIRGNLEKQQD-----ERLKLQDKL------------RL---------
A0A519Q9V3      DVKGDMA-----TIKGNLEKQQD-----ARQKLQDKL------------RL---------
A0A0M3RW20      DVKADVG-----TLTEKLAEQEK-----ERIELQKRL------------DL---------
A0A495VFX4      DVKADVG-----TLTEKLAEQEK-----EKIELQKRL------------DL---------
A0A1S9B3W0      DAKSDLG-----AITQELSELQK-----EREKLLRKA------------TV---------
A0A1W1VRL3      DVRADAA-----TVNGKILAQEE-----KRQNLLQKQ------------GL---------
A0A1M6R305      DVKATIG-----DLTGRLEKQEE-----ERLRLVEKI------------RL---------
A0A4Z0PHK3      DVKSELA-----LITGKLAKQEE-----ERLKMVEKA------------RL---------
A0A2M9B9H9      DVKTEVA-----GITEKLAEQEE-----VRLKLVEKA------------RL---------
A0A4Z0QCY9      DVKGEVS-----AITEKLAKQEE-----ERLKIVEKA------------RL---------
A0A418R9X5      DVKSEAG-----LVTNQLNMLES-----QQEELQEQA------------DM---------
A0A428JSJ3      DVKSEAS-----LINNQLTTQEA-----EQEKLQEEA------------DM---------
A0A428KI59      DVKSEAN-----LVTNQLTAQEL-----EQEQLQEQA------------DM---------
W8F1I6          DVKSEAS-----LVTNQLTAQEL-----EQEQLQEQA------------DM---------
A0A246FQC0      DVKGDVG-----QITGLLMELEE-----ERTKLQQQA------------DM---------
A0A372E5P8      DVKGEVS-----QLTGLLQTLEE-----ERAKLQEQS------------EM---------
A0A1H3EMW1      DVKGEVG-----TITGLLQELEV-----ERAKLQEQG------------EM---------
A0A1H9ZSN3      DVKGEVG-----QITGLMQELEE-----ERAKLQEQG------------EM---------
A0A5N1J2M4      DIKSDVS-----ASRLKIEELMK-----ERQALRLKI------------AL---------
A0A519S476      DITTEVE-----GLKTRLEKQQD-----TRFELEGKL------------RL---------
A0A4Q3JRW8      DVKGDMA-----SIKGNLEKQQE-----ARQKLQDKL------------RS---------
A0A519M923      DVKGDMT-----AIKADLEKQQE-----DRQKLQDKL------------RL---------
A0A4Z0ENW1      DAKGELG-----IITDKLEKIEE-----DRLKLEQKL------------TL---------
A0A519UDB4      DAKGQLG-----DISEKLLEIQK-----GRSELEQRL------------GL---------
A0A3S0QKV1      DAKADVG-----TLTTQLSDLRK-----ERETLQRKA------------SL---------
A0A328BL48      DAKGDLA-----TITTQMQELAK-----QREQILRRQ------------GV---------
A0A5R8WLY4      DAKGDLT-----AITTQLQELAK-----QREEIQRRQ------------GV---------
A0A1I5WSL8      DTRAELE-----AISGKMEKLEA-----ERLKLTDKM------------IL---------
A0A0U3JVM7      DSKGEFS-----AITEKLEKLEA-----DRLKLTDKI------------NM---------
A0A1G1SSV2      DSKGEFE-----AISGKLEKFET-----ERLKLTDNI------------AM---------
A0A1G1SXV7      DSKGEFE-----AISAKLEKFET-----ERLKLTDNI------------AL---------
A0A0W8EDI5      DVKSDLA-----TITEKMEALEE-----EKEQLLRKA------------GA---------
A0A3B7RBP8      DVKSDVA-----NIAEKMAALQE-----ERVELQRKA------------GA---------
A0A3R9P8H7      DVKGDVG-----QIMTALKEQET-----EREKLQEQV------------DM---------
A0A238WIA7      DAESELG-----TVTSAITTQQE-----ERQELQEQI------------NL---------
A0A212UCJ7      DAETELG-----SLTTILTTQQE-----ERQKLQEQL------------TL---------
A0A4Z0MQE1      DAESELG-----SLTTLLNSQEE-----ERQKLQEQL------------SL---------
A0A4Z0PCF4      DAESELG-----SLTGTLKEQEK-----ERQELQEQL------------TL---------
A0A5D6VDG1      DVRSGVQ-----TITDQLDEQEK-----EQQALQRRL------------EL---------
A0A243WHR7      DVRGDLA-----SISDKLLEQEK-----ERLQLQQQI------------DL---------
A0A5B8A0P6      DVRSDVS-----TVIAKLAQLEE-----DRRKLDEKS------------RL---------
A0A076HRT9      DVRASIG-----EITARLEKQEE-----ERLKLSEKI------------RL---------
A0A4Z0PVM7      DVKGEVS-----VITDKLAKQEE-----ERLELEEKA------------RL---------
A0A1M6DHW8      DVKADVA-----AITEKLAAQAE-----EQQKLAEKA------------RL---------
A0A4Q5LC61      DVKADVA-----AISEKLAEQEE-----ERLKLTEKA------------RL---------
A0A2A8CVM9      TQGIGGE-----RLVAEYTELTA-----RRDALRFELEQEEEALRLLRDQL---------
A0A3C0ZQC7      SLDDEAK-----KVIDQLATLEA-----QRDAADIEL------------QA---------
A0A2E3R1D0      ALQEETS-----RLVDQIATLDA-----RRDQAQVNL------------VT---------
A0A2T2USC0      ALDQETQ-----QIVQQISEMQA-----RRDELQIEL------------DM---------
A0A2T2V0F3      ALDQETS-----RIVDQIANLQT-----RQDELRIEL------------DM---------
A0A2T2S682      SLDQEAS-----RLVQQLSELEA-----RRDELRIEL------------DM---------
D5H561          SLDQRQG-----SLTSRIAETES-----SLEQARIEL------------RM---------
A0A2H3NWA9      ALDEETS-----STVSRITSLES-----ERAQLRIEL------------EM---------
A0A2A8CVB6      ALDQESG-----RIVSDIAQMEA-----EQRQLQIEL------------QL---------
A0A2P6C1S6      SLDQETG-----RVVQQISELEA-----QRAELRIEL------------DM---------
A0A2T2UTM4      SLDQETG-----RVVQQISELES-----KRARLRIEL------------DM---------
R5RVP0          DIRSLSA-----AYLEESTEYKA-----KSFDVNNQL------------AI---------
R6A0L2          DFDKTPQ-----AMIDESSTARQ-----QSLQAETQL------------NV---------
R7LG80          DFETTAQ-----SITQESSLARQ-----KTLEAETQL------------NV---------
A0A2L2WX98      DFEQSAQ-----MYLTESSAARK-----QRLELETQV------------AV---------
A0A285T4L1      DIGSLAG-----QYMGEAQTYSA-----DALEQETQL------------KL---------
G5GD56          DFQQAAG-----TVTAQSADARQ-----QALQLETQL------------SV---------
R5KD55          DVEKAYS-----LSMERADKNSA-----ILLDLNTKL------------SV---------
A0A174QNT3      DINANAN-----IYLQEGSKAKE-----ESIQLEAQL------------NV---------
A0A4S2FGS1      DINSNAN-----LYLQEGSKAKE-----ESIQLEAQL------------NV---------
R9I0H0          DINSNAN-----LYLQEGSKAKE-----ESIQLEAQL------------NV---------
K5BUT9          DMSANAT-----QYLAESSKVKE-----ESAQLETEL------------SI---------
A0A174FPA3      DMSANAT-----QYLAESSKVKE-----ESAQLETEL------------SI---------
R6S9Y6          DMSANAT-----QYLAESSKIKE-----ESAQLETEL------------SI---------
A0A642LIH6      DMSANAT-----QYLAESSKVKE-----ESAQLETEL------------SI---------
C9KX15          DMSANAT-----QYLAESSKVKE-----ESAQLETEL------------SI---------
R6DAG6          GSEGNGT-----QFLAESSRMKT-----ENLQMETEL------------SI---------
A0A3L8AAP1      GSEGNGS-----QFLAESSRMKT-----ENLQMETEL------------SI---------
A0A4S2AYX2      GSEGNGS-----QFLAESSRMKT-----ENLQMETEL------------SI---------
A0A4Y9H477      GSEGNGS-----QFLAESSRMKT-----ENLQMETEL------------SI---------
A0A0E2M2Y7      DISTDVG-----AFLKSNADLQK-----DQLVVERNL------------SL---------
A0A0K2J6Z0      DISTDVG-----AFLKSNADLQK-----DQLVVERNL------------SL---------
B2RKZ8          DISTDVG-----AFLKSNADLQK-----DQLVVERNL------------SL---------
A0A212GC82      DISTDVG-----AFLKSNADLQK-----DQLVVERNL------------SL---------
A0A254MU12      DISTDVG-----AFLKSNADLQK-----DQLVVERNL------------SL---------
R6CQ93          DIGSLAG-----RYMGEAQTYSA-----DAMEQETQL------------KL---------
A0A3D1NQW3      DIVSEAE-----QTITESAQYKT-----DGLSLENQI------------RM---------
B0MT10          DIVSEAE-----QTITESAQYKT-----DGLSLENQI------------RM---------
R7JGW9          DIVSEAE-----QTITESAQYKT-----DGLSLENQI------------RM---------
A0A414Q925      DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
A0A415PUS9      DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
A0A108TCU0      DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
A0A413BA42      DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
S3Y344          DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
A0A4Q5G8Y8      DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
A0A412TGL3      DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
A0A413VJ33      DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
A0A414L0W6      DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
A0A412DP39      DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
A0A413ZSE8      DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
B0NP84          DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
R6AK43          DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
A0A412N2D9      DIASESA-----LYLKSSSMLDT-----EGLSVENQL------------NM---------
A0A1Y4JYS9      DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
R6LHA4          DIASESA-----LYLQSSSMLDT-----EGLSVENQL------------NM---------
A0A3D2BF46      DITAQAT-----QSLTESSQFKT-----AGLSVENQI------------SM---------
A0A4Y1WUN1      DITAQAT-----QSLTESSQFKT-----AGLSVENQI------------SM---------
A0A4Y1XL94      DITAQAT-----QSLTESSQFKT-----AGLSVENQI------------SM---------
A0A358R538      DLQSEAA-----RNVTESSRYKA-----EGLSLENQI------------AV---------
A0A1Y4AAB8      DLASEAT-----RNVEESSQFKA-----EGLSLENQI------------NV---------
A0A1Y3WWY9      DIASEAT-----RSVTESSQYKA-----EGLSLDNQI------------NV---------
A0A1Y4U5L4      DIASEAT-----RSVTESSQYKA-----EGLSLDNQI------------NV---------
A0A1Y3VCJ1      DISSEAT-----RSLTESSQYKA-----EGLSLDNQI------------NI---------
A0A1Y3QTW7      DITSEAT-----RSITESSKFKV-----EGLSIENQI------------SV---------
R6XWY7          DITSEAT-----RSITESSKFKV-----EGLSIENQI------------SV---------
A0A4Y1X9Y9      DITSEAT-----RSITESSKFKV-----EGLSIENQI------------SV---------
A0A4Y1WM66      DITSEAT-----RSITESSKFKV-----EGLSIENQI------------SV---------
A0A174AVF1      DITSEAT-----RSITESSKFKV-----EGLSIENQI------------SV---------
A0A656Q4F4      DITSEAT-----RSITESSKFKV-----EGLSIENQI------------SV---------
A0A1Q6EIY0      DITSEAT-----RTITESTRYKA-----ESLTIENQI------------SV---------
A0A5B5VN71      DITSEAT-----RTITESTRYKA-----ESLTIENQI------------SV---------
E4M8L3          DITSEAT-----RTITESTRYKA-----ESLTIENQI------------SV---------
I3YQ50          DITSEAT-----RTITESTRYKA-----ESLTIENQI------------SV---------
R5UEY8          DITSEAT-----RTITESTRYKA-----ESLTIENQI------------SV---------
A0A1H4D866      DITSEAA-----RSVSESSKYKA-----EGLSLENQI------------NV---------
A0A5B3G4Y7      DITSEAA-----RSVSESSRYKT-----EGLSLENQI------------NV---------
A0A374A9J5      DITSEAA-----RSVSESSRYKT-----EGLSLENQI------------NV---------
A0A5B3GQN5      DITSEAA-----RSVSESSRYKT-----EGLSLENQI------------NV---------
A0A1Q6E9S3      DITSEAA-----RSVSESSRYKT-----EGLSLENQI------------NV---------
D4IJ36          DITSEAA-----RSVSESSRYKT-----EGLSLENQI------------NV---------
A0A3E5HPT8      DINTVAG-----MYIQDSRQYES-----SIKELDTQL------------QL---------
C6IJ48          DINTVAG-----MYIQDSRQYES-----SIKELDTQL------------QL---------
Q8A3U2          DINTVAG-----MYIQDSRQYES-----SIKELDTQL------------QL---------
A0A3R6S1H6      DIVSETG-----IYLQNSNLYQQ-----EGLGLENQL------------SL---------
A0A3R6SD81      DIVSETG-----IYLQNSNLYQQ-----EGLGLENQL------------SL---------
A0A354WXN6      DITSETG-----MYLQNTSQYNQ-----ESLSLQSQL------------QL---------
R5IP14          DITSEAG-----MSLTMKSGYMS-----EGVSLENQI------------SL---------
A0A316SZX7      DISSEAQ-----SQLQQSSAFKK-----EGLSLENQI------------NL---------
A0A1Y4AIY1      DITSETG-----MYLQNTSQYRK-----EGLSLENQL------------SV---------
F3ZRU7          NITSDAE-----MFITETTGLKK-----EELEVLNQL------------SL---------
A0A0J6CIR2      DISSETG-----MYLQESSQYSK-----EGLGLENQV------------TL---------
A0A3D8HG59      DIVSETG-----MYLKESSEYSR-----EGLSLENQL------------TL---------
A0A3R6S408      DIVSETG-----MYLKESSEYSR-----EGLSLENQL------------TL---------
A0A1C5Q1F3      DISTQTG-----SFMERSNRYQQ-----EGVTLENQR------------TL---------
R7A239          DISTQTG-----SFMERSNRYQQ-----EGVTLENQR------------TL---------
A0A3R6HIK7      DIKSETG-----MYLQNTSQYKQ-----EGLSLENQV------------AV---------
K5ZVW7          DIKSETG-----MYLQNTSQYKQ-----EGLSLENQV------------AV---------
A0A1Y4D5Z0      DISSETG-----MYLQNTSKYKQ-----EGLSLENQL------------AM---------
A0A413VXJ7      DITSETG-----MYLANTSLYRQ-----EGLSLENQL------------SI---------
I9RSN9          DITSETG-----MYLANTSLYRQ-----EGLSLENQL------------SI---------
U6RJK5          DITSETG-----MYLANTSLYRQ-----EGLSLENQL------------SI---------
A0A1Q6GA32      DITSETG-----MYLANTSLYRQ-----EGLSLENQL------------SI---------
I9RPU6          DITSETG-----MYLANTSRYQQ-----EGLSLENQL------------SI---------
I8YFS5          DITSETG-----MYLANTSRYKQ-----EGLSLENQL------------SI---------
A0A4Q5F7I7      DITSETG-----MYLQNTSRYKQ-----EGLSLENQL------------SI---------
I8Y597          DITSETG-----MYLQNTSRYKQ-----EGLSLENQL------------SI---------
A0A1Q6GBF5      DITSETG-----MYLANTSRYQQ-----EGLSLENQL------------SI---------
I8YFZ3          DITSETG-----MYLANTSRYQQ-----EGLSLENQL------------SI---------
A0A4V1YNX8      DITSETG-----MYLANTSRYQQ-----EGLSLENQL------------SI---------
A0A1Q6GDH2      DITSETG-----MYLANTSRYQQ-----EGLSLENQL------------SI---------
U6RSB0          DITSETG-----MYLANTSRYQQ-----EGLSLENQL------------SI---------
I9GXM2          DITSETG-----MYLANTSRYQQ-----EGLSLENQL------------SI---------
I9SIK1          DITSETG-----MYLANTSRYQQ-----EGLSLENQL------------SI---------
A0A4Q5FNG1      DITSETG-----MYLANTSRYQQ-----EGLSLENQL------------SI---------
I9TP59          DITSETG-----MYLANTSRYQQ-----EGLSLENQL------------SI---------
R5S343          DAGLETG-----VFLQESSLYNQ-----TGLGLDNQL------------SL---------
A0A1M6K7I9      DITSETG-----MYLQTTTKYKQ-----EGLSLENQL------------SL---------
A0A5M6A8C8      DITSETG-----MYLQTTTKYKQ-----EGLSLENQL------------SL---------
A0A4V1YPN7      DITSETG-----MYLQNTSRYKQ-----EGLTLENQL------------SI---------
A0A4Q5F874      DITSETG-----MYLQNTSRYKQ-----EGLSLENQL------------SI---------
A0A641LV22      DITSETG-----MYLQNTSRYKQ-----EGLSLENQL------------SI---------
A0A3R5ZMK1      DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A0A3E4ZTK7      DISSETG-----MYLQTSSRNQQ-----EGLSLENQL------------SL---------
A0A1Y3ZIA4      DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
K5Y1A4          DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A0A4Q5CIT0      DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A0A3R6K8X4      DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A0A414GI87      DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A0A415BDM7      DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A0A412DM15      DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A7AEU7          DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A0A1Q6I3T6      DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A0A414XX40      DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A0A3R6BKI7      DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A0A414LPI6      DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A0A412M2W1      DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
K5ZX55          DISSETG-----MYLQTSSQYRQ-----EGLSLENQL------------SL---------
A0A5F0U645      DIHSEAG-----MYLQEGSQYSQ-----EGLGLENQL------------TL---------
K5ZBN2          DIHSEAG-----MYLQEGSQYSQ-----EGLGLENQL------------TL---------
A0A0J6CKW3      DIHSEAG-----MYLQEGSQYSQ-----EGLGLENQL------------TL---------
A0A0F5IQM7      DIHSEAG-----MYLQEGSQYSQ-----EGLGLENQL------------TL---------
A0A496CDT3      DIHSEAG-----MYLQEGSQYSQ-----EGLGLENQL------------TL---------
S0GLB0          DIHSEAG-----MYLQEGSQYSQ-----EGLGLENQL------------TL---------
A0A3R6NLC1      DIHSEAG-----LYLQEGSQYSQ-----EGLGLENQL------------TL---------
A0A416WYC9      DIHSEAG-----LYLQEGSQYSQ-----EGLGLENQL------------TL---------
A0A0F5IT40      DISSETG-----MYLQESSQYSK-----EGLGLENQV------------TL---------
A0A496CX20      DISSETG-----MYLQESSQYSK-----EGLGLENQV------------TL---------
A0A5F0UBI0      DISSETG-----MYLQESSQYSK-----EGLGLENQV------------TL---------
S0GSI7          DISSETG-----MYLQESSQYSK-----EGLGLENQV------------TL---------
K5YB65          DISSETG-----MYLQESSQYSK-----EGLGLENQV------------TL---------
A0A0F5IWP9      DISSETG-----MYLQESSQYSQ-----EGLGLENQL------------TL---------
A0A0F5IZT8      DISSETG-----MYLQESSQYSQ-----EGLGLENQL------------TL---------
A0A417LKQ2      DISSETG-----MYLQESSQYSK-----EGLGLENQR------------TL---------
A0A416TME1      DISSETG-----MYLQESSQYSK-----EGLGLENQR------------TL---------
A0A416XPE8      DISSETG-----MYLQESSQYSK-----EGLGLENQR------------TL---------
A0A5C8KAD6      DLNEQGK-----LYLRNIGDNDR-----RISEISNHL------------SV---------
A0A5N1J695      NLGEQSK-----LYLQSVGENDR-----KIADINIQL------------AV---------
A0A1H4ADG3      DLPTQSQ-----SLIANAGENAK-----ELAAQQVQL------------SI---------
A0A5B8VUR8      DLPSQSQ-----SLISNAGANAK-----DLATQQVQL------------SI---------
A0A2A4G4B1      DLDMESG-----LYLRDNAQSRQ-----EINTLSTQL------------EL---------
A0A3N2M1H3      DLIASAQ-----ASMEKESNLEQ-----SILNIENQL------------SI---------
A0A4S2G8T2      DLIASAQ-----ASMEKESNLEQ-----SILNIENQL------------SI---------
A0A212K7W5      DIQAASN-----MYMARSNENDT-----KIQALSTQH------------TI---------
F5IU11          DIQAASN-----LYMVKSNENDT-----KIQALNTQY------------TI---------
A0A3N2N6F7      DVAAASE-----MYMANANENTK-----QQLGVMTQM------------EI---------
A0A4P7VVU7      DVAAASA-----MYMEDANENTK-----QQMQVSTQI------------AI---------
A0A2V1ILM4      DVAAASA-----MYMEDANENTK-----QQMQVSTQI------------AI---------
A0A3N2L0E8      DVAAASA-----MYMEDANENTK-----QQMQVSTQI------------AI---------
A0A3N2LFC5      DVAAASA-----MYMEDANENTK-----QQMQVSTQI------------AI---------
A0A553LCN8      GTEGNGS-----QYLAESSRVKG-----ETLQMETEL------------SI---------
K0XJ09          SIDAAAT-----QFMSESSKMRD-----ELVQLETEY------------AI---------
R5EUZ0          SIDAAAT-----QFMSESSKMRD-----ELVQLETEY------------AI---------
W0EQS0          SIDAAAS-----QFMSENSQMRS-----ELVQLEMEY------------AI---------
A0A1Y3WE15      SIDAAAS-----QFMSENSKMRD-----ELVQLETEY------------AI---------
A0A1Y4GUK3      SIDASAN-----QFMSENSQMRT-----ELVQLETEY------------AI---------
A0A352Z1R7      KLDSEAQ-----EVVKNLSETEK-----LRAEVIFQK------------KQ---------
A0A0A2F501      DLKETTR-----IYLDQTSEAEA-----QLLDLSNQL------------YM---------
R5B7P0          DVGAAAT-----MYMQQSTVLNQ-----QLQDVSNQL------------YM---------
R5B0L5          NVQQAAS-----MYMTESQVVST-----QMLELNNQL------------QM---------
A0A374THP7      DVEAAAQ-----QYMQKSTEVDK-----QIMDLNSRL------------AI---------
A0A3R5XWG1      DVETAAQ-----QYMQKSSDLSK-----QIMDLNSRL------------SI---------
A0A5P0Y910      DVETAAQ-----QYMQKSSDLSK-----QIMDLNSRL------------SI---------
A0A5P0XQC0      DVETAAQ-----QYMQKSSDLSK-----QIMDLNSRL------------SI---------
A0A414YFM3      DVETAAQ-----QYMQKSSDLSK-----QIMDLNSRL------------SI---------
A0A5P0VXP6      DVETAAQ-----QYMQKSSDLSK-----QIMDFNSRL------------SI---------
A0A5P0W892      DVETAAQ-----QYMQKSSDLSK-----QIMDLNSRL------------SI---------
A0A0A2EVS5      DVRTASE-----MYMTQAGEAGT-----QILALNNQL------------YM---------
A0A1T4NAJ7      DVRTASE-----MYMTQAGEAGT-----QILALNNQL------------YM---------
A0A255T941      DVQAASA-----LYMNQSAESKK-----AILELNSQL------------TT---------
A0A3N2KCL3      DVSAASS-----MYMSQNQQISQ-----QIMDLKNQL------------KQ---------
A0A4P7VSV0      DVSAASS-----MYMSQNQQISQ-----QIMDLKNQL------------KQ---------
A0A2V1IJY1      DVSAASS-----MYMSQNQQISQ-----QIMDLRNQL------------KQ---------
A0A4P7VXK7      DVSAASS-----MYMSQNQQISQ-----QIMDLRNQL------------KQ---------
A0A1Y4CHN5      DIQAASS-----MYMSQSQETNA-----QILELSMQL------------SM---------
A0A1M6I2S6      DVQAASS-----LYLSQSAENKK-----ELLALNSQL------------ST---------
A0A1Y3V692      DVQAASS-----LYLSQSAENKK-----ELLALNSQL------------ST---------
F3PXM2          DVQAASS-----LYLMQSAENKK-----ELLALNNQL------------ST---------
A0A3E4ZNL4      DVQTASN-----LYMNQSAENKK-----EIQALSNQL------------ST---------
A0A174AHH7      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------TT---------
A0A174JCE8      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------TT---------
A0A3E4JMC4      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------TT---------
A0A412SND6      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------TT---------
A0A414IEQ9      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------TT---------
A0A415UKN5      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------TT---------
A0A0M1W8D8      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------TT---------
A0A3R6GKX5      DVQAASN-----LYMSQSAENKK-----EIQALTNQL------------TT---------
A7V4S1          DVQAASN-----LYMSQSAENKK-----EIQALTNQL------------TT---------
B0NU19          DVQAASN-----LYMSQSAENKK-----EIQALTNQL------------TT---------
D4V601          DVQAASN-----LYMSQSAENKK-----EIQALTNQL------------TT---------
A0A4Q0U3M9      DVQAASN-----LYMSQSAENKK-----EIQALTNQL------------TT---------
A0A4R4H1Q2      DVQAASN-----LYMSQSAENKK-----EIQALTNQL------------TT---------
A0A397WLT5      DVQAASN-----LYMSQSAENKK-----EIQALTNQL------------TT---------
A0A3R6GM96      DVQAASN-----LYMSQSAENKK-----EIQALTNQL------------TT---------
A0A015XH67      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------AT---------
A0A078RZN2      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------AT---------
A0A4R4I3T9      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------AT---------
A6L0K5          DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------AT---------
A7ACT5          DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------AT---------
A6KY94          DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------AT---------
A0A173UQR8      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------AT---------
A0A3R6HK75      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------AT---------
A0A412B7D1      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------AT---------
A0A412VNY9      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------AT---------
A0A414LTU9      DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------AT---------
I9Q4U4          DVQAASS-----LYMSQSAENKK-----EIQTLTNQL------------AT---------
A0A373ISF0      DVQAASS-----LYMAQSAENKK-----ELLTLNTQL------------ST---------
U6RF62          DVQAASS-----LYMAQSAENKK-----ELLTLNTQL------------ST---------
A0A662ZZD5      DVQAASS-----LYLSQSAENKK-----ELLALNSQL------------ST---------
A0A395YYT3      DVQAASS-----LYLSQSAENKK-----ELLALNSQL------------ST---------
A0A642JYJ3      DVQAASS-----LYLSQSAENKK-----ELLALNSQL------------ST---------
A0A015UXN7      DVQAASS-----LYLSQSAENKK-----ELLALNSQL------------ST---------
A0A5M5W148      DVQAASS-----LYLSQSAENKK-----ELLALNSQL------------ST---------
A0A3A5TI83      DVQAASS-----LYLSQSAENKK-----ELLALNSQL------------ST---------
A0A415NEB6      DVQAASS-----LYLSQSAENKK-----ELLALNSQL------------ST---------
A7AJ60          DVQAASS-----LYLSQSAENKK-----ELLALNSQL------------ST---------
A0A016E4F9      DVQAASS-----LYMAQSAENKK-----ELLALNSQL------------ST---------
A0A4Q5CFJ7      DVQAASS-----LYMAQSAENKK-----ELLALNSQL------------ST---------
A0A108TH71      DVQAASS-----LYMAQSAENNK-----ELSTLNNQL------------ST---------
I8VXH0          DVQAASS-----LYMAQSAENNK-----ELSTLNNQL------------ST---------
A0A412S0N6      DVQAASS-----LYMAQSAENNK-----ELSTLNNQL------------ST---------
A0A412IIJ0      DVQAASS-----LYMAQSAENNK-----ELSTLNNQL------------ST---------
A0A0P0FM97      DVQAASS-----LYMAQSAENNK-----ELSTLNNQL------------ST---------
R6KTP3          DVQAASS-----LYMAQSAENNK-----ELSTLNNQL------------ST---------
A0A139LU87      DVQAASS-----LYMAQSAENNK-----ELSTLNNQL------------ST---------
A0A1C6B3Y5      DVQAASS-----LYMAQSAENNK-----ELSTLNNQL------------ST---------
E2NMQ4          DVQAASS-----LYMAQSAENNK-----ELSTLNNQL------------ST---------
A0A412YDB9      DVQAASS-----LYMAQSAENNK-----ELSALNNQL------------ST---------
R7DY01          DVQAASS-----LYMAQSAENNK-----ELSALNNQL------------ST---------
A0A414LGK8      DVQAASS-----LYMAQSAENNK-----ELSALNNQL------------ST---------
A0A415IPQ4      DVQAASS-----LYMAQSAENKK-----ELSALNNQL------------ST---------
A0A3E5BRW7      DVQAASS-----LYMTQSAENNK-----ELSALNNQL------------ST---------
K9DXS6          DVQAASS-----LYMTQSAENNK-----ELSALNNQL------------ST---------
A0A1M6KFV3      DVQAASS-----LYMAQSAENKK-----ELSALNNQL------------ST---------
A0A1Q6G7L3      DVQAASS-----LYMAQSAENKK-----ELSALNNQL------------ST---------
A0A413H235      DVQAASS-----LYMAQSAENKK-----ELSALNNQL------------ST---------
A0A1M5B2J8      DVQAAAN-----MYMAQASEANA-----AIKSLNNQT------------YM---------
A0A255RCT5      DVQAAAN-----MYMAQASEANA-----AIKSLNNQT------------YM---------
A0A1Y4GLF5      DVQAASN-----MYMMQSSETNS-----QILALNNQL------------YM---------
A0A1H3XSC0      DVQAASS-----MYMAQSNQTNA-----LILTLNNQL------------YM---------
A6LE40          DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A4Y1VPX5      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
B3JI46          DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
R6NN15          DVQAASQ-----LYMTERSQAQS-----QILTLNTQL------------SM---------
A0A358R8U0      DVQAASS-----LYMAQSSETNA-----QIMALSNQL------------YM---------
R6WSB6          DVQAASS-----LYMAQSSETNA-----QIMALSNQL------------YM---------
A0A4Q5ENK6      DVQVAAN-----MYMTQANEANA-----EIRELNNQV------------YM---------
A0A401LPX7      DVQAAAS-----MYMTQANEANT-----AIRELNNQA------------YM---------
A0A3A5Z900      DVQAAAN-----MYMTQANEANA-----AIRELNNQT------------YM---------
A0A3R6EGW5      DVQAAAN-----MYMTQANEANA-----AIRELNNQA------------YM---------
A0A285TGL6      DVQAAAN-----MYMTQANEANA-----AIRELNNQA------------YM---------
A0A3A5RFX4      DVQAAAN-----MYMTQANEANA-----AIRELNNQA------------YM---------
A0A1Q6IUW9      DVQAAAN-----MYMTQANEANA-----AIRELNNQA------------YM---------
A0A3R6NPG7      DVQAAAN-----MYMTQANEANA-----AIRELNNQA------------YM---------
A0A413XDP6      DVQAAAN-----MYMTQANEANA-----AIRELNNQA------------YM---------
K6AP24          DVQAAAN-----MYMTQANEANA-----AIRELNNQA------------YM---------
A0A662ZYI7      DVQAAAN-----MYMTQANEANA-----AIRELNNQA------------YM---------
A0A078RYI7      DVQAAAN-----MYMTQANEANA-----AIRELNNQA------------YM---------
C7XEQ8          DVQAAAN-----MYMTQANEANA-----AIRELNDQA------------YM---------
D7INX6          DVQAAAN-----MYMTQANEANA-----AIRELNNQA------------YM---------
K5ZG55          DVQAAAN-----MYMTQANEANA-----AIRELNNQA------------YM---------
A0A3N2N9B8      DVQAASS-----MYMSENRQIAS-----GIMDINNQL------------QM---------
A0A3N2NMI0      DIAAASS-----MYMSQNQQIAS-----EILAINNQI------------QM---------
A0A359I8H7      NLEEAAK-----TQMKQSVEMSN-----KMLEVTNQM------------SM---------
A0A3N2KA63      NLEEAAK-----TQMKQSVEMSN-----KMLEVTNQM------------SM---------
A0A4Q0IMT7      NLEEAAK-----TQMKQSVEMSN-----KMLEVTNQM------------SM---------
A0A3B9FAU3      SVQAASQ-----MSMQQSQESQK-----QVLALNTQR------------SM---------
A0A3C1E5L7      SVQAASQ-----MSMQQSQESQK-----QVLALNTQR------------SM---------
A0A4Q0UAV1      DGSSTAN-----GAMQQRQQSQN-----AILELNNRL------------SL---------
A0A354SN68      NIGIATG-----MVMSQENSLDN-----TIVSTNNKI------------HM---------
A0A3N2N595      DVDAAST-----LYMGESQRISQ-----EIMGLRNQL------------QM---------
A0A0A2DUD9      DVQTASN-----LFLNQAAQVDN-----QIVELRSRE------------YM---------
A0A3P1ZBJ5      DVESASK-----LYMQKTSANDD-----KLMELNNQL------------YM---------
R5FHS9          DVDAVAT-----SYLDQSTAANA-----KLLDLNTQR------------AM---------
A0A413TW79      DVETAAQ-----QYMQKSGDVDK-----QILELNSRL------------SM---------
A0A3E5E9M7      DVETAAQ-----QYMQKSGDVDK-----QILELNSRL------------SM---------
A0A3E4SK73      DVETAAQ-----QYMQKSGDVDK-----QILELNSRL------------SM---------
A0A415GGC6      DVETAAQ-----QYMQKSGDVDK-----QILELNSRL------------SM---------
A0A413DBH9      DVETAAQ-----QYMQKSGDVDK-----QILELNSRL------------SM---------
A0A495WI87      DVQAASS-----MYMAQVNETDA-----QLLALNNQL------------YM---------
A0A354M4S6      DVQAASS-----MYMAQVSETDA-----QLLALNNQL------------YM---------
R7DH52          DVQAASS-----MYMAQVSETDA-----QLLALNNQL------------YM---------
A0A4Q5E7L5      DVQTASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A4P8LP09      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A4R4GZU7      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A016CWA4      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A1C6H117      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A415TAH7      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A0M1W0V2      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A139KA16      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A174VQ92      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A1Q6HCG0      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A1Y4JYM9      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A3A5QW67      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A3A5RQE6      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A3A6BP07      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A3E5E153      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A3Q9IP20      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A412WV15      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A413ICP6      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A414KYB9      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A5B3FWR2      DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
E5WX00          DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
K0X3P3          DVQAASS-----MYMAQSSQTNA-----QILALNNQL------------YM---------
A0A3A5Z014      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A1M4YZ07      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A078S3Q8      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A069SJV7      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A3E5DXI5      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A3E5EM98      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A3E5F453      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
I9T3G6          DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A4Q5E5M7      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A0P0FQW1      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A5M5C0W6      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A642LZ22      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A5M5YM86      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A642LE65      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A5M5Y0P8      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A642NJ89      DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
C3RFN5          DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A3E4SYU0      DVQAASS-----IYMAQSSQTNA-----QILALNNQL------------YM---------
A6LGY1          DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
K5ZSH4          DVQAASS-----MYMAQSSATNA-----QILALNNQL------------YM---------
A0A078T2W6      DVQAASS-----MYMAQSSEANA-----QILSLNNQL------------YM---------
A0A3R6EAF7      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A5C6L2P1      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A412MJT7      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A3E4WKT5      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A3A5YY33      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A078TAH2      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A1E9CFZ7      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A373FYU5      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A3A5TZ72      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A3A5XBP2      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A3A6MEG9      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A3E4JP35      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A3E4KP40      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A3E4NX82      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A3E4XFU8      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A412RG70      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A412TD37      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A413GAA4      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A414M7I4      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A496BTA0      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A496D2V6      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A4Q5EN83      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A4Q5G1P5      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A5C6KCA6      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A5M5AHM5      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A641WNS6      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
E5UZA2          DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A069SMG6      DVQAASS-----MYMAQSSAANA-----QILSLNNQL------------YM---------
A0A1Y4PQK7      DVQTASN-----LYMAQNSQISS-----QILALNTQL------------SL---------
A0A1Y4IH41      DVQAASN-----LYMAQSSQTSS-----QILALSTQL------------SM---------
A0A3A6AAP4      DVQAASN-----LYMAQSSQTSS-----QILALSTQL------------SM---------
A0A1Y4DYA7      DVQAAAN-----MYMTQSNATNS-----QILVLNTQL------------AM---------
A0A1Y3X4I9      DVQAAAS-----MYMTQSSETSS-----QILALNTQL------------AM---------
A0A1Y4FNK8      DVQAAAS-----MYMAQSSETNA-----QILALNTQL------------SM---------
A0A355FD59      DVEAASG-----MYMEQSRETSN-----LLLSLKSQL------------SM---------
A0A359CEZ9      DVEAASG-----MYMEQSRETSN-----LLLSLKSQL------------SM---------
A0A353Q7B4      DVEAASG-----MYMEQSRETSN-----LLLSLKSQL------------SM---------
F8X3A5          DVDAASS-----MYMAQSRETSN-----LMLDLNTRL------------SM---------
A0A1M3KVR9      DVEAASS-----MYMAQSRETSN-----LMLDLNTRL------------SM---------
A0A4Y9IJS3      DVEAASS-----MYMAQSRETSN-----LMLDLNTRL------------SM---------
A0A4Q5WS95      DLSEQGK-----LYLKNVGEIDQ-----KLAEVNMKM------------AV---------
A0A501VZX6      NLSEQGK-----LYLESVEGRDL-----KMSDIDLQL------------AV---------
A0A399SH26      DLSEQGR-----TFLQNMSANDS-----KVEDINLQL------------AV---------
A0A501W1A9      NLNEQGR-----MFLQNVGENDR-----RLGEINLQL------------AV---------
A0A0E3ZGV6      NLNEQGK-----LFLQSVDNNDR-----RLNEINLQL------------AV---------
A0A1I2N4S1      NLNEQGK-----LYLQSVDFNDR-----RMNEINLQL------------AV---------
A0A2T5YE44      NLNEQGK-----LYLQSVDFNDR-----RMNEINLQL------------AV---------
A0A1V9FHD0      DLTEQGK-----QYLENVGTNDR-----KIADLSMEL------------AA---------
A0A4V4H170      NLGEQSR-----QYLENVGSNDR-----KIADLSMQL------------AA---------
A0A1V9F098      DLSAQGR-----QYLENVGSNDR-----KMADLSMQL------------AS---------
A0A4R2VU64      DLGAQGR-----QYLDNVGSNDR-----KMVDISMQL------------AS---------
A0A4S8HY23      DLGEQSK-----QYLENVGSNDR-----KMADLSMQL------------AA---------
A0A1V9F383      DLGEQSK-----MYLENVGDNDR-----KIADLSMQK------------AA---------
G8TRZ6          DLGEQGK-----MYLDNVGDNDR-----KIADLSMQI------------AA---------
A0A543WA52      DLSEQGK-----LYLKDVGDYDR-----EIANLNRQL------------DV---------
A0A1M5BA90      DLSEQGK-----LYLQNVGDNDR-----KMTDINMQL------------AM---------
A0A512B879      DISEQGR-----LYLQNVGDNDR-----KMTEVNMEM------------AM---------
A0A559PPI3      DLSQQSR-----IYLQDAGHNDQ-----RIADIRLKL------------SV---------
A0A1T5CS78      DLSEQGR-----LYLQDVGENDK-----QISELELQL------------AV---------
A0A0Q9Z8F1      DLSEQGR-----LYLQDVGENDK-----QISELELQL------------AV---------
A0A2N0U0M7      DLSEQGR-----LYLQDIGENDK-----QISELELQL------------AV---------
                                                                            

A0A1T5MMH4      INK----LMDGL--------QTGNFSVNPSIRQ-------ALPEYMFKDIDEVQSLL--L
A0A2W4R1L8      INE----LLDDM--------SNGVYLVNPVHRL-------YFPQAINDNLDKLSELQ--M
A0A2E5CV79      RRE----RISFL--------NSKLSAEEKNFATKISTDINAQMIVLRKEINQLESQS--I
A0A2D4ZVH1      VMSGIAQYENQL--------NEIKPGLADLYSDAIGPVIERYQYALAELETNKLLYL--T
A0A0K8QSK7      YRY----LRNYI--------I--QNQELESIMAPSAMGV--EDPMMTSLTQELNTLT--L
A0A1V6CN82      YNY----LKTYI--------L--ENRDVGSILVPSSVGI--NDPLLSGLLSQYNQLT--V
A0A1M4XZ45      YHY----LRDYI--------STSSSQEMETVIAPSAMGI--QDPLLNSLILQLNELI--T
A0A399D319      YHY----LRDYI--------HSDTNKE-ETIIAPSAMGI--QDPLLNSLILRLNELI--T
A0A1M6GR99      YDY----IKEYN--------SDNS---DDTQIVPPSAMG-VQDPLLNNLIEELSTAQ--T
A0A1M6TTV4      IEL----ASEQL--------DEGTPISPV-----------DMPKEIMQLLVDYNKLK--N
A0A4Q8RX32      LEF----LNSNF--------NKDDDFTDYSLTILSDLNN----QVLNDLLNEYVDLV--G
K0X1U5          ISM----VDSFL--------NKPE---NKYSLVPVTTGL--PDRGAAEAINEYNKLL--L
R5EXK3          ISM----VDSFL--------NKPE---NKYSLVPVTTGL--PDRGAAEAINEYNKLL--L
A0A401UAP7      IRK----LKEDL--------KDGK-----TERYVSLTDKETLPQEVINDVLAYQKKR--E
A0A1W2GF52      VDL----VGENF--------RNGQ-----------QVSIFKMPTRITELVNSYNDLV--N
A0A2G5L7B8      VEL----ANKQL--------GEGT-----------PITTLGLPKPFLEMLAEYNELK--N
A0A523GAC0      IHQ----LQSNV--------GNQTGAPERLLQYS------SYNEDINTTLSKLGDLV--R
L8JW09          FDQ----LLADL--------ENNKTEFLGISQ-E------TYPKHIADAYNELSVQI--S
A0A5C7MX19      IKS----FKKIF--------KDTE-----FSSIPLVALQ-EKDIDVNDLITRINVLK--N
A0A364XUP5      LNQ----LSDGL--------RSKK-------FFVSPGLRKILPEYISKNLDRVQELF--L
A0A1M5RLA9      VNT----LMDGM--------KAGD-------LSISLTQLHALPPTVAKNLEQLEDLY--R
A0A385SFR9      VNT----LMEGL--------KTGD-------LFISLTQLHALPPTIAKNLEQLEDLY--R
A0A5M4A9J4      YTY----LLNYL--------KSN----NDLKQIAAPSTVGINNPMLVSLLQQLAGQT--L
A0A5M4B1C7      YRY----LLQYL--------KSN----NSIEQIAAPSTMGVDDPMIVNLLQQLTSQT--L
A0A0D3LFR6      LTN----LSSRI--------KSED---TYFAQSLVNRAGDDFPADIKTLLDQLNKLI--S
M7N6D4          ITS----LASRI--------EAED---SYFAQSLVNRQDGNFPAELKGLVEELNTLT--S
A0A1Q3ZMZ7      LKD----LKRRI--------NSTSSETEISNILIEIANE-EYSGIIRTQIETLQEMI--T
A0A2D8JJW3      LIN----AKEIY------------------------------------------------
A0A2W2AFF7      VES----LQKYL--------HENVNNRRVVPSSLVLQDP-----TFVALIDKYNGVQ--L
A0A2N5YXE2      LEK----VSEKI--------EKDP-ELKTYEILAMLSGQ-QSETFIAGMINSLQELL--N
A0A2W1NDY9      ILG----LVEGI--------NSK-NRVSIYNLIPTLAGT-RFQPLLEGQIEKLYRLL--E
A0A5C8AQR5      LRM----VSGKL--------KAEPNRLEIYKILPEMLGK-SYESSLSKQIEDLHQML--E
A0A1G0CI31      LKL----VSSKL--------RNDPNRLEIYRLIPEMLGK-SFEISLTRQITDLHALL--Q
A0A556N0M0      LKT----VHSKL--------KLEPNRLDIYRLIPEMLGK-SYELSLTKQITDLNTLL--E
F2IKD6          LKV----VNSKL--------KTEPNRLDIYRLIPEMLGK-SYESSLTKQITDLNTLL--E
A0A1I7BM74      LKR----IKTEI--------NNSPRSTEVYKLLPVLIEK-SYQNALKDQIETLFSKL--E
A0A2G2FJ17      LEM----ISLKL--------KQSPESLDVYKLIPELIGK-SFEGSLNLQVKELHELL--E
A0A077ENE7      AEM----MRSYL--------MNKG---KQNNLIPNNTGL--VDSGVEGQIAEYNKAL--L
T0NN57          AEM----MRSYL--------VNKN---KRNDLIPNNTGL--VDASVEGQIAEYNMAL--L
X5K347          AEM----MRSYL--------VNKN---KRNDLIPNNTGL--VDASVEGQIAEYNMAL--L
A0A2I0QZ80      LKV----VKEKL--------NSDPNSNDVYRLIPNIIGQ-SYEGSLTKQIQELYELI--E
A0A3E1F1A3      LET----VKKKI--------EGNPNSLDVYRLIPIIIGK-SYESSLNQQIQELYELI--E
A0A2U2XBJ3      LNS----VQDKL--------EGNPNSLDVYRLIPVIIGK-SYESSLNSQIQELYNLI--E
A0A4Q4KU94      LNS----VESKL--------KGNPNSLDVYRLIPVIIGK-SYESSLSIQIQELYNLI--E
A0A2U1FKU2      AKY----IQAFL--------RQTN---SDNELMPANLGL--TEQGIDNSIAQYNELK--L
A0A0A2F954      AKY----IQSFL--------RQTS---TDNELMPANLGL--TERGIDNSITLYNELK--L
A0A0A2FW91      AKY----IQSFL--------RQTS---TDNELMPANLGL--TERGIDNSITLYNDLK--L
A0A2D2N2N1      AKY----IQSFL--------RQTS---TDNELMPANLGL--TERGIDNSITLYNELK--L
Q7MWZ2          AKY----IQSFL--------RQTS---TDNELMPANLGL--TERGIDNSITLYNELK--L
T2NDT6          AKY----IQSFL--------RQTS---TDNELMPANLGL--TERGIDNSITLYNELK--L
W1R7P9          AKY----IQSFL--------RQTS---TDNELMPANLGL--TERGIDNSITLYNELK--L
A0A1R4AFZ0      AKY----IQSFL--------RQTS---TDNELMPANLGL--TERGIDNSITLYNELK--L
A0A1R4DVZ7      AKY----IQSFL--------RQTS---TDNELMPANLGL--TERGIDNSITLYNELK--L
A0A5M4B212      YQY----LEEYL--------SKNE---DLESLVAPTTVG-INDPLLVNLLQELSQLN--I
A0A1T5K9D4      AEY----LRDYV--------RGSM---DSFEVIPANTGL--NDANLDQAISQYNDLV--I
A0A3D1KEX9      AKY----LREYV--------VKNASNTNLIPDLNL-----GDNGAMQGQIGKYNDAV--I
A0A358Y7S2      LYL----VQGKL--------TSNPNRLDIYKVIPEMIGKKSFEGAVIRQIEELNDLL--E
A0A1X7J248      IEN----IQKQL--------EKDTLSFDKINYLVLPSNM-------QPLFEEFSELK--E
E4TQD2          INN----IQSQL--------DKDTLSFDKINYLVLPSNM-------QPLFEEFSELK--R
A0A2J6HHN3      LSA------FIL--------SVENEENDVLFLISMLTGT-ESYTYLSPYLTSLQDLE--F
A0A1Y3WMT8      ISM----VDSFM--------NSPE---NKYSLVPITTGL--PDRGAAEAINEYNKLL--L
A0A1Y4GQU1      ISM----VDSFL--------NRPE---NKYSLVPVTTGL--PDKGAAEAINEYNKLL--L
A0A1V5W8T5      LQK----VNKQI--------AAGK-DFNAVELISILSGS-SSESMVLNFLNGIQQLQ--K
A0A2T8HKA9      AEM----MRDYI--------YDAG---RSEKLIPSNMGL--ADLNVDRYISDYNSAL--L
A0A3B8INU3      VNR----MFSSV--------IDSADIPDQSLLFPHLNTA----------LQEYGNLK--V
A0A414ZBF2      AEY----IKDYL--------QDNS---KTAELIPSSIGI--NDNGIQNQINEYNTTL--T
A0A1Q3Q573      LQN----FKMLL--------QKT----KDYSTLPILQFK-EEEMSIAGEIENINQLQ--R
A0A662BAY3      YKY----LREYI--------INNQ---ELETIIAPSAMD-IDDPLLNALILELNNLS--I
A0A4U3L369      IKN----LKEYL--------QDERNNKRIVPSNLV-----TSDPTFTELVGKYNTLM--I
A0A357YNR3      VSN----LNDYV--------QNIN---NHEQLIPANSGI--NSQSLNNQINSYNNLV--L
A0A5E8AX52      IQM----AQEQM--------DKGE------PLLLANYNSRSLPEFISGSLTEYNKLF--G
F4KK08          AQF----VRGHL--------KDKN---QMESLIPANVGI--ASPSIEAAIAKYNEFL--L
A0A496LCF9      FKY----LRNYL--------KSNIDRESLASPATLG----IQEPRLIALVDKYNELQ--I
A0A5P2G2A9      VNT---MLDYVL--------NTKNNQRPVPSLLA------TPDPALESILTQYNALV--L
A0A419VXB7      YKN----LRGYI--------GEDGNMKNI--VFPSVVGI--TDVGLNSMVVRLSELN--S
C3J7R8          ANY----LKDYL--------KSPS---SKDELIPANVGL--NEASADNLIREYNSLL--L
A0A0B0BTJ4      LSA----IGDIL--------NGK----EEIGILPVNIGI--ENQALSNAINKYNELV--L
A0A3B9CNN6      LSA----IGDIL--------NGK----EEIGILPVNIGI--ENQALSNAINKYNELV--L
R5X290          LSA----IGDIL--------NGK----EEIGILPVNIGI--ENQALSNAINKYNELV--L
A0A1Q6E6I7      LSA----IGDIL--------NGK----EEIGILPVNIGI--ENQALSNAINKYNELV--L
A0A1G8BVM8      ANY----MKNYL--------HDNANKSELIPGNLGINNS-----GIESQIARYNETM--T
A0A2G2F510      LIT----VHKMI--------GSSPNRLEVYKMLPEMLGK-SYETSLVKHIEELHLLL--E
A0A316JZ08      LIA----IDNQL--------ERAPNRLEVFRMIPEMLGK-SYEASLVTHITDLHDML--E
A0A1I1FXP9      LMD----LRNTI--------INNQ---DIRKIIPALKHI--NDQELVDLAEALSDLQ--N
A0A3N4H5N3      LES----LENLI--------NSQSSQGDLIPSSLV-----SLDPALGDLLTRYNDLQ--R
A0A2P8EAX2      LES----IESLI--------AVQGSGNETIPSSFV-----TLDPTLSELLSKYNDLL--R
A0A4V2F6N9      LES----LENLI--------AVQGNGNETIPSSFV-----TLDPTLSDLLAKYNDLL--R
A0A3B9FXJ0      LKW-------LL--------DYANNNIEDLDALSGYFGN-LKFNNFAPYFNSLSELE--K
R5GSU5          AEY----LEDFL--------KNNSKADQVIPVLNDMVDQ-----GIQQQITEYNKLV--L
A0A2A3UE91      ITE----IQANI--------AKNK-NIDIYQLISLMSGT-EYESVIKDVTQNIQKLL--S
A0A0A2G557      AGF----IKEHL--------TNPS---SANGLIPASSGL--EDLASNSLIKEYNTLY--L
A0A2N2WFW8      LDR----FYNTF--------ESG--NSDFVVLLSLLSGL-ESQVYLAPYLQSLKELE--M
A0A1F3IU95      LEI----FYKAF--------SSG--NADIITLLPLISGI-ESQVYLSPYLQSLKDLE--M
A0A3D0VUF6      LEI----FYKAF--------SSG--NADIITLLPLISGI-ESQVYLSPYLQSLKDLE--M
A0A1T4PT95      ARF----IKEHL--------TNPS---TAGGLIPASSGL--EDLSSNTLINEYNTLY--L
A0A4P5TMD1      LNYYLGYFNLYK--------DSSKLLLGIVD---------QKYVGLQSYVEALDKLQ--S
A0A651GU15      LGE----LEKVA--------LANPEETDIYALIPLIVGT-RLENSLSGLITDLREIL--L
A0A3Q9FR88      YQK----LRHFL--------EADSSIVYIQAYATILTDG-----SISSSLDELAKLE--T
A0A553GEX3      YQK----LRHFL--------EADSSIVYIQAYATILTDG-----SISSSLDELAKLE--T
A0A150ADJ9      YQK----LRHFL--------EADSSIVYIQAYATILTDG-----SIASNLSELAKLE--V
A0A1B1FWQ4      YQK----LRTLL--------QADSSIVYIQAYATILTDG-----SISSSLDELAKLE--T
A0A1S1Z228      YQK----LRHFL--------EADSSIVYIQAYATILTDG-----SISSSLSELAKLE--T
A0A2A4PYG9      LDE----VADMI--------KKK-DDIDVYNLLPALTGS-SFQDEISDLVQSLHKLL--A
A0A1F3K695      LKR----IQEQI--------NSK-ANLNIFELIALLSGT-KSGNVIEGILNTLQSLI--T
A0A353KZR1      LKR----IQEQI--------NSK-ANLNIFELIALLSGT-KSGNVIEGILNTLQSLI--T
A0A2N2WYB5      LQR----ISTQV--------NVD-NELNIYELIALLSGT-KSEAILVSVLNNLQQLI--S
A0A1F3K4G0      LQR----INQQV--------AND-HDLNIYELIATLSGT-KSETIVVNVLNNLQELI--N
A0A356H8Y3      LQR----INQQV--------AND-HDLNIYELIATLSGT-KSETIVVNVLNNLQELI--N
A0A351HSA6      LQR----INQQV--------AND-HDLNIYELIATLSGT-KSETIVVNVLNNLQELI--N
A0A1F3Q014      LNK----IETTL--------SNS-KNIDTYTLIAMLAGT-TTESNITSAVEALHKLL--I
A0A2A4YXP3      LKE----VKKSI--------SLNNDDIDVYDLLPILAGT-DYAGGIMSLITSLKEFL--I
A0A2D5KD44      LEE----IKKQI--------KEGGEQIDIYEFLPILVGS-QFESSISSLIEQLNDLL--L
A0A1F3R158      LEE----INNSV--------KGKIKDINVYNLLPILSGT-EYEIRITTLITDLQTLL--L
A0A2M8ADX2      LEE----INNSV--------KGKIKEINVYNLLPILAGT-EYEIRITSLITDLQSLL--I
A0A1J5B2H0      LNE----VEITF--------NAS-ENVDIYKLIATIAGS-EFQGIISSLLNNLQDLL--L
A0A1V5N756      LKR----VEEFV--------NQS-KDLDVYELYALVAGS-QFQSSVSGNLQAIQNLL--M
A0A1F3SJM1      LDI----LDQKL--------NAKVSRLNVYRMIPEMLGK-SYETALVGHIESLHTLL--E
A0A2G2EB96      LLN----VKQKL--------SKTPNRLEVYKLLPELLGR-SYERALEGHLNQLHDFL--E
A0A2G6PRA9      LLN----VKRKL--------SKSPNRLEVYKLLPELLGR-SYEASLAGHLRELHEFL--E
A1ZKR2          IKE----LDDLV--------NKQG---DLSEFLPTLTTPIQGLGQLQPLISKLNQLQ--E
A0A1Q3GX01      IKE----LENLM--------EQDK---ELVLYLPETSAGLQGLTQ---IMNQINKLQ--E
A0A349DQI4      IKE----IENLI--------AEDK---ELVLYLPENTSGLQSLTE---ILKKISKLQ--E
A0A2N3IIZ0      IIE----LEIFV--------NQRFVDSKNIPLMPDVDGA------ILQQISELNRLR--Q
A0A497D5Z2      YNY----LRDYI--------RNNQ---HLGNVIAPSAMG-IDDPLLNSLIAELNTLI--V
A0A662B170      YNY----LRDYI--------RNNQ---HLGNVIAPSAMG-IDDPLLNSLIAELNTLI--V
A0A2A5FYT6      LKE----IEKKI--------TANEKEIDPYTIIPVLTGT-HFEKNISRQINSLHQLL--I
A0A2E6SYP1      FTQ----FQLKL--------SENPSNEELYSILLLNSTN----KYLSSVGTSLKQLL--A
A0A2E5RLE8      FRN----FYSAI--------SNKINHEELYSILLLNSKN----QYISTTSSRLRNLL--S
A0A2E7TQF6      FRN----FYSAI--------SNKINHEELYSILLLNSKN----QYISTTSSRLRNLL--S
A0A2E6GVY9      FKN----FYSSI--------SNKISHEELYSVLLLNSKN----QYISTTASRLRKLL--S
A0A350JJ90      LSE----LRGGI--------QIEKTGVDIYNLLPVLAGT-EFENSVKGQIEELQNLV--L
A0A3M1CDV2      LDE----ILNNI--------QTQK-NIDLYQLISLASGT-SYEESIKNITSNIQKLL--L
A0A522EYA6      LVE----LEKSI--------EGKK-EVDSYQLVSLLTGI-EFESALNNQINSLQELL--K
A0A4P5U6G4      LYS----YQDYF--------NRYEDSTRLFSGIVDVQFS-----ALQEFVRMLDKLQ--A
A0A2E2TFD1      LIQ----VKQAA--------TSSSDSVEVHQLIPLLTGT-QFEDNLLQQIAYLQELQ--I
A0A2E4ELE6      LDE----LKAAS--------DGEKDSVDVYDLLPLLAGT-QFEIGIKKQIQFLHELL--L
A0A2E3XZI5      LNQFDLMFDENL--------SSKI-TTSSIKNISLLTNIFYEDELIKIMITQLQEDV--L
A0A2M7NLQ9      YRE----ISTLL--------EDDS-----TLLVALTYSSMLKDTNLKNRIEKVYDEE--K
I4AFR0          YKE----ISTLL--------ENDS-----TLLIALTYSTILKEPSLKIRLEEVYEEE--K
A0A2N2Y3E5      YNN----LLDYL--------KKK--DLSAVELIAIIPQN-LNSSVLTSILSEIQSLI--K
A0A2D9D7T6      LYL----IKSKI--------TPNPDRIQIYKLIPEMLGKKNLEANVIKQVEELNALL--E
A0A1F3PPL5      LNR----IKSEV--------AENK-NIDVYELIALLSGT-KSEGYISNILESIQQKN--D
A0A357QK06      LNR----IKSEV--------AENK-NIDVYELIALLSGT-KSEGYISNILESIQQKN--D
A0A662AEA4      LNR----IQKQI--------VKGK-DSNIYEIIAILSGT-KFDGVIVNVLNNLQKLI--S
A0A0S2HYK8      LKN----VKTQL--------ETNQ-QLNTYEMIATLAGT-NSEKVLVSILTNLQNLI--N
A0A2N5ZWN6      LEN----VNDQL--------KKQG-QINIYEMIATLAGT-SSEKVLVNILSNLQQLI--N
A0A0F2NS19      LKE----ISKSV--------TGKINTIDIYNLLPTLTGT-EYEASITALITNLQNLM--V
A0A2A5H8X6      LKE----ISKSV--------TGKINTIDVYNLLPTLTGT-EYEASITALITNLQSLM--V
A0A2H0GAU8      LTE----ISKSV--------SGKLNTIDVYNLMPTLTGT-EYEASISALITNLQGLL--V
A0A2M8FTK1      LTE----ISKSV--------SGKLNTIDVYNLMPTLTGT-EYEASISALITNLQGLL--V
A0A2A5B3B0      LEE----IKTSI--------SSNDKDIDVYELLPILAGT-EYAGGIMSLITTLKELL--F
A0A5C6RXM7      LVE----ISSSI--------ESELKNVDVYKLLSILAGT-DYSSGITSLVTELKRLL--L
A0A2E0FJ09      LNE----IATVI--------TDNPLELDIYNVLPILIGS-EFESNLYTLISVLHKKL--M
A0A1F3FZ62      LEE----LEKNF--------SSIK-DLDVYKLIAFISGT-EVNKIVKGNLDAIQSIL--L
A0A1F3K211      LEE----LEKNF--------SSIK-DLDVYKLIAFISGT-EVNKIVKGNLDAIQSIL--L
A0A1F3KLL5      LKR----IEKQL--------SAGE-NLKYYDLYSLLSGT-KSENVVSRLLEEINKLE--N
A0A359D1M1      LKR----IEKQL--------SAGE-NLKYYDLYSLLSGT-KSENVVSRLLEEINKLE--N
A0A2E7CT70      LNQFQEMFQSTL--------SKKI-SSNSIKSLS-LSKIFYDNLVIQNMIESLEKNV--I
A0A2D5V560      XNQFSDMFENXL--------STEI-NSTSMKNISLLTAIFYNESLTSKMIEQLQEDV--N
A0A2D7K5A8      MDQFSNMFENNL--------STEI-NSSSVKNISLLTTIFYGESLTSKMIDQLEKDV--I
A0A2E1XQ82      MDQFSNMFENNL--------STEI-NSSSVKNISLLTTIFYGESLTSKMIAQLEEDV--N
A0A1V6I2U9      LEK----MLDKL--------KSNP-EINTYELLAMLSGQ-KSEVFLSSMINSLQELL--N
A0A1F3C1M2      LKR----INEYV--------NKNS-NLNILDLIAILSGT-KSEGLIVSILNKLQDLI--N
A0A1F3DS87      LKR----INEYV--------NKNS-NLNILDLIAILSGT-KSEGLIVSILNKLQDLI--N
A0A2H0B957      LKQ----ILDEI--------SKTP-NINAYNLISLLP-L-KDNNILLSLLNQIQNLI--T
A0A1F3CFW6      LKQ----ILDEI--------SKTP-NIKVYDLISLLP-S-KNDGILISLLNQMQNLI--N
A0A2M7E2T8      LKQ----ILDEI--------SKTP-NIKVYDLISLLP-S-KNDGILISLLNQMQNLI--N
A0A2M7NC69      LKQ----ILDEI--------SKTP-NIKVYDLISLLP-S-KNDGILISLLNQMQNLI--N
A0A5C8A5B4      CSS----VLSKI--------RSSSDLRNV--PAPSSSGI--DDPVLNNLVIEITKLSADL
A0A4Y9ITE2      LEM----TRELM--------NDPNHRYD-----LIPTPY--GAEAAVDAIAEYNKLI--L
A0A5M8NYX7      ISS----VKNYL--------SNPDNKNNG--A-PANVGI--TDPMVISLMNAYNTEI--F
A0A3D5KRY6      FNN----LKYYL--------ENRDQNKDL--VFPSIEQL--TDPALIETVKKLNGLY--S
A0A1V5IPN7      LDV----LRKQL--------QDQDSLLV-----KVENVL--QAPYIGELRRQITNTQATI
A0A0E3V905      LND----LQKYI--------EGKGDTRGN--T-PAVVGL--SDPVLLSLINNLTQLE--Q
A0A553ETH6      SKD----IKIFL--------KNLEADKVS----EVNYEQ--LPRFIGENIRLLNELF--L
A0A640Q161      YKQ----TRNDV--------SLDDIA-------RLPEVL--NHPTIRDVRRDEAKAM--T
A0A640QU49      YRQ----TRNDV--------SLNDIA-------RLPEVL--NHPTIRDVRRDEAKAM--T
A0A1Q3PII2      VEL----LAAHL--------RAKPTMAI-----PSALYP--REDNFADLVTKYNDML--L
A0A351BXT2      YNS----LKSEI--------ERMDPTLVN--F--LQGKV--DELYLTEIQSKIAELE--S
A0A2K8Z965      LND----LQKYV--------ETKSENRGN--TPPAVVGL--NDPVLLGLITNLTTLE--Q
A0A418M8U8      LSD----LQRYI--------NNRSLDRGA--T-PALVGL--NDPVLFSLIEKLTQLD--L
I2GTA4          LSD----LQRYI--------NNRSLDRSA--T-PALVGL--NDPVLFSLIEKLTQLD--L
A0A2K8ZAJ2      LAD----VERYV--------QSHSGRKGV--A-PATLGL--SEPILTSLLTKAAELE--L
A0A368JPA3      LGD----VEKYV--------RSKGENRGV--L-PTTLKF--SDPTLTALIGKLTELE--T
A0A5N1JI29      LGD----VEKYV--------RSKGENRGV--L-PTTLKF--SDPTLTALIGKLTELE--T
A0A3P1BT12      LGD----VEKYI--------RAKGENRGM--L-PATLKF--NDPALTSLISKLNDLE--Q
A0A3P1CI15      LGD----VEKYI--------RSKKDNRAA--L-PATLKF--NDPTLTSLLGKLTDLE--V
A0A4R8CUK1      LGD----VEQYI--------REEGTHYCS--L-PAMLDF--SDPAVTAFVTKIQDLE--R
A0A3D0MYJ7      INN----LRRKI--------SEISPE-VD--L-YVNSQA--NQSKFTTISNEIASLE--V
A0A662AH13      INV----YKAEI--------DKKNPT-LS--K-YIENYA--STPRMLALQEAIGNYE--L
A0A5C7QA01      -----------------------------------------------------IELK--Q
A0A3D3LS70      YDA----LKSEL--------EKLDPQ-LI--T-YVESQI--SQSYVEEIQKTIANVE--A
A0A1G1TM36      VES----IERYL--------RNPQPA-AT--V-PTTLGI--TDEALNNLVGRLTSLQ--L
A0A1G7ZF38      VGL----LEAHL--------RE-KSA-TA--I-PSALYP--QESNFAAMVSKYNETQ--L
C6VS52          VQL----LEDHL--------RK-SPS-TA--I-PSLLYP--QESNFSALASTFNEMQ--L
A0A0P7X1V8      VAA----NSALE--------AYQQELDRL--T-PGLSEQ--LTASIAPRINQLQVFL--A
A0A3B0C2S4      AAL----LKNAV---------LGQSAYGL--L-PVDVGL--ENSGINSLVAEYNEMA--I
L8JI02          YTY----ISESL--------AEGRFGDVV--A-PSTFGL--EDPLLSSLLIELSKLN--Q
A6EBM4          IDQ----LRNTI--------TTEQTNTPL--N-LSLEGT--IDPLLATLAQNLNSLL--H
A0A416GA42      TRY----LKEFL--------LQPKNDKSL--I-PVNIGV--SETNLVNQIAEYNKMR--L
A0A4R5DL69      ISS----LQAFI----------KKNPNGI--I-PSSIVL--QSSDFTLLTDKYNTVQ--L
A0A1T3IYP5      AEM----MRSYL--------SAKGKQNNL--I-PNNTGL--VDASVENQIAEYNTTL--L
A0A1M4YED3      LDQ----IERYV--------TSRNNKDGV--A-PATLGL--NDRGLTSLVERLAEAE--A
A0A3P1Z8V4      ASF----LADHL--------RSSGKGKEV--I-PAVAGF--TNAALAQQITEYNRLV--L
A0A2N3U785      LQT----IEDYL--------TKSKNKSIL--V-PSTLNI--KDPTLQDLISRFNELQ--L
A0A0E3ZG78      LES----IESYL--------NKDENQYKM--V-PSTLSI--QDVTLMGLIARFNELQ--L
A0A1I6BRK6      LES----LENYL--------KNNNN--SI--V-PNSLGI--KDETLAKLIGRFNEVE--L
A0A243WAB1      LES----IENYL--------KRTNGQYSM--V-PSTLGI--KDETLLGLIGKFNELQ--L
A0A126PFG0      VST----IERTL--------RDPRPTAT---V-PTALGI--TDATLSSLVEKLTELH--A
A0A3M1N7Z3      LRR----VLDTL--------RQDPAAEV---A-FLPLGA--LPEVQVPLTE-LNQLL--E
A0A2H3NSN0      EQR----TLDML--------VNQLNEAESSFR-SDVEGE-QSVQSMQNRIAALDQQI--A
A0A2P6C324      EKR----TLSIL--------EDQMERAQPSLR-SAVLKE-QEVQSLRTQIQALEDQI--A
A0A1M6XHU0      EKS----ALQFI--------EQELQKLEPGLV-NELVKS-RQVATLEAQIDALSKKI--A
A0A5S9C8G0      EKS----ALQFI--------EQELQKLEPGLV-DELVKS-RQVSTLEAQIDALSKKI--A
G2SF81          EKS----ALQFI--------EQELQKLEPGLV-DELVKS-RQVSTLEAQIDALSKKI--A
A0A5S9EYW1      EKS----ALQFI--------EQELQKLEPGLV-DELVKS-RQVSTLEAQIDALSKKI--A
D0MHQ9          EKS----ALQFI--------EQELQKLEPGLV-DELVKS-RQVSTLEAQIDALSKKI--A
A0A4D7K1D4      IDK----VQAQL--------GNNEQLE----F-GSLTLE-NFPESITELIEEINVLE--T
A0A3C1ITV0      ARF----IREYL--------VDNTRQYDL--L-PSNSGV--GSQAIEEQIAEYNKRL--L
R7HN19          ARF----IREYL--------VDNTRQYDL--L-PSNSGV--GSQAIEEQIAEYNKKL--L
A0A060RD97      ANY----IKDYL--------LDPINANAL--I-PRVSGA--QNLGVDSQIDSYNELR--L
A0A0D3L8Q3      LNS----IEDYL--------RREGNEVGI--V-PSTLSI--TDHTLNRLIERYNELQ--L
A0A5B6TJH8      LRS----IEKYL--------SQDKGEYRM--V-PSSLGI--QDQTLMSLIGKFNELQ--L
A0A519U664      LES----LESYL--------RKNTGQYSI--V-PSSLGL--KDETLLGLIGKF-------
A0A519UDD1      LES----LERYL--------VTTAGRYTT--V-PSSLGI--KDGTLTSLIGKYNELQ--I
A0A519MA34      LES----LEGYL--------RKNAGQYSI--V-PSSLGL--KDETLLGLIGKFNELQ--V
A0A519UCX0      LES----LESYL--------RKNAGQYSI--V-PSTLGL--KDETLLVLIAKFNELQ--A
R7PCR1          ARY----LESYL--------HSKSKDDEF--I-PMLDL---GDAGIQQEISAYNDIL--I
A0A350IHV0      AKF----IKEYL--------KDPQHDGAL--I-PSNLGL--DSKTVDSQITEYNQMV--L
A0A1G9E2A9      LDE----LEAYV------NRVDSTLEVEF--I-PSTRAI--RDEQLLSLVNQLNTKR--I
A0A098LL25      LGE----LKDLI--------LGDQEVNSF--I-PALSQV--ENPQLSAAINSLNTLQ--E
A0A2T2YJE8      LNE----VDQLL--------NKSSNLDQM--I-PSLKEL--DDAQLLKQIAQLSDLQ--L
A0A127B287      LSD----------IQQRIRKGDDLSLVIS--S-LQLQEQ--QDPQLAQLLTELNDLQ--A
A0A3M9N829      YNT----------IQSKMQQDEDLGLIVA--G-LQGQPN--QDPQLSELLTELSQLQ--A
A0A0P0CSF9      LNT----------IQTKVQRNEDLGMIAS--S-IQGQEN--QDPQLAEQLTELSDLQ--A
A0A5M8QQB8      LNT----------IQAKVQRNEDLGMVVS--G-LQGQEG--QDPQLTEQLTELSDLQ--A
A0A3M9MNC3      LNT----------IQSKVQKNEDLGMIAS--T-IQGQEN--QDPQLAEQLTELSDLQ--A
A0A5B6TAX2      LNT----------IQAKVQRNEDLGMVVS--G-LQGQGN--QDPELAEQLTELSDLQ--A
A0A5N1IQ33      LAD----LTGLI-GQNRVFVREGQSLEQS--I-PAIGAL--ENPQIAEQISILNEQQ--G
A0A512AYT3      LKD----VARLV-SQAGQDEQESD-LEQV--I-PSLKAV--EDQELSSRISELSNLQ--L
A0A5M6CYN7      LRD----VAQLI-N------NDSE-LDQV--I-PSLKAV--EDQELSQRIAELSDMQ--L
A0A369QP10      LNE----IDQLI--------GRNTSLDQM--I-PSLKEL--DDEQLSNRISQLSNLQ--L
A0A126PDF2      LSE----ISRMV-QQTHITRNEDETIEQS--I-PGLGDI--NDPILSQLLSQLNGMQ--W
A0A2Z3GKA1      LSE----ISRMVQQQTHITRNENETIEQS--I-PGLGDI--NDPVLSQLLSQLNGMQ--W
A0A502GZP7      LND----IARVV-QQAHITRNENETIEQS--I-PGLGDI--NDPLLSQLLSQLNGMQ--W
A0A519SBU8      LAE----VRRLM-DSEQLTRNDDETVADN--I-PGLAEI--EDPILEKLLDQLDNEQ--R
A0A4Q3JNZ3      LAE----VGRMM-NRDQLTRTDDETVADN--L-PGLIEL--ADPVLTGMLEQLDAQQ--R
A0A519Q9V3      LSD----ISRLM-NRDQLTNNDDETVTDN--L-PGLAEL--EDQVLTGLLEQLDGQQ--R
A0A0M3RW20      LNG----VARLI-QRERITRDENVSVEQS--V-PGLVTL--EDPILTQQITELNLAQ--Q
A0A495VFX4      LIG----VARSV-QREHITRDENTSVEQS--V-PGLVTL--EDPVLTQQITELNLSQ--Q
A0A1S9B3W0      LTE----ITRLV-EQERLT-KDDETVEQS--I-PGLAAL--EDPVLSQQIGFLNEQQ--R
A0A1W1VRL3      LAD----LSSLV-EQDQLTANEDSTVAQS--I-PGLAEL--EDGRLTQEIEALNDQQ--W
A0A1M6R305      LNE----VAALA-EQGTITAREDLTVEES--I-PALATI--ENPQLSQQLTEVNSLQ--W
A0A4Z0PHK3      LGE----ITRLV-EEDRLTQSEDATLEQS--I-PGIAAF--EDGQLTGQLAELNNLQ--W
A0A2M9B9H9      LGE----ISRLV-EQDRLTQNEDATLEQS--I-PGIAAV--EDAQLTQQLSELNALQ--W
A0A4Z0QCY9      LGE----ITRLV-EQDRLTANEDATLEQS--I-PGIAAI--EDNQLTSQLTELNSLQ--W
A0A418R9X5      LAE----LSRLV-EQERLTSRQDGDVMQT--I-PALSTI--EDAQLTKRITELSDLQ--L
A0A428JSJ3      LAD----LARLV-EQERLTDREDGDVFQT--I-PALSTI--KDGQLLQRITELSNLQ--L
A0A428KI59      LAE----LARLI-EQERLTDREDGDVFQT--I-PALSTI--KDGQLTQRIIELSDLQ--L
W8F1I6          LAE----LARLI-EQERLTDREDGDVFQT--I-PALSTI--KDGQLTQRIIELSDLQ--L
A0A246FQC0      MND----VARLV-EQDRLTVRPDGDVMQS--I-PALAEV--KDGQLVQRITELSDAQ--L
A0A372E5P8      MSD----VGQLL-DREQLTTRADGDVMQS--I-PALADV--KDGQLIQRITELSDAQ--L
A0A1H3EMW1      MGD----VGRLL-QQEQLTTRADGDVMQS--I-PALAEV--KDGQLVQRITELSDAQ--L
A0A1H9ZSN3      MND----VGQLL-DREQLTTRADGDVMQS--I-PALAEV--KDAQLVQRITELSDAQ--L
A0A5N1J2M4      LDD----VSALL-AKN-------THVDQI--I-PTLGSL--QDQQLSEKIKELGTLQ--T
A0A519S476      LAE----VGRIM-ARDQLTRSDDETVAEN--L-PGLSEI--EDESLVSLLEELDTRQ--R
A0A4Q3JRW8      LSD----ISRLM-NREQLTRNDDETVADN--L-PGLAEL--DDPTLVALLDQLDGQQ--R
A0A519M923      LAD----VSRLM-NRDQMTRNDDETVAET--L-PGLVEL--DDPVLMGMLDQLDGQQ--R
A0A4Z0ENW1      LSE----VSRLT-SAEYLTPSDEVTVDQT--I-PGLALL--EDPALSQQLNNLNILQ--Q
A0A519UDB4      LTE----VGRLA-SQELIMTNENSTLAES--I-PGLAIL--NDGPITQQLNDLHILQ--Q
A0A3S0QKV1      LTQ----VSRLV-QQERITSRDDETVEQS--I-PGLALL--EDPQLTQLMSVLNEQQ--R
A0A328BL48      LQE----LSRVV-ETERLIGSDELTVEES--I-PGLAVL--QDPQISQQLTVLNEQQ--R
A0A5R8WLY4      LQE----LSRVV-EKDRVVGSDELTVEES--I-PGLAVL--QDPQISQQLTALNEQQ--R
A0A1I5WSL8      LTE----IEVMA-RQDRLTRDETQTVEQS--M-PAIVGI--EDAQLLQQLNELNNLQ--W
A0A0U3JVM7      LGE----IAQMA-SQGSLTRDETQTVEQS--I-PALAGI--EDPQLAQQLNELNDLQ--W
A0A1G1SSV2      LAE----IANMA-NQDRLTRDETQTVEQS--L-PALAGI--EDAQLGQELNQLNSLQ--W
A0A1G1SXV7      LAA----ITNMA-NQERLTRDETQTVEQS--L-PALAGI--EDAQLGQELNQLNSLQ--W
A0A0W8EDI5      IGE----IAQLV-EQNQVMVQEGDDIEQS--I-PALAIL--EDAQLTQQIGVLNDQQ--A
A0A3B7RBP8      LAE----VASLV-QQNRVLTREGETIEQS--I-PALTVL--EDAQLSQQIALLNDQQ--A
A0A3R9P8H7      LND----VARLI-EQDRLTDRADGDVLQS--I-PALTDA--KDGQLVARIQELSDAQ--L
A0A238WIA7      LRN----LSNQI-ESNQFVAREDVSAEQS--I-PALAEI--KAPELTERIGELYGLQ--L
A0A212UCJ7      LRS----LNSQI-AQNRIVASEERSAEQS--I-PALAEL--KAPELAARIGELYDLQ--L
A0A4Z0MQE1      LRS----LNSQI-EQNRIIAVEGRSAEQS--I-PALAEV--KAPELTERISELYGLQ--L
A0A4Z0PCF4      LRN----LNGQI-EQNRFVAVEGVSAEQS--I-PALAEL--KSPELTERVSELYGLQ--L
A0A5D6VDG1      LTS----VARLT-SRDRIARDENASIDQS--V-PGLSQL--EDPVLTQQITELNAAQ--Q
A0A243WHR7      LDE----IVALV-ESNQLTNSEEASISES--I-PGLKQL--GDEQVTQQINRLNDLQ--W
A0A5B8A0P6      LEE----VSRLV-EQERLTTSEDLTVEKS--I-PGLALL--EDPGLTEQLTELNNQQ--Y
A0A076HRT9      LNE----VADLA-ERGTITSREDLTVEQS--I-PALATL--ENSQLSQQLGELNDLQ--W
A0A4Z0PVM7      LGE----ITNLV-EQGRLTESEDATLEQS--I-PGISAI--EDNQLTSQLTELNSLQ--W
A0A1M6DHW8      LSN----VARLV-EQDRLIASDEATLEEG--I-PGIALL--DDSPLTQQLSELNDLQ--R
A0A4Q5LC61      LGE----VTRLV-EQDRLVASEEATLEES--I-PGLATL--EDSPLTQQLEELNQLQ--Q
A0A2A8CVM9      AQF----EPGLR--------ETVQQEQEASGL-RSEISV--LERKIGEMRAEAAQYY--V
A0A3C0ZQC7      LSK----TLTSY--------QEELAKQEP-NV-AKAIGE-ANDPYIRLLQEQLAMLE--V
A0A2E3R1D0      KRA----ELAAL--------QSELSRLES-QL-GTRLSS-NLDSELAAARERIQQLN--A
A0A2T2USC0      ESS----ALQSL--------KEELANIRP-NL-AERIAS-GLGEELSQVQKEKAEVA--S
A0A2T2V0F3      KQS----ALTSK--------QEELANIRP-NL-AERISS-GLEEELSQVQREKAQVT--A
A0A2T2S682      AES----ALNTK--------KKELKRIRP-RL-AERLSS-GIQTELKQVQQEKANVA--A
D5H561          EQS----SLESL--------REELESIQPGQL-SDQLAS-TVDQEISSLQSEIAKLE--L
A0A2H3NWA9      TRA----RFNAQ--------QDNIESIEP-QL-AERLAS-NIDSELARVQEERAELK--Q
A0A2A8CVB6      ART----SLDEK--------RSELEKIEP-QI-SDRLSS-TTGDVLESVQEEKARLQ--A
A0A2P6C1S6      QQA----ALETQ--------KEELGTIEP-KL-AERLSS-SLGQRLSSLQTEQAELE--S
A0A2T2UTM4      KQA----TLETR--------KEELRQIEP-KL-AERLSS-DLGEKLSTFQTEKAELE--V
R5RVP0          AKF----IKEYL--------ENPAHSGAL--I-PANSGL--TSTTVEAQIKEYNSLV--L
R6A0L2          AKY----LDEYL--------HTHSNSHDL--I-PA-LNV--GDASFNTQIAAYNDQM--N
R7LG80          AQY----LYNYL--------DNQTNDRDL--I-PA-LSL--KDASFNTTIDKYNQLQ--M
A0A2L2WX98      ARY----LTQYL--------QNSSKRNET--V-PV-LSL--PEASFTPLIGEYNNQM--L
A0A285T4L1      AQF----IKEYL--------TDPTKNRDL--I-PSGTGI--SDASVEGQINQYNALK--L
G5GD56          ARY----LQEFL--------QNNSNEHQI--I-PA-INL--ERATFNGQIDTYNQLM--N
R5KD55          AGY----IRDYI--------TNRANTNQL--L-PANMGL--DDGKTDGLIDKYNALQ--L
A0A174QNT3      VEF----IKKYV--------TDKSKSADL--I-PNVSGV--GDAGVQTQIEDYNEMM--L
A0A4S2FGS1      VEF----VKNYV--------TDKTRSSDL--I-PNVSGV--GDVGVQSQIESYNEMM--L
R9I0H0          VEF----VKNYV--------TDKTRSSDL--I-PNVSGV--GDVGVQSQIESYNEMM--L
K5BUT9          ARS----IKSYL--------ADVTRKDQL--I-PNVTGV--GDVSMQSQITAYNELM--L
A0A174FPA3      ARS----IKTYL--------ADVTRKDQL--I-PNVTGV--GDVSMQSQITAYNELM--L
R6S9Y6          ARS----IKTYL--------ADVTRKDQL--I-PNVTGV--GDVSMQSQITAYNELM--L
A0A642LIH6      ARS----IKTYL--------ADVTRKDQL--I-PNVTGV--GDVSMQSQITAYNELM--L
C9KX15          ARS----IKTYL--------ADVTRKDQL--I-PNVTGV--GDVSMQSQITAYNELM--L
R6DAG6          AQS----IKSYL--------LDATRNNQL--I-PNVSGV--GDASVQSQITAYNELM--L
A0A3L8AAP1      AQS----IKSYL--------LDATRNNQL--I-PNVSGV--GDASVQSQITAYNELM--L
A0A4S2AYX2      AQS----IKSYL--------LDATRNNQL--I-PNVSGV--GDASVQSQITAYNELM--L
A0A4Y9H477      AQS----IKSYL--------LDATRNNQL--I-PNVSGV--GDASVQSQITAYNELM--L
A0A0E2M2Y7      AKY----IQSFL--------RQTSTDNEL--M-PANLGL--TERGIDNSITLYNDLK--L
A0A0K2J6Z0      AKY----IQSFL--------RQTSTDNEL--M-PANLGL--TERGIDNSITLYNDLK--L
B2RKZ8          AKY----IQSFL--------RQTSTDNEL--M-PANLGL--TERGIDNSITLYNDLK--L
A0A212GC82      AKY----IQSFL--------RQTSTDNEL--M-PANLGL--TERGIDNSITLYNDLK--L
A0A254MU12      AKY----IQSFL--------RQTSTDNEL--M-PANLGL--TERGIDNSITLYNDLK--L
R6CQ93          AQF----IKEYL--------TDPTKSRDL--I-PSGTGI--SDASVEGQINQYNSLK--L
A0A3D1NQW3      TEF----LKEYL--------LDPTKTNEL--I-PGTLSI--NSPAINSQIEGYNTEL--Q
B0MT10          TEF----LKEYL--------LDPTKTNEL--I-PGTLSI--NSPAINSQIEGYNTEL--Q
R7JGW9          TEF----LKEYL--------LDPTKTNEL--I-PGTLSI--NSPAINSQIEGYNTEL--Q
A0A414Q925      AQY----MKEYL--------QDNSKTTEL--V-PASIGI--DDMGVQNLIMEYNTVL--T
A0A415PUS9      AQY----MKEYL--------QDNSKTTEL--V-PASIGI--DDMGVQNLIMEYNTVL--T
A0A108TCU0      AQY----MKEYL--------QDNSKTTEP--V-PASIGI--DDMGVQNLIMEYNTVL--T
A0A413BA42      AQY----MKEYL--------QDNSKTTEP--V-PASIGI--DDMGVQNLIMEYNTVL--T
S3Y344          AQY----MKEYL--------QDNSKTTEP--V-PASIGI--DDMGVQNLIMEYNTVL--T
A0A4Q5G8Y8      AQY----MKEYL--------QDNSKTTEP--V-PASIGI--DDMGVQNLIMEYNTVL--T
A0A412TGL3      AQY----MKEYL--------QDNSKTTEP--V-PASIGI--DDMGVQNLIMEYNTVL--T
A0A413VJ33      AQY----MKEYL--------QDNSKTTEP--V-PASIGI--DDMGVQNLIMEYNTVL--T
A0A414L0W6      AQY----MKEYL--------QDNSKTTEP--V-PASIGI--DDMGVQNLIMEYNTVL--T
A0A412DP39      AQY----MKEYL--------QDNSKTTEP--V-PASIGI--DDMGVQNLIMEYNTVL--T
A0A413ZSE8      AQY----MKEYL--------QDNSKTTEP--V-PASIGI--DDMGVQNLIMEYNTVL--T
B0NP84          AQY----MKEYL--------QDNSKTTEP--V-PASIGI--DDMGVQNLIMEYNTVL--T
R6AK43          AQY----MKEYL--------QDNSKTTEP--V-PASIGI--DDMGVQNLIMEYNTVL--T
A0A412N2D9      AQY----MKEYL--------QDNSKTTDP--I-PASIGI--DDMGVQNLIMEYNTVL--T
A0A1Y4JYS9      AQY----MKEYL--------QDNSKTTDP--I-PASIGI--DDMGVQNLIMEYNTVL--T
R6LHA4          AQY----MKEYL--------QDNSKTTDP--I-PASIGI--DDMGVQNLIMEYNTVL--T
A0A3D2BF46      AQY----IRDYL--------LNDTKLRDL--I-PANVAI--TNVSISDQIKNYNELM--L
A0A4Y1WUN1      AQY----IRDYL--------LNDTKLRDL--I-PANVAI--TNVSISDQIKNYNELM--L
A0A4Y1XL94      AQY----IRDYL--------LNDTKLRDL--I-PANVAI--TNVSISDQIKNYNELM--L
A0A358R538      ARF----VSDYL--------RDPAHAGEL--I-PMAASV--ASETVAAQIDRYNEAI--L
A0A1Y4AAB8      AEF----IRSYL--------LDREHAGDL--I-PAMAAI--ANSGITEQISAYNEGI--L
A0A1Y3WWY9      AQF----IRSYL--------SDPSKAGEL--I-PAMASV--TNAAVSAQIDEYNTSI--L
A0A1Y4U5L4      AQF----IRSYL--------SDPSKAGEL--I-PAMASV--TNAAVSAQIDEYNTAI--L
A0A1Y3VCJ1      AEF----VRGYL--------ADPAKSGEL--I-PAMAAI--SNGAVTAQIDEYNATI--L
A0A1Y3QTW7      ANY----IRDYL--------NNPTHAGEL--I-PMVASL--TNNGIVAQITEYNDAI--L
R6XWY7          ANY----IRDYL--------NNPTHAGEL--I-PMVASL--TNNGIVAQITEYNDAI--L
A0A4Y1X9Y9      ANY----IRDYL--------DDPSHAGDL--I-PMVASL--TNNGIVAQITEYNDAI--L
A0A4Y1WM66      ANY----IRDYL--------DDPSHAGDL--I-PMVASL--TNNGIVAQITEYNDAI--L
A0A174AVF1      ANY----IRDYL--------DDPSHAGDL--I-PMVASL--TNNGIVAQITEYNDAI--L
A0A656Q4F4      ANY----IRDYL--------DDPSHAGDL--I-PMVASL--TNNGIVAQITEYNDAI--L
A0A1Q6EIY0      ADF----IREYL--------NDPSHAGDL--I-PMVASM--TNNGIVAQISEYNEAI--L
A0A5B5VN71      ADF----IREYL--------NDPSHAGDL--I-PMVASM--TNNGIVAQISEYNEAI--L
E4M8L3          ADF----IREYL--------NDPSHAGDL--I-PMVASM--TNNGIVAQISEYNEAI--L
I3YQ50          ADF----IREYL--------NDPSHAGDL--I-PMVASM--TNNGIVAQISEYNEAI--L
R5UEY8          ADF----IREYL--------NDPSHAGDL--I-PMVASM--TNNGIVAQISEYNEAI--L
A0A1H4D866      AEF----IRTYL--------NDPKNAGEL--I-PMMASV--TNQGISSQIADYNNAI--L
A0A5B3G4Y7      AEY----IRTYL--------NDPKNVGEL--I-PAMAAA-GTNTAIAKQIEDYNSAI--L
A0A374A9J5      AEY----IRTYL--------NDPKNVGEL--I-PAMAAA-GTNTAIAKQIEDYNSAI--L
A0A5B3GQN5      AEY----IRTYL--------NDPKNVGEL--I-PAMAAA-GTNTAIAKQIEDYNSAI--L
A0A1Q6E9S3      AEY----IRTYL--------NDPKNVGEL--I-PAMAAA-GTNTAIAKQIEDYNSAI--L
D4IJ36          AEY----IRTYL--------NDPKNVGEL--I-PAMAAA-GTNTAIAKQIEDYNSAI--L
A0A3E5HPT8      VSF----IKQYL--------QDSNKDDEL--I-PSNIGL--SDLSIESQISRYNETL--L
C6IJ48          VSF----IKQYL--------QDSNKDDEL--I-PSNIGL--SDLSIESQISRYNETL--L
Q8A3U2          VSF----IKQYL--------QDSNKDDEL--I-PSNIGL--SDLSIESQISRYNETL--L
A0A3R6S1H6      ARS----IKEYL--------HDPQHERDL--I-PSNTGI--PDVNIEQSIGKYNEML--L
A0A3R6SD81      ARS----IKEYL--------HDPQHERDL--I-PSNTGI--PDVNIEQSIGKYNEML--L
A0A354WXN6      AKY----IKEYL--------IDPSHNADL--I-PANTGV---DVNVESDISEYNTML--L
R5IP14          VNF----IKDYL--------SDPVKINDL--I-PANTGI--ESAEISGAISEYNQLL--L
A0A316SZX7      ALF----IKEYL--------SDEKHVSEL--L-PANTGV--ADLGINEQIKEYNTLL--L
A0A1Y4AIY1      AQY----IRDYL--------SDPQKALDL--I-PANT-I--TDVTVEQQIAAYNEML--L
F3ZRU7          GQY----IKDYL--------IDPANRGKL--I-PANTGI--SDNTTEGQIKEYNTML--L
A0A0J6CIR2      AKY----IRDYL--------TDPHKSSDL--I-PANTGI--ADVNIEGQISEYNNLL--L
A0A3D8HG59      ARY----IRSYL--------VDPSKEAEL--I-PANTGI--SDSNVESQIGEYNALL--L
A0A3R6S408      ARY----IRSYL--------VDPSKEAEL--I-PANTGI--SDSNVESQIGEYNALL--L
A0A1C5Q1F3      ALY----IRDYL--------ADPAKSGEL--I-PSNTGI--SDGTIERQIMEYNELM--L
R7A239          ALY----IRDYL--------ADPAKSGEL--I-PSNTGI--SDGTIERQIMEYNELM--L
A0A3R6HIK7      AKY----IRDYL--------SDPQKALEL--I-PANT-I--TDMKVEQQISTYNEML--L
K5ZVW7          AKY----IRDYL--------SDPQKALEL--I-PANT-I--TDMKVEQQISTYNEML--L
A0A1Y4D5Z0      AKY----VREYL--------SDPHKASDL--L-PANT-L--SDVNIEQQIAEYNTQL--L
A0A413VXJ7      AKY----IKDYL--------VDPQKNADL--I-PANTGI--SDNSVESQISEYNEML--L
I9RSN9          AKY----IKDYL--------VDPQKNADL--I-PANTGI--SDNSVESQISEYNEML--L
U6RJK5          AKY----IKDYL--------VDPQKNADL--I-PANTGI--SDNSVESQISEYNEML--L
A0A1Q6GA32      AKY----IKDYL--------VDPQKNADL--I-PANTGI--SDNSVESQISEYNEML--L
I9RPU6          ARY----IKEYL--------TDPQKNSDL--I-PANTGI--SDNSVEAQIKEYNDIL--L
I8YFS5          VKY----IKEYL--------VDPQKSSDL--I-PANTGI--SDTSVEAQIKEYNDML--L
A0A4Q5F7I7      VKY----IKEYL--------VDPQKGSDL--I-PANTGI--SDNSVESQIKEYNDML--L
I8Y597          VKY----IKEYL--------VDPQKGSDL--I-PANTGI--SDNSVESQIKEYNDML--L
A0A1Q6GBF5      ARY----IKEYL--------TDPLKNSDL--I-PANTGI--SDNSVESQIKEYNDIL--L
I8YFZ3          VRY----IKEYL--------TDPQKNSDL--I-PANTGI--SDNSVESQIKEYNDIL--L
A0A4V1YNX8      ARY----IKEYL--------TDPQKSSDL--I-PANTGI--SDNSVESQIKEYNDVL--L
A0A1Q6GDH2      AKY----IKEYL--------TDPQKNSDL--I-PANTGI--SDNSVESQIKEYNDIL--L
U6RSB0          ARY----IKEYL--------TDPQKSSDL--I-PANTGI--SDNSVESQIKEYNDIL--L
I9GXM2          AKY----IKEYL--------TDPQKSSDL--I-PANTGI--SDNSVEFQIKEYNDIL--L
I9SIK1          AKY----IKEYL--------TDPQKSSDL--I-PANTGI--SDNSVESQIKEYNDVL--L
A0A4Q5FNG1      AKY----IKEYL--------TDPQKSSDL--I-PANTGI--SDNSVESQIKEYNDVL--L
I9TP59          AKY----IKEYL--------TDPQKSSDL--I-PANTGI--SDNSVESQIKEYNDIL--L
R5S343          AKY----IREYL--------TDTRTRGKL--I-PANTGL--TDMNMEGRIGEYNELL--L
A0A1M6K7I9      AEY----IKQYL--------VDPSKVADL--I-PANTGI--TDAGVEKQIAEYNEIL--L
A0A5M6A8C8      AEY----IKQYL--------VDPSKIADL--I-PANTGI--TDAGVEKQIAEYNEIL--L
A0A4V1YPN7      AKY----IKEYL--------IDPQKNSDL--I-PANTGI--SDNSVEAQIKEYNDML--L
A0A4Q5F874      SKY----IKEYL--------VDPQKNSDL--I-PANTGI--SDNSVESQIKEYNDML--L
A0A641LV22      SKY----IKEYL--------VDPQKNSDL--I-PANTGI--SDNSVESQIKEYNDML--L
A0A3R5ZMK1      AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A0A3E4ZTK7      AKY----IKNYL--------TDPGKSSEL--I-PANTGI--SDVNIESQIGEYNEML--L
A0A1Y3ZIA4      AKY----IKNYL--------TDPGKNSDL--I-PANTGI--SDVNIESQIGEFNEML--L
K5Y1A4          AKY----IKNYL--------TDPGKNSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A0A4Q5CIT0      AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A0A3R6K8X4      AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A0A414GI87      AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A0A415BDM7      AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A0A412DM15      AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A7AEU7          AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A0A1Q6I3T6      AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A0A414XX40      AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A0A3R6BKI7      AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A0A414LPI6      AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A0A412M2W1      AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
K5ZX55          AKY----IKNYL--------TDPGKSSDL--I-PANTGI--SDVNIESQIGEFNEML--L
A0A5F0U645      AKY----IREYL--------TDPHKGADL--I-PANTGI--SDVSLESQISEYNTLL--L
K5ZBN2          AKY----IREYL--------TDPHKGADL--I-PANTGI--SDVSLESQISEYNTLL--L
A0A0J6CKW3      AKY----IREYL--------TDPHKGADL--I-PANTGI--SDVSLESQISEYNTLL--L
A0A0F5IQM7      AKY----IREYL--------TDPHKGADL--I-PANTGI--SDVSLESQISEYNTLL--L
A0A496CDT3      AKY----IREYL--------TDPHKGADL--I-PANTGI--SDVSLESQISEYNTLL--L
S0GLB0          AKY----IREYL--------TDPHKGADL--I-PANTGI--SDVSLESQISEYNTLL--L
A0A3R6NLC1      AKY----IREYL--------TDPHKGADL--I-PANTGI--SDANVESQISEYNALL--L
A0A416WYC9      AKY----IREYL--------TDPHKGADL--I-PANTGI--SDANVESQISEYNALL--L
A0A0F5IT40      AKY----IRDYL--------TDPHKSSDL--I-PANTGI--ADVNIEGQISEYNNLL--L
A0A496CX20      AKY----IRDYL--------TDPHKSSDL--I-PANTGI--ADVNIEGQISEYNNLL--L
A0A5F0UBI0      AKY----IRDYL--------TDPHKSSDL--I-PANTGI--ADVNIEGQISEYNNLL--L
S0GSI7          AKY----IRDYL--------TDPHKSSDL--I-PANTGI--ADVNIEGQISEYNNLL--L
K5YB65          AKY----IRDYL--------TDPHKSSDL--I-PANTGI--ADVNIEGQISEYNNLL--L
A0A0F5IWP9      AKY----IRDYL--------IDPHKSSDL--I-PANTGI--ADVNIEGQISEYNNLL--L
A0A0F5IZT8      AKY----IRDYL--------IDPHKSSDL--I-PANTGI--ADVNIEGQISEYNNLL--L
A0A417LKQ2      AKY----IRDYL--------TDPHKSSDL--I-PANTGI--ADVNIEGQISEYNNLL--L
A0A416TME1      AKY----IRDYL--------TDPHKSADL--I-PANTGI--ADVNIEGQISEYNNLL--L
A0A416XPE8      AKY----IRDYL--------TDPHKSADL--I-PANTGI--ADVNIEGQISEYNNLL--L
A0A5C8KAD6      LDQ----IEKFV--------VSRNSSTGS--I-PSTLGI--NDPILSDLLQKLQNLE--I
A0A5N1J695      LQK----VENYV--------ISKNKATGI--V-PSTLGV--NDPVLEQLLQKLYNAE--T
A0A1H4ADG3      TNS----LIEYM--------HSQNGNDRV--V-PASLTI--NDGSLSAIIDNYNKLL--L
A0A5B8VUR8      TNS----LIGYM---------SQNGNDRV--I-PASLTI--NDGNLNTIIDSYNKLL--L
A0A2A4G4B1      ALL----MKKSV--------LEGG--IQL--L-PTNIGL--DHSGVKETIDNFNQLI--L
A0A3N2M1H3      TTY----MKDFL--------DDSANKFNI--I-PANTGL--DNPSIEKDIATYNTIL--L
A0A4S2G8T2      TTY----MKDFL--------DDSANKFNI--I-PANTGL--DNPSIEKDIATYNTIL--L
A0A212K7W5      AKY----ILSHL--------KDSRTKDML--L-PANLGI--EGTNIDRQINEYNTLL--L
F5IU11          AKY----ILSHL--------KNPRTKDIL--L-PANLGI--EGANIEGQINEYNTLL--L
A0A3N2N6F7      TRF----LIDYM--------QSPANKGKL--L-PGNLGI--ENQGIVAQITEYNNLQ--L
A0A4P7VVU7      SKF----ILDYI--------KNPDTNGQL--V-PANAGL--ENPGIEAQINEFNQLQ--L
A0A2V1ILM4      SKF----ILDYI--------KNPDTNGQL--V-PANAGL--ENPGIEAQINEFNQLQ--L
A0A3N2L0E8      SKF----ILDYI--------KNPDTNGQL--V-PANAGL--ENPGIEAQINEFNQLQ--L
A0A3N2LFC5      SKF----ILDYI--------KNPDTNGQL--V-PANAGL--ENPGIEAQINEFNQLQ--L
A0A553LCN8      AQS----IKSYL--------MDVTRNNQL--I-PNVSGV--GDASVQNQITAYNELM--L
K0XJ09          ARA----VERYL--------TDNENGKQL--I-PNVSGV--GDSGLQNQITTYNEIL--L
R5EUZ0          ARA----VERYL--------TDNEHSKQL--I-PNVSGV--GDSGLQNQITTYNEIL--L
W0EQS0          AQA----VQKAF--------SGKENNKQL--I-PNVSGV--GDAGLQSQIEAYNAMI--L
A0A1Y3WE15      AQA----VQRAF--------ANEKGDKQL--I-PNVSGV--GDAGLQKQIESYNEML--L
A0A1Y4GUK3      AQA----VHRAF--------TNDKDNKQL--I-PNVSGV--GDAGLQSQIEAYNEML--L
A0A352Z1R7      VEF----ALDAL--------NSTLRKGNI--Y-SPAIMR--DDPLVAGLATKLSELE--I
A0A0A2F501      ARY----IRQHL--------GTDTNATQL--I-PAISGI--GNKLIDQQIGEYNQKM--L
R5B7P0          ARY----IKDYI--------GKEDNRNQP--L-PANMGL--SSQTIENGISEYNSKI--L
R5B0L5          TRY----LRNYL--------GSESSRNQP--L-PVNVGS--GSPAIESQIAQYNDAM--L
A0A374THP7      AQY----IRNYL--------TGKVGKNQL--L-PSNTGI--ESPGIEQQIAEYNKSQ--L
A0A3R5XWG1      AQY----IRSSL--------VGRVSKNQV--L-PSNTGI--DSPGIEQQIAEYNKTL--L
A0A5P0Y910      AQY----IRSSL--------VGRVSKNQV--L-PSNTGI--DSPGIEQQIAEYNKTL--L
A0A5P0XQC0      AQY----IRSSL--------VGRVSKNQV--L-PSNTGI--DSPGIEQQIAEYNKTL--L
A0A414YFM3      AQY----IRSSL--------VGRVSKNQV--L-PSNTGI--DSPGIEQQIAEYNKTL--L
A0A5P0VXP6      AQY----IRSSL--------VGRVSKNQV--L-PSNTGI--DSPGIEQQIAEYNKTL--L
A0A5P0W892      AQY----IRSSL--------VGRVSKNQV--L-PSNTGI--DSPGIEQQIAEYNKTL--L
A0A0A2EVS5      ARY----IRGHI---------TGGQGREL--L-PVNSGI--NSPVIEREISEYNETL--L
A0A1T4NAJ7      ARY----IRGHI---------TGGQGREL--L-PVNSGI--NSPVIEREISEYNETL--L
A0A255T941      AQY----IRHEL---------TSKSIDQT--L-PTNSGI--ANANIETQINNYNNMV--L
A0A3N2KCL3      TLY----IKSYL--------GAASDNEKM--L-PMNSGV--ANVDIQSQITDYNNLV--L
A0A4P7VSV0      TLY----IKSYL--------GAASDNEKM--L-PMNSGV--ANVDIQSQITDYNNLV--L
A0A2V1IJY1      TLY----IKSYL--------GAASDNEKM--L-PMNSGV--ANVDIQSQITDYNNLV--L
A0A4P7VXK7      TLY----IKSYL--------GAASDNEKM--L-PMNSGV--ANVDIQSQITDYNNLV--L
A0A1Y4CHN5      AKY----IKSYL--------AAGESQNQL--L-PANSGI--SGGNIENQISEYNTAQ--L
A0A1M6I2S6      AQY----IRREL---------NNKELSQL--L-PTNSGI--ANVNIESQIGEYNTMV--L
A0A1Y3V692      AQY----IRREL---------NNKELSQL--L-PTNSGI--ANVNIESQIGEYNTMV--L
F3PXM2          ARY----IRGEL---------NGKGLTQL--L-PANSDI--GNSHIESLIGEYNAQV--L
A0A3E4ZNL4      AQY----IRREL---------NSKDMNQP--L-PTNSGI--SSVNIESQIGEYNKMV--L
A0A174AHH7      AQY----IRREL---------NSKDMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A174JCE8      AQY----IRREL---------NSKDMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A3E4JMC4      AQY----IRREL---------NSKDMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A412SND6      AQY----IRREL---------NSKDMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A414IEQ9      AQY----IRREL---------NSKDMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A415UKN5      AQY----IRREL---------NSKDMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A0M1W8D8      AQY----IRREL---------NSKDMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A3R6GKX5      AQY----IRREL---------NSKEMNQP--L-PTNSGI--ANVNIESQIGEYNKIV--L
A7V4S1          AQY----IRREL---------NSKEMNQP--L-PTNSGI--ANVNIESQIGEYNKIV--L
B0NU19          AQY----IRREL---------NSKEMNQP--L-PTNSGI--ANVNIESQIGEYNKIV--L
D4V601          AQY----IRREL---------NSKEMNQP--L-PTNSGI--ANVNIESQIGEYNKIV--L
A0A4Q0U3M9      AQY----IRREL---------NSKEMNQP--L-PTNSGI--ANVNIESQIGEYNKIV--L
A0A4R4H1Q2      AQY----IRREL---------NSKEMNQP--L-PTNSGI--ANVNIESQIGEYNKIV--L
A0A397WLT5      AQY----IRREL---------NSKEMNQP--L-PTNSGI--ANVNIESQIGEYNKIV--L
A0A3R6GM96      AQY----IRREL---------NSKEMNQP--L-PTNSGI--ANVNIESQIGEYNKIV--L
A0A015XH67      AQF----IRREL---------GGKEMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A078RZN2      AQF----IRREL---------GGKEMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A4R4I3T9      AQF----IRREL---------GGKEMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A6L0K5          AQF----IRREL---------GGKEMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A7ACT5          AQF----IRREL---------GGKEMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A6KY94          AQF----IRREL---------GGKEMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A173UQR8      AQF----IRREL---------GGKEMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A3R6HK75      AQF----IRREL---------GGKEMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A412B7D1      AQF----IRREL---------GGKEMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A412VNY9      AQF----IRREL---------GGKEMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A414LTU9      AQF----IRREL---------GGKEMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
I9Q4U4          AQF----IRREL---------GGKEMNQP--L-PTNSGI--ANVNIESQIGEYNKMV--L
A0A373ISF0      ARY----ILKEL---------KEKSLSQP--L-PTNSGI--ANSNIESQISEYNNMV--L
U6RF62          ARY----ILKEL---------KEKSLSQP--L-PTNSGI--ANSNIENQISEYNNMV--L
A0A662ZZD5      AQY----IRKEL---------NNKKLSQL--L-PTNSGI--ANVNIESQIGEYNTIV--L
A0A395YYT3      AQY----IRKEL---------NNKKLSQL--L-PTNSGI--ANVNIESQIGEYNTIV--L
A0A642JYJ3      AQY----IRKEL---------NNKKLSQL--L-PTNSGI--ANVNIESQIGEYNTIV--L
A0A015UXN7      AQY----IRKEL---------NNKKLSQL--L-PTNSGI--ANVNIESQIGEYNTIV--L
A0A5M5W148      AQY----IRKEL---------NNKKLSQL--L-PTNSGI--ANVNIESQIGEYNTIV--L
A0A3A5TI83      AQY----IRKEL---------NNKKLSQL--L-PTNSGI--ANVNIESQIGEYNTIV--L
A0A415NEB6      AQY----IRKEL---------NNKKLSQL--L-PTNSGI--ANVNIESQIGEYNTIV--L
A7AJ60          AQY----IRKEL---------NNKKLSQL--L-PTNSGI--ANVNIESQIGEYNTIV--L
A0A016E4F9      ARY----IRKEL---------NNKELDQL--L-PTNSGI--ANVNIESQIGEYNTMV--L
A0A4Q5CFJ7      ARY----IRKEL---------NNKELGQL--L-PTNSGI--ANVNIESQIGEYNTMV--L
A0A108TH71      AQY----IRREL---------NTKQLDQT--L-PANSGI--VSANIETQISEYNNLV--L
I8VXH0          AQY----IRREL---------NTKQLDQT--L-PANSGI--VSANIETQISEYNNLV--L
A0A412S0N6      AQY----IRREL---------NTKQLDQT--L-PANSGI--VSANIETQISEYNNLV--L
A0A412IIJ0      AQY----IRREL---------NTKQLDQT--L-PANSGI--VSANIETQISEYNNLV--L
A0A0P0FM97      AQY----IRREL---------NTKQLDQT--L-PANSGI--VSANIETQISEYNNLV--L
R6KTP3          AQY----IRREL---------NTKQLDQT--L-PANSGI--VSANIETQISEYNNLV--L
A0A139LU87      AQY----IRREL---------NTKQLDQT--L-PANSGI--VSANIETQISEYNNLV--L
A0A1C6B3Y5      AQY----IRREL---------NTKQLDQT--L-PANSGI--VSANIETQISEYNNLV--L
E2NMQ4          AQY----IRREL---------NTKQLDQT--L-PANSGI--VSANIETQISEYNNLV--L
A0A412YDB9      AQY----IRREL---------NTKQLNQT--L-PTNSGI--VSANIETQISEYNNLV--L
R7DY01          AQY----IRREL---------NTKQLNQT--L-PTNSGI--VSANIETQISEYNNLV--L
A0A414LGK8      AQY----IRREL---------NTKQLNQT--L-PTNSGI--VSANIETQISEYNNLV--L
A0A415IPQ4      AQY----IRREL---------NAKQPDQP--L-PTNSGI--VNANIETLISEYNNLV--L
A0A3E5BRW7      AQY----IRREL---------NAKLLDQP--L-PANSGI--VNANIETLIGEYNNLV--L
K9DXS6          AQY----IRREL---------NAKLLDQP--L-PANSGI--VNANIETLIGEYNNLV--L
A0A1M6KFV3      AQY----IRREL---------NSKQLNQP--L-PANSGI--VNANIETLISEYNNLV--L
A0A1Q6G7L3      AQY----IRREL---------NSKQLNQP--L-PANSGI--VNANIETLISEYNNLV--L
A0A413H235      AQY----IRREL---------NSKQLNQP--L-PANSGI--VNANIETLISEYNNLV--L
A0A1M5B2J8      ARY----IRNYL--------TSETNRFQL--L-PANSGI--DNPNIASQINEYNNQL--L
A0A255RCT5      ARY----IRNYL--------TSETNRFQL--L-PANSGI--DNANIGSQITEYNNQL--L
A0A1Y4GLF5      ARY----IRNYL--------ANDANKSQL--L-PANSGI--DNGNIESQISEYNRQL--L
A0A1H3XSC0      TRY----IRNYL--------TNDANKNQL--L-PANSGI--ESANIESQIAEYNRQL--L
A6LE40          TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A4Y1VPX5      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
B3JI46          TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
R6NN15          ARY----IRNYL--------TAASSRNQL--L-PANSGL--ESANIENQISEYNNLQ--L
A0A358R8U0      TRY----VRNYL--------SDENNRTQL--L-PANSGI--ESTNIESQISEYNTKL--L
R6WSB6          TRY----VRNYL--------SDENNRTQL--L-PANSGI--ESTNIESQISEYNTKL--L
A0A4Q5ENK6      ARY----IKNYL--------TNENNKHQL--L-PANSSI--ENASLATQLNEYNTKL--L
A0A401LPX7      ARY----IKNYL--------TDENNKYQL--L-PANSGI--ENASLSTQLNEYNTKL--L
A0A3A5Z900      ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENANLATQLNEYNTKL--L
A0A3R6EGW5      ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENASLATQLNEYNTKL--L
A0A285TGL6      ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENASLATQLNEYNTKL--L
A0A3A5RFX4      ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENASLATQLNEYNTKL--L
A0A1Q6IUW9      ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENASLATQLNEYNTKL--L
A0A3R6NPG7      ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENASLATQLNEYNTKL--L
A0A413XDP6      ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENASLATQLNEYNTKL--L
K6AP24          ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENASLATQLNEYNTKL--L
A0A662ZYI7      ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENASLATQLNEYNTKL--L
A0A078RYI7      ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENASLATQLNEYNTKL--L
C7XEQ8          ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENASLATQLNEYNTKL--L
D7INX6          ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENASLATQLNEYNTKL--L
K5ZG55          ARY----IKNYL--------TNENNKHQL--L-PANSGI--ENASLATQLNEYNTKL--L
A0A3N2N9B8      TRF----VRNYL--------TAESSRNQL--L-PANSGL---VGDIASQVGEYNDLL--L
A0A3N2NMI0      ARF----VRTYL--------TAEDSRNQL--L-PANSGL---VGDIAKQVSEYNEML--L
A0A359I8H7      SIY----LRDYL--------NNPGNAKSV--I-PVNTGI--GSPTLEAQISNYNNLL--L
A0A3N2KA63      SIY----LRDYL--------NNPGNAKSV--I-PVNTGI--GSPTLEAQISNYNNLL--L
A0A4Q0IMT7      SIY----LRDYL--------NNPGNAKSV--I-PVNTGI--GSPTLEAQISNYNNLL--L
A0A3B9FAU3      AQY----VKGML--------TRGAKSRKL--L-PTNAGL--ESTGIEQQIAEYNTLL--L
A0A3C1E5L7      AQY----VKGML--------TRGAKSRKL--L-PTNAGL--ESTGIEQQIAEYNTLL--L
A0A4Q0UAV1      VKY----LRREV--------QN-ASLDQP--L-PNPAGI--EGTTVESQIAEYNTIV--R
A0A354SN68      AYF----IKEYL--------SNVKNRNQL--L-PVNSGI--GNEGIEGLINDYNAQI--L
A0A3N2N595      TRY----IRNYL--------SADNDNTKL--L-PIPSEV--ENVDVKSQLTNYNDLI--L
A0A0A2DUD9      ARQ----VRNLL--------KN-LDKSRL--L-PVNSFV--NNPSLEQQIGEFNDLL--L
A0A3P1ZBJ5      TRY----VSQML--------TNEKNKFDL--L-PANSGI--NSSSVEALIGDYNGNI--L
R5FHS9          AQY----VLSYI--------TNPKQRNHV--L-PANFGL--TDQNIEQQIESYNKDL--I
A0A413TW79      ARY----LRDFL--------TGKVGKNQL--L-PANIGI--DSPGIEQQITEYNKQQ--L
A0A3E5E9M7      ARY----LRDFL--------TGKVGKNQL--L-PANIGI--DSPGIEQQITEYNKQQ--L
A0A3E4SK73      ARY----LRDFL--------TGKVGKNQL--L-PANIGI--DSPGIEQQITEYNKQQ--L
A0A415GGC6      ARY----LRDFL--------TGKVGKNQL--L-PANIGI--DSPGIEQQITEYNKQQ--L
A0A413DBH9      ARY----LRDFL--------TGKVGKNQL--L-PANIGI--DSPGIEQQITEYNKQQ--L
A0A495WI87      ARY----IRNYL--------GGESNKYQL--L-PANSGI--ENSNLGDQITEYNNKL--L
A0A354M4S6      ARY----IRNYL--------GGESNKYQL--L-PANSGI--ENSNLGDQITEYNNKL--L
R7DH52          ARY----IRNYL--------GGESNKYQL--L-PANSGI--ENSNLGDQITEYNNKL--L
A0A4Q5E7L5      TRY----IRNYL--------TNDANRTQL--L-PANSGI--ENANIESQITEYNKQL--L
A0A4P8LP09      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A4R4GZU7      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A016CWA4      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A1C6H117      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A415TAH7      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A0M1W0V2      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A139KA16      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A174VQ92      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A1Q6HCG0      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A1Y4JYM9      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3A5QW67      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3A5RQE6      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3A6BP07      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3E5E153      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3Q9IP20      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A412WV15      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A413ICP6      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A414KYB9      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A5B3FWR2      TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
E5WX00          TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
K0X3P3          TRY----IRNYL--------SNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3A5Z014      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A1M4YZ07      TRY----IRNYL--------TNDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A078S3Q8      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A069SJV7      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3E5DXI5      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3E5EM98      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3E5F453      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
I9T3G6          TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A4Q5E5M7      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESVNIESQIAEYNKQL--L
A0A0P0FQW1      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESVNIESQIAEYNKQL--L
A0A5M5C0W6      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESVNIESQIAEYNKQL--L
A0A642LZ22      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESVNIESQIAEYNKQL--L
A0A5M5YM86      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESVNIESQIAEYNKQL--L
A0A642LE65      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESVNIESQIAEYNKQL--L
A0A5M5Y0P8      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESVNIESQIAEYNKQL--L
A0A642NJ89      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESVNIESQIAEYNKQL--L
C3RFN5          TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3E4SYU0      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A6LGY1          TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
K5ZSH4          TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A078T2W6      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3R6EAF7      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A5C6L2P1      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A412MJT7      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3E4WKT5      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3A5YY33      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A078TAH2      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A1E9CFZ7      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A373FYU5      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3A5TZ72      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3A5XBP2      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3A6MEG9      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3E4JP35      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3E4KP40      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3E4NX82      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A3E4XFU8      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A412RG70      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A412TD37      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A413GAA4      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A414M7I4      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A496BTA0      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A496D2V6      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A4Q5EN83      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A4Q5G1P5      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A5C6KCA6      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A5M5AHM5      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A641WNS6      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
E5UZA2          TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A069SMG6      TRY----IRNYL--------ANDANRTQL--L-PANSGI--ESANIESQIAEYNKQL--L
A0A1Y4PQK7      VRY----IRNYL--------ATTAGQNQL--L-PANSGL--ENVGIEKQISEYNTLQ--L
A0A1Y4IH41      VRY----IRNYL--------ATTAEQNQL--L-PANSGL--ENVGIEKQISEYNTLQ--L
A0A3A6AAP4      VRY----IRNYL--------ATTAEQNQL--L-PANSGL--ENVGIEKQISEYNTLQ--L
A0A1Y4DYA7      TRY----VRNYL--------TNNNNKNQL--L-PANSGI--ESSGIENQILDYNTLQ--L
A0A1Y3X4I9      TRY----VRNYL--------TGGNSRNQL--L-PANSGI--ESSGIEKQIADYNALQ--L
A0A1Y4FNK8      ARY----IRNYL--------TNATSKNQL--L-PANSGI--ESPGIEQQIANYNTAQ--L
A0A355FD59      ANY----IRNYL--------TGPAYTNQL--L-PANSGI--ENSGIESQISEYNTLQ--L
A0A359CEZ9      ANY----IRNYL--------TGPAYTNQL--L-PANSGI--ENSGIESQISEYNTLQ--L
A0A353Q7B4      ANY----IRNYL--------TGPAYTNQL--L-PANSGI--ENSGIESQISEYNTLQ--L
F8X3A5          ARY----MRNHL--------MTSTNNNQL--I-PANSGI--ESASVENQITEYNTIQ--L
A0A1M3KVR9      ARY----MRNHL--------MTSTNNNQL--I-PANSGI--ESASVENQITEYNTIQ--L
A0A4Y9IJS3      ARY----MRNHL--------MTSTNNNQL--I-PANSGI--ESASVENQITEYNTIQ--L
A0A4Q5WS95      LGQ----VEQYV--------SAKQRDGSL--V-PSTLGI--DDPLLSGLLEKLYQAD--L
A0A501VZX6      LDK----VENYV--------IAKEKARGI--V-PSTLGL--NDAVLSQLLQKLYNAE--I
A0A399SH26      LAK----IENYI--------IAKDKSAGI--V-PSTLGI--NDPVLTQLLQKLYDNE--I
A0A501W1A9      LDN----VESYV--------KAKNNTAGI--V-PATLGV--NDPVLSQLLQKLYDAE--I
A0A0E3ZGV6      LDN----VERYV--------VRKNKDLGI--V-PSTLGV--SDPVLSQLLQKLYNSE--I
A0A1I2N4S1      LDN----VEKYV--------LSKEENIGI--V-PSTLGV--SDPVLSQLLQKLYEAE--I
A0A2T5YE44      LDN----VEKYV--------LSKEQNIGI--V-PSTLGV--SDPVLSQLLQKLYNAE--I
A0A1V9FHD0      LDE----MERYA--------NSKDNNTET--V-PSTMDI--PDPVLTDLMQKMYTAK--V
A0A4V4H170      LGE----MERYV--------NSNENNGNI--V-PATLGI--SDPVLSELMQKMYNAK--V
A0A1V9F098      LNE----MERYV--------NSKENKGDI--I-PATIGI--SDPVLTELMQKLYNGK--L
A0A4R2VU64      LNE----MERFV--------SSKDNNADM--L-PATMGI--TDPLLTDMMGKLNNAK--V
A0A4S8HY23      LEE----MERYV--------KSNENKGDV--V-PATLGI--SDPVLGELMQRMYNAK--V
A0A1V9F383      LDE----MENYV--------TSRSNKGDL--V-PATLGI--TDPVLSDLMQKLYNKK--V
G8TRZ6          VDE----MENYV--------NQKSNTGDL--I-PSTLGI--ADPILSDLMSKLYSKR--V
A0A543WA52      LNR----VESYV--------ISKNNEGGL--V-PSTMGI--NDPVLSQLLEKLYNSE--I
A0A1M5BA90      LNE----VEKYV--------LSKNNQIGI--V-PSVVGV--KDPLLSSLLQKLYDSQ--M
A0A512B879      LNE----VEKYV--------QAKDSQIGI--V-PSIAGL--KDPLLAQLLQRYYDAQ--M
A0A559PPI3      LDK----VENYI--------LSKDGGGSI--V-PSTLGI--DDPVLTQLLQKLYNSE--I
A0A1T5CS78      LNN----VENYV--------ISKGSAGGM--V-PSTLGI--SDPILSQLIEKLYNLE--V
A0A0Q9Z8F1      LNN----VENYV--------ISKGSAGGM--V-PSTLGI--SDPILSQLIEKLYNLE--V
A0A2N0U0M7      LNN----VENYV--------ISKGSAGGM--V-PSTLGI--SDPILSQLIEKLYNLE--V
                                                                            

A0A1T5MMH4      QQERLKLS---------YN-E-NTLAY----------------REKQQEIENRT-DKTSQ
A0A2W4R1L8      SFDRLKLS---------YS-E-VTFAF----------------REREQQIQNLQ-EQVTK
A0A2E5CV79      QNAMIYG-------------E-NHSAV----------------IEIQKRVSIMK-EKLDE
A0A2D4ZVH1      KNPGIS--------------E-NNPEI----------------ARIENEILKVK-RQIKD
A0A0K8QSK7      EKSRLGNV---------RVS----PRL----------------NQINAQIEKLK-EALMA
A0A1V6CN82      EKSKMSDV---------LIS----PRL----------------TQLNDQLGNVK-EAMLE
A0A1M4XZ45      EKSSQTSI---------RKGS-EHPTI----------------LRLNAQIESVK-NSLRE
A0A399D319      EKSSQTSI---------KRGS-QHPII----------------LQLNAQIESVK-NSLRE
A0A1M6GR99      QKDNLIQN---------NQ-Q-RNPIV----------------NRLDIQIKNLK-NTVSE
A0A1M6TTV4      ERMLKLES---------YN-E-NTQVI----------------QRLNQRLEISQ-NSAKF
A0A4Q8RX32      RKRHLIEN---------RQ-D-KSPQL----------------RELNFQTNNLK-KTILV
K0X1U5          ERMRLLRT---------AK-D-SNLAL----------------RTLTAQIDVMR-ENILN
R5EXK3          ERMRLLRT---------AK-D-SNLAL----------------RTLTAQIDVMR-ENILN
A0A401UAP7      AINELKLS---------YK-E-STFAY----------------QELQRDIEFAE-KALVI
A0A1W2GF52      DRALKLNS---------YN-E-NTQVI----------------KRLDQQIEIAK-NSANS
A0A2G5L7B8      ERLLKLDT---------YN-E-NTQII----------------KQLNSRIDLSQ-KAVHD
A0A523GAC0      ERELLKIS---------YH-K-NTFAV----------------IKVDQEITLIQ-EQLES
L8JW09          ERDKLRLS---------YN-E-TTFAL----------------TRKEEEIKNSK-TALKA
A0A5C7MX19      ERNLVLLD---------VT-P-DHPKV----------------RLLDKQIQDFK-EELNN
A0A364XUP5      TQEKLKLS---------YN-E-TTFAY----------------RELEKEIETHS-TRAIE
A0A1M5RLA9      DQEKLKLS---------YN-E-ATFAY----------------RQRQKDIETLR-AKASR
A0A385SFR9      DQEKLKLS---------YK-E-VTFAY----------------RQRQKDIETLR-DKSGR
A0A5M4A9J4      DLTTLETT---------VIDK-NHPTL----------------QQLRSQIEVTK-KALIE
A0A5M4B1C7      SLKTLKTA---------VIDP-NHPSV----------------IQLRTQIRVTQ-KAVVE
A0A0D3LFR6      EKEVLLEH---------YN-E-NTQAA----------------QMKIKQVSMIK-EDLLA
M7N6D4          EKEILLAS---------QN-E-NTQAV----------------QLRNKKISAVK-EELAN
A0A1Q3ZMZ7      DRDILLNK---------VQ-K-SNPEI----------------TIKEKQIDQKI-REIKK
A0A2D8JJW3      --------------------E-QEIGK----------------NDIPKSYELAI-KDTLR
A0A2W2AFF7      ERERMLMS---------TT-E-ENPMV----------------RNMDQQSDNLR-GDINN
A0A2N5YXE2      KKEILLFD---------VT-A-NNHKI----------------VTIDEQIATKK-ATIVD
A0A2W1NDY9      DQEDASYR---------MT-M-ENDGL----------------KNLESNIINQT-ETINR
A0A5C8AQR5      KKEDLLFD---------VK-P-DNSVI----------------VNLNQRIEGKI-QAIKR
A0A1G0CI31      RKEDLLFD---------VT-E-NNTEI----------------KNINIQIQSKI-QSIRR
A0A556N0M0      RKEELLTN---------VS-E-NNSEL----------------KNLNSRIQSKV-QSIRR
F2IKD6          RKEELLTN---------VT-E-NNSEL----------------KNLNTRIQSKI-QYIRR
A0A1I7BM74      QRENLLYT---------VT-E-ESRTI----------------TQLDKKISADI-EITNK
A0A2G2FJ17      TKEDLLYK---------VT-P-ENDMI----------------KKIETRVDNRI-QNINK
A0A077ENE7      KRNRLAEG---------GN-S-SNPVV----------------LDLDDALGAMR-TNISR
T0NN57          KRNRLAEG---------GN-T-SNPVV----------------MDLDEALGAMR-NNIGR
X5K347          KRNRLAEG---------GN-T-SNPVV----------------MDLDEALGAMR-NNIGR
A0A2I0QZ80      RKEDLSYK---------VT-Q-NNDII----------------QKLEKRITIRK-ESITR
A0A3E1F1A3      EKEDLLFQ---------VT-P-QNEKI----------------SKLEGRIQVRK-ENIDE
A0A2U2XBJ3      EKEDLLYQ---------VT-P-QNENI----------------KKLEMRIQIRK-ENIDE
A0A4Q4KU94      QKEDLLYQ---------VT-P-ENENI----------------KKLIMRIQVRK-ENIDE
A0A2U1FKU2      RYDRLKQS---------SS-E-NSPAV----------------QEAAMQLVSMR-KSINV
A0A0A2F954      KYERLKQS---------SS-E-NSPAV----------------QEVGMQLVAMR-KSINA
A0A0A2FW91      KYDRLKQS---------SS-E-SNPLV----------------QEMAMQLVAMR-KSINA
A0A2D2N2N1      KYDRLKQS---------SS-E-NSPAV----------------QEVGMQLVAMR-KSINA
Q7MWZ2          KYDRLKQS---------SS-E-NSPAV----------------QEVGMQLVAMR-KSINA
T2NDT6          KYDRLKQS---------SS-E-NSPAV----------------QEVGMQLVAMR-KSINA
W1R7P9          KYDRLKQS---------SS-E-NSPAV----------------QEVGMQLVAMR-KSINA
A0A1R4AFZ0      KYDRLKQS---------SS-E-NSPAV----------------QEVGMQLVAMR-KSINA
A0A1R4DVZ7      KYDRLKQS---------SS-E-NSPAV----------------QEVGMQLVAMR-KSINA
A0A5M4B212      ELTTLSAT---------VKDP-EHPRM----------------RQLSIQMETTK-RTLLE
A0A1T5K9D4      KRDRLEKA---------SS-S-VSPAV----------------MQIEDAMISMK-QNILG
A0A3D1KEX9      QYTRLSAN---------SS-N-SSSVI----------------QDYEKSLVAMR-SAIKV
A0A358Y7S2      KKEELLKD---------VT-L-ENEAI----------------KRIEIKIQNKI-SNIRR
A0A1X7J248      EYQLSKTR---------YK-K-ESQVL----------------LQRKIEINVLK-DRINN
E4TQD2          DYQMAKTR---------YK-K-ESQVL----------------LQRNLEINALK-DRINN
A0A2J6HHN3      KRQEYLIT---------MT-E-NSTVI----------------ESIDKQISYQK-RMIHQ
A0A1Y3WMT8      ERMRLLRT---------AK-D-SNLSL----------------RTLTAQIDAMR-DNILN
A0A1Y4GQU1      ERMRLLRT---------AK-D-SNLSL----------------LTLTAQIDAMR-ENILN
A0A1V5W8T5      QKEQLLIT---------VT-P-DNHKV----------------KVIDQQILEQK-KLLLD
A0A2T8HKA9      RRNRLLEG---------NN-S-NNPYV----------------QELDQYLSSNR-QNIER
A0A3B8INU3      ELDQLLLS---------HD-P-RTLIV----------------RRTQQSLQILR-DELLD
A0A414ZBF2      KKNKLMAN---------SS-A-NNPIV----------------REMNASLVSMR-ASISK
A0A1Q3Q573      SREIKLLE---------RT-E-DHPEV----------------RLLDKQIFSSK-NQLLK
A0A662BAY3      EKSSMTSV---------KN-T-EHPKL----------------KRLNAQIENAK-SNLLE
A0A4U3L369      ERDRVSLN---------YP-D-TNPLL----------------QNIDMQLSNLR-RDMIN
A0A357YNR3      ERNRLARI---------AS-S-SNQSM----------------IDLNYQLTSML-NSVKS
A0A5E8AX52      EREVLLGS---------YN-E-NTHAV----------------SRMTQRLETLK-KNVRG
F4KK08          KRDQLQAN---------SS-S-QNPLV----------------QELNTQLAAQR-LSIIT
A0A496LCF9      K----LLD---------LG-A-KNPQY----------------EVVSGQIAQIK-NQLNE
A0A5P2G2A9      QKERYATT---------NT-S-ENPGM----------------IALDSQIGKAR-KELIG
A0A419VXB7      KKETLSYS---------VH-S-KNPGI----------------QVIDKELEYVK-KSLVE
C3J7R8          RRDQLIAN---------AE-T-QNPVV----------------ETLEKQLASMH-VAVVK
A0A0B0BTJ4      ERMRLGTE---------TS-D-DNPVI----------------REMNAQIISMQ-HSLKK
A0A3B9CNN6      ERMRLGTE---------TS-D-DNPVI----------------REMNAQIISMQ-HSLKK
R5X290          ERMRLGTE---------TS-D-DNPVI----------------REMNAQIISMQ-HSLKK
A0A1Q6E6I7      ERMRLGTE---------TS-D-DNPVI----------------REMNAQIISMQ-HSLKK
A0A1G8BVM8      LRNKLLAN---------ST-S-NNPII----------------NDLQTSLVSMR-SSILS
A0A2G2F510      RKEDLLYR---------VT-P-ENSEV----------------KLLDRKVKAKT-NLIQR
A0A316JZ08      QKEDLLVS---------LT-P-NNEKV----------------ALVQKRIDTKI-NTILR
A0A1I1FXP9      QKEMMSYT---------AK-E-GTLAA----------------RLRDKKIGSMG-EDLLK
A0A3N4H5N3      DRQRLSRV---------VQ-P-NNQQI----------------LSLNEQISSLR-SNIIQ
A0A2P8EAX2      ERQRISRI---------VQ-P-NNQQL----------------ISLNEQLSSLK-SNILQ
A0A4V2F6N9      ERQRISRI---------VQ-P-NNQQL----------------IALNEQLSSLK-SNILQ
A0A3B9FXJ0      QKANLMLS---------LP-P-TDPKV----------------KLVTGQIDEVK-KNFKE
R5GSU5          ERNRLAPN---------TG-E-NSPVM----------------NDLNQKLIATN-EAIRA
A0A2A3UE91      EKENLLYA---------VT-P-NSENI----------------KQVNYQLENQR-KLLLE
A0A0A2G557      YREQLLSE---------SG-Q-TNPLI----------------ETQQKQLESLR-KAIIK
A0A2N2WFW8      KKQDLLVH---------IT-E-NSTAV----------------ESVNSQIDFQK-RIIRE
A0A1F3IU95      RKQELLLR---------VT-E-NSTAI----------------ESINAQIEFQN-KIIRE
A0A3D0VUF6      RKQELLLR---------VT-E-NSTAI----------------ESINAQIEFQN-KIIRE
A0A1T4PT95      YRERLLSE---------SG-Q-TNPLI----------------ETQQKQLESLQ-KAIIK
A0A4P5TMD1      DKREKLLK---------LK-P-ANPQI----------------INIDKQIDEVK-TNIIQ
A0A651GU15      RKEEMGFN---------VK-G-NHGAV----------------KNIEYQVEIQK-RLILE
A0A3Q9FR88      EALRIKDS---------YT-S-NTIAS----------------NAKLELYKKLR-YEVAE
A0A553GEX3      EALRIKES---------YT-S-NTIAS----------------NAKLELYKKLR-YEVAE
A0A150ADJ9      QANRIKNS---------YT-E-RTVAS----------------NAKLELYKKLR-YEVAE
A0A1B1FWQ4      EALRIRES---------YT-S-NTVAS----------------NSTLELYKKLR-YEVAE
A0A1S1Z228      EALRIKES---------YT-S-NTVAS----------------NSTLELYKKLR-FEVAE
A0A2A4PYG9      KKEEILYT---------AT-K-ESEAV----------------KGVNYQISVQK-KLLIG
A0A1F3K695      QKEVLLND---------VT-N-NNHQI----------------KVVDKQIENQK-MILTE
A0A353KZR1      QKEVLLND---------VT-N-NNHQI----------------KVVDKQIENQK-MILTE
A0A2N2WYB5      EKEQLLND---------VT-P-NNLKI----------------KQLDKQISNQK-NLLID
A0A1F3K4G0      KKEQLLND---------IT-R-DNLKI----------------KLLEKQIDNQK-DLLLE
A0A356H8Y3      KKEQLLND---------IT-R-DNLKI----------------KLLEKQIDNQK-DLLLE
A0A351HSA6      KKEQLLND---------IT-R-DNLKI----------------KLLEKQIDNQK-DLLLE
A0A1F3Q014      QKEEMLYD---------VK-P-NSEAT----------------RLIDYQIEIQK-KLLKE
A0A2A4YXP3      QKENLQFE---------VT-K-DSEII----------------KSLDHKIKVQK-KILFE
A0A2D5KD44      KKQELLFT---------MR-E-NSNRI----------------QEIDYQIDIQK-KLISE
A0A1F3R158      QRQKILNE---------AT-K-ESDLI----------------KFHDQQIEVQK-EVLFK
A0A2M8ADX2      QRQKMLTE---------AT-K-ESDLI----------------KIQDQQIELQK-EVLFK
A0A1J5B2H0      KREQLLYE---------VT-L-NSSQI----------------ESINYQINIQK-KLLIE
A0A1V5N756      QKEELLYN---------VT-A-YNSQI----------------KQINYKLDIQK-KLFAE
A0A1F3SJM1      KKEDLLYN---------VT-E-ENEEV----------------VALTKKIKAKI-LLIQH
A0A2G2EB96      RKEDLLFE---------VT-E-ANSEI----------------AIINQKIASKL-RIIQR
A0A2G6PRA9      RKEDLLFE---------VT-E-NNSEI----------------EIINQRITSKL-NIIQR
A1ZKR2          NKKILALK---------AT-G-SSIVV----------------KDINQKLELQR-TQVQK
A0A1Q3GX01      EKKLLDLK---------VN-N-SSMVF----------------KDVNKKLDIQK-EKATR
A0A349DQI4      DKKLLDLR---------AT-S-SSMII----------------QNINQQLNTQK-AKANR
A0A2N3IIZ0      IRQNQELS---------ET-S-ATYSY----------------QVLDIKINNLQ-KNITE
A0A497D5Z2      EKSSLTSV---------KN-M-EHPKL----------------KRLNAQIESVK-SSLLE
A0A662B170      EKSSLTSV---------KN-M-EHPKL----------------KRLNAQIESVK-SSLLE
A0A2A5FYT6      KKEEMLYS---------ET-E-KSEKI----------------KSIDYQISIQK-NLLLE
A0A2E6SYP1      KRRELSFR---------VT-E-ESYEV----------------KEIDFQIKLQL-NDLKE
A0A2E5RLE8      EKRSLSFR---------IT-E-ESYQV----------------KEIDFQINLEI-QDLLE
A0A2E7TQF6      EKRSLSFR---------IT-E-ESYQV----------------KEIDFQINLEI-QDLLE
A0A2E6GVY9      DKRSLSFR---------IT-E-ESYQV----------------KEIDFQINLEI-EDLLE
A0A350JJ90      TRNRLLGG---------AT-M-DNPNI----------------RVYDQQISVQK-NLVIK
A0A3M1CDV2      EKENLLYQ---------VT-P-NSEQI----------------KIINYQIENQK-KILIE
A0A522EYA6      SREELLYQ---------VT-P-TSEKI----------------KSIEFQIEVQK-KLLLE
A0A4P5U6G4      DKRYFLLS---------KT-A-NNPEV----------------INIEKQIDDLK-LNIKE
A0A2E2TFD1      EKDQSLYE---------VT-Q-SSGRV----------------QNLDYQVRIQK-KLLFE
A0A2E4ELE6      EREQSLYE---------VT-A-DNGRV----------------KNLEYQISIQK-KLLVE
A0A2E3XZI5      KRDLLLKE---------VT-K-NNKNF----------------IQLNRQIEEE-----IL
A0A2M7NLQ9      EKKFMLDR---------LT-K-QTAAY----------------QQKEKKIELLK-KEVDK
I4AFR0          EKKFMLDR---------VT-K-QTGAY----------------QQKAKRIDLLK-KEVDK
A0A2N2Y3E5      EKEKAMNN---------LT-T-QSFQI----------------KSIDKQIDNQR-EILKE
A0A2D9D7T6      KKENLLTG---------LT-P-QNKEI----------------EILDQKIDARI-VSIRK
A0A1F3PPL5      QKDMLLND---------VT-N-NNHKI----------------KIVDKQIENLR-KTMID
A0A357QK06      QKDMLLND---------VT-N-NNHKI----------------KIVDKQIENLR-KTMID
A0A662AEA4      KKQQLLND---------VT-S-NNYQI----------------TTIDKQINNQR-QLIIE
A0A0S2HYK8      EKNQLLND---------VT-E-NNMRI----------------KIIDKQIANQK-KLIID
A0A2N5ZWN6      EKNQLLND---------VT-E-NNMRI----------------KLIDNQIENQR-RLIID
A0A0F2NS19      QKQNLLSE---------VT-V-NSGSV----------------KSLENQIDVQK-QILFT
A0A2A5H8X6      QKQNLLSE---------VT-V-NSGSI----------------KSLENQIDVQK-QILFT
A0A2H0GAU8      QKQNLLGE---------VT-V-SSEAS----------------KSLDRKIEIQK-EVLFA
A0A2M8FTK1      QKQNLLGE---------VT-V-SSEAS----------------KSLDRKIEIQK-EVLFA
A0A2A5B3B0      RQENLQYE---------VT-K-NNEVV----------------KSLKHQINVQK-KVLFE
A0A5C6RXM7      LKENMLYE---------VT-D-NSGAI----------------NSMNYKIDVQK-KLLTE
A0A2E0FJ09      LYEDLISE---------RT-G-DHEEI----------------KKIRSQIDVQT-KLISE
A0A1F3FZ62      QKEKMLYE---------IT-P-DNRQI----------------NALEYQLGIQK-KIMFE
A0A1F3K211      QKEKMLYE---------IT-P-DNRQI----------------NALEYQLGIQK-KIMFE
A0A1F3KLL5      DREQMLSD---------VT-A-NNYKI----------------KVIDKQIVTKK-GILVE
A0A359D1M1      DREQMLSD---------VT-A-NNYKI----------------KVIDKQIVTKK-GILVE
A0A2E7CT70      KRDELLRD---------VT-E-SNENV----------------ILLNYQIEEE-----II
A0A2D5V560      KRDQLLKD---------IT-P-NNKNI----------------IILNGEIEES-----VV
A0A2D7K5A8      QRDELLKD---------IT-P-NNKNI----------------ILLNGQIEES-----VL
A0A2E1XQ82      QRDELLKD---------IT-P-NNKNI----------------ILLNGQIEES-----IL
A0A1V6I2U9      RKEVLLFD---------LT-S-NSHKI----------------QTLDEQIKSKK-ETIID
A0A1F3C1M2      QKEILLND---------VT-K-NNHQI----------------QVIDKQVQNQK-EILIE
A0A1F3DS87      QKEILLND---------VT-K-NNHQI----------------QVIDKQVQNQK-QILIE
A0A2H0B957      QRDAYLNN---------QT-K-NSYQI----------------KVIEKQIETQK-QTLID
A0A1F3CFW6      QRDLYLNN---------QT-Q-NSFQI----------------KVIEKQIETQK-QTIID
A0A2M7E2T8      QRDLYLNN---------QT-Q-NSFQI----------------KVIEKQIETQK-QTIID
A0A2M7NC69      QRDLYLNN---------QT-Q-NSFQI----------------KVIEKQIETQK-QTIID
A0A5C8A5B4      AAQNLSTG---------AR-S--NPTV----------------IAMERKLNNLK-SSLAQ
A0A4Y9ITE2      ERMKLVNN---------AK-T-NNNAAL---------------RTISSQLDAMR-ENINA
A0A5M8NYX7      EKNRATLG---------LK-P-TNSIV----------------REYEERIALLR-TNLLK
A0A3D5KRY6      NREVLSYT---------VQ-E-KNPVL----------------VSLNNEIRFTQ-KSLLE
A0A1V5IPN7      ARLRTNEN---------YS-E-NHPQM----------------KLLQEELAKTK-NTLDT
A0A0E3V905      QRDHLLHT---------TS-E-LNPLL----------------ETVDSQIKITK-NNMAS
A0A553ETH6      EREQLRLS---------YS-E-TTFAL----------------TKKEQEIQSLK-TAISK
A0A640Q161      RVSELSNV---------YG-P-KHPRM----------------IAANAELSSIR-ETLNG
A0A640QU49      RVSELSKV---------YG-P-KHPRM----------------IAANAELSSIR-DTLSS
A0A1Q3PII2      SRVKALSQ---------LS-P-GHPDF----------------ILLEEQISVLR-NSLFD
A0A351BXT2      QRD--VEA---------SI-P-NDEKLREKTLAEYNRKIAPLRETLEEKIEVMR-SSLFA
A0A2K8Z965      QRDQMART---------TS-E-QHPML----------------ETINSQIRTAE-NNMAG
A0A418M8U8      QRSQLART---------TS-D-QNPLL----------------QTIDTQINSLK-GNMED
I2GTA4          QRSQLVRT---------TS-E-QNPLI----------------QTIDTQINSLK-GNMED
A0A2K8ZAJ2      KREDLLKT---------TS-S-GSPLI----------------ESLDSQLKNTN-AAISE
A0A368JPA3      QRTVLLRN---------SP-E-PSAVL----------------RSLDDQIFATR-ASIGE
A0A5N1JI29      QRTVLLRN---------SP-E-PSPVL----------------RSLDDQIFATR-ASISE
A0A3P1BT12      QRSLLVRN---------SS-D-SNPVL----------------RSLDDQISATK-TSINE
A0A3P1CI15      QRNLLARN---------SS-E-SSPLL----------------RSLDDQIATTR-ASLAE
A0A4R8CUK1      QRDRLVRT---------TS-E-ANPIV----------------QSITHQIDATK-SSASE
A0A3D0MYJ7      KRDIELST------------V-ENPQVYAKVESDYNKKISTLKSQYDKYYEEFV-IGITS
A0A662AH13      QRDIALSD---------TT-V-SDASK-PILKAEADRRIGELKTELDNELAKYK-ASIFA
A0A5C7QA01      QQADLVVK---------YT-D-DHPAM----------------REINAQI----------
A0A3D3LS70      ERDMELTI------------P-KDPKLIEKVKNEYDAKITALKKSLDEKVELLK-TGIYA
A0A1G1TM36      QRETLLTT---------TP-A-GNPLF----------------KPLDSEIQTTQ-LAIRT
A0A1G7ZF38      ALTRALAS---------LA-P-GHPEV----------------QSMEKQIGVLR-TSLAD
C6VS52          NRVKALTT---------LA-P-NHPAV----------------TTLDSQIAAAR-GNLFD
A0A0P7X1V8      DRETQRTLLLSRNPQLRNT-P-DDPSL----------------IEINQQIEGLR-EEIAR
A0A3B0C2S4      EREKLIST---------VG-D-NHPTL----------------VTLSGQLENLK-VNILR
L8JI02          ERAGLNYN---------AK-E-QNPVT----------------EVVDRRIRNTK-NTLQE
A6EBM4          EKEELLKV---------YN-G-DAQAV----------------MRLNRQIQEVR-KAAME
A0A416GA42      QCDKMEST---------TA-V-ENPVV----------------QDLQQAMLSLR-ESILR
A0A4R5DL69      SRDKAGYN---------FT-G-QHPAM----------------QNLDLQLKRIR-EEIIQ
A0A1T3IYP5      KRNRLAEG---------GN-N-LNPVV----------------LDLDDALSAMR-NNISR
A0A1M4YED3      NQIKLRQT---------MG-E-NSPQV----------------VATQNEIDRLR-PAILD
A0A3P1Z8V4      TRNRYAVN---------SN-D-DTPAV----------------RDLDRQLEALR-SAINT
A0A2N3U785      ERQGLLRT---------MQ-P-NNPLV----------------VNLNDQLSNLE-VNILE
A0A0E3ZG78      DRERMLRT---------AQ-P-KSPII----------------KNLNEQLANIR-SSILE
A0A1I6BRK6      ERQRMLRT---------MQ-P-TSVLI----------------QNTNEQLADLR-VNILE
A0A243WAB1      ERERTLRT---------TQ-P-SSLLV----------------QNLNEQLANLR-INILE
A0A126PFG0      QRERLLTT---------TP-E-NNPLF----------------NPLNSEILATQ-LAIRS
A0A3M1N7Z3      QRLRLLKV---------YQ-P-TSPIV----------------SAHNQLILSRV-RALLD
A0A2H3NSN0      DLEAQAEP---------YY-I-NNPDL----------------RGNEDQV--RELSQIKR
A0A2P6C324      ELKARAEQ---------YY-I-NDPTL----------------RGDESRV--RELAEIKR
A0A1M6XHU0      ELKVQAEQ---------YY-V-FNPKL----------------RGNEEKLGDQQLVEIVR
A0A5S9C8G0      ELKVQAEQ---------YY-V-FNPKL----------------RGNEEKLGDQQLVEIVR
G2SF81          ELKVQAEQ---------YY-V-FNPKL----------------RGNEEKLGDQQLVEIVR
A0A5S9EYW1      ELKVQAEQ---------YY-V-FNPKL----------------RGNEEKLGDQQLVEIVR
D0MHQ9          ELKVQAEQ---------YY-V-FNPKL----------------RGNEEKLGDQQLVEIVR
A0A4D7K1D4      ERLQLLEK---------YN-E-NTYAV----------------RKLNNELKIHK-QELND
A0A3C1ITV0      ERQRLVAN---------SS-D-SNPLV----------------SDINNQLRMMR-STILR
R7HN19          ERQRLVAN---------SS-D-SNPLV----------------SDINNQLRMMR-STILR
A0A060RD97      KLDKMLES---------SG-E-NNPLV----------------VDGRTQLSALK-MTIIQ
A0A0D3L8Q3      ERQRLLLT---------NK-P-NNPLV----------------MNLSEQLTDLR-QNILE
A0A5B6TJH8      ERERMLRT---------TN-P-NNPLI----------------QNINEQLANLR-VNLLE
A0A519U664      ------------------------------------------------------------
A0A519UDD1      ERQRLLPN---------LE-P-SSILI----------------QNVNEQLANLR-ANTLE
A0A519MA34      TRERMLRT---------NE-S-TSFLI----------------KNIDEQITNLQ-NNILE
A0A519UCX0      TRESILRT---------SQ-A-NSFLI----------------NNTNEQIANLR-ANILE
R7PCR1          EKKNLEQN---------ST---NSPVI----------------RDMNEALKAKR-ASILA
A0A350IHV0      TRDRYMSD---------SS-S-DNPLV----------------GDLNNSISALK-VAISR
A0A1G9E2A9      EQSTLLVS---------TK-P-TTQAY----------------QFGVTEINKLE-KSVKE
A0A098LL25      ERNRLLNS---------QR-E-NTLVV----------------KTKNKSIERIK-ENVLE
A0A2T2YJE8      DRNLMVQS---------YK-T-TTKAY----------------QLLEEEIKFVE-QSVRK
A0A127B287      QRRKVLTT---------TR-G-NTLSV----------------ELLDQQIKFAQ-DKVSS
A0A3M9N829      RSRTARMT---------SR-G-NTAAD----------------NLREEQLKFTQ-GRLNA
A0A0P0CSF9      QQRTRRLT---------SR-G-NTLAD----------------NSLEERLEIAQ-NRLRD
A0A5M8QQB8      RIRTQSMT---------SR-G-NTTAE----------------KLAEEQLRFAQ-NRIAG
A0A3M9MNC3      QQRTRKLT---------SR-G-NTLAD----------------NALEERLQFAQ-GRLRD
A0A5B6TAX2      RLRTVRLT---------SR-G-NTTAD----------------NALEEKLAFSQ-NRIAG
A0A5N1IQ33      DLNRLLES---------YR-P-TTTAV----------------QLKQEALEYTR-RNIRG
A0A512AYT3      YYKLLKRS---------YK-D-STEAV----------------RRYQKEMAFTK-DAVNK
A0A5M6CYN7      YYKLLLRS---------YK-P-ETEAV----------------KRAQKEISLTK-EAASK
A0A369QP10      DRSLMMQS---------YK-T-TTKAY----------------QLLEEEIDFSE-KAVRK
A0A126PDF2      EQERIRRS---------YT-G-ATEAV----------------QQKNAQMDYTL-SSILR
A0A2Z3GKA1      DQERIRRS---------YT-G-ATEAV----------------QQKNAQMDYTL-SSILR
A0A502GZP7      DQERVSRS---------YT-G-ATEAM----------------QQKNALMAYTL-SSILR
A0A519SBU8      ELRLTLKS---------QT-D-KTFAV----------------QRNQAIIRETR-VSLQR
A0A4Q3JNZ3      SLRLTLKS---------QT-D-QTFAV----------------QRDEAVVRETR-KSLQR
A0A519Q9V3      SLRLTLKS---------QT-D-KTFAV----------------QRDQAIIRDTR-DLLQH
A0A0M3RW20      DLRRVLRS---------ST-E-ATEAV----------------QQRKAAVEYAK-RNVQD
A0A495VFX4      DLRRVLRS---------NT-E-ATEAV----------------QQRKAAVEYAK-QNVKD
A0A1S9B3W0      EMRKVLQS---------YQ-PNATTAV----------------RIKEDQLQKTK-SNIQK
A0A1W1VRL3      DLRRVLRS---------YK-E-TTEAV----------------KQRRVQLDFTR-STIRR
A0A1M6R305      NLRRLSRS---------YK-E-TTEAV----------------QQQREALSYVR-GNLRR
A0A4Z0PHK3      NLRRLLRS---------YN-E-TTEAV----------------KQQQAALAYVK-NNIRR
A0A2M9B9H9      NLRRLLRS---------YN-E-TTEAV----------------KQQQAQLAYVK-NNIRR
A0A4Z0QCY9      NLRRLLRS---------YN-E-TTEAV----------------KQQQAALAYVK-NNIRR
A0A418R9X5      DLSQLLKS---------YQ-E-TTTAV----------------KLRRAEIANIK-AIIRE
A0A428JSJ3      DLSQLLKS---------YQ-E-TTTAV----------------KLRRSEIANIK-GIIRE
A0A428KI59      DLSQLLKS---------YQ-E-TTTAV----------------KLRRSEIANVK-SIIRE
W8F1I6          DLSQLLKS---------YQ-E-TTTAV----------------KLRRSEIANVK-SIIRE
A0A246FQC0      DLKRALLS---------YQ-PGATLAM----------------QTKEQNIADLK-KIVRQ
A0A372E5P8      DLKRALLS---------YQ-PGATVAM----------------QIKEQSITNIK-KIVRQ
A0A1H3EMW1      DLKRALLS---------YQ-PGATVAM----------------QIKEQSIADLK-KIVRQ
A0A1H9ZSN3      DLKRALLS---------YQ-PGATLAM----------------QTKEQSIADLK-KIVRQ
A0A5N1J2M4      RREVVLAS---------NQ-P-GTFAV----------------TSIETQINKLK-KDIRE
A0A519S476      RLRLTLKS---------QT-D-KTTAV----------------QLQQAEIRETR-AALRR
A0A4Q3JRW8      QLRLTLKS---------QT-D-KTFAV----------------QRNQALIRDTR-ELLQR
A0A519M923      SLRLTLKS---------QT-D-KTLAV----------------QRNEAIIRDTR-TSLQR
A0A4Z0ENW1      NLRRIRRS---------YQ-D-RLEAV----------------QGPLTQLKFAQ-ATLQH
A0A519UDB4      NLRRVERS---------YT-D-KTEAL----------------SQLRAQVQFAR-AALQK
A0A3S0QKV1      DMRKILES---------YQ-PNATAAV----------------RIREDQLRRTR-DGVQK
A0A328BL48      ELRQVLQS---------YQ-P-TTTAV----------------QIRQSQLAFTK-RSIRR
A0A5R8WLY4      ELRQVLQS---------YQ-P-TTTAV----------------QIRQSQLAFTK-RSIRR
A0A1I5WSL8      NLRRISRS---------YT-D-KTETV----------------QRTKADIEYAR-TAVSR
A0A0U3JVM7      QLRRASRS---------YT-D-KTEAI----------------QSKQANIEYTR-ASIKR
A0A1G1SSV2      RLRRVSRS---------YN-E-STEAV----------------QGIRDDIAYTR-ASLKR
A0A1G1SXV7      RLRRVSRS---------YN-E-STEAI----------------QGIRDDIAFTR-ASLKR
A0A0W8EDI5      DMNRLLES---------YK-P-TTTAV----------------QIRREQLDFTR-RSIRR
A0A3B7RBP8      DLNRVLES---------YK-S-TTTAV----------------QIKQEQLDYTR-RSIGR
A0A3R9P8H7      DLKRALLS---------YQ-PGATTAM----------------QTKEQFVADLK-KIVRQ
A0A238WIA7      DLNRASVG---------YK-P-TTTAI----------------QVIQDQIAFTK-RSIRQ
A0A212UCJ7      QINRVSNS---------YT-P-ETQTI----------------KNLQGQITFTK-QNINQ
A0A4Z0MQE1      EINRISNS---------YT-P-ATQAI----------------KNLQDQIAFVK-RNINQ
A0A4Z0PCF4      DINRISNS---------YT-P-ETQTI----------------KNLQQQIAFVK-RNIMQ
A0A5D6VDG1      DLRRVLRS---------NT-E-ATEAV----------------QLRRANVAYAK-RNVQE
A0A243WHR7      NLRRILRS---------YQ-P-TTFTV----------------QQLQADVNLVK-KSTQR
A0A5B8A0P6      NLQRLLRS---------YK-E-TTEAV----------------KQQESMLVFIK-QNIRR
A0A076HRT9      NLRRLLRS---------YK-E-TTEAV----------------QQQREQLNFVK-GNVRR
A0A4Z0PVM7      NLRRLLRS---------YN-E-TTEAV----------------KQQQAALAYVK-NNIRR
A0A1M6DHW8      NLRRILRS---------YT-P-ATEAV----------------QQQQSTIAFLK-GSIRR
A0A4Q5LC61      NLRRILRS---------YT-P-ATEAV----------------KQQQSAITYLK-NSVRR
A0A2A8CVM9      ANDGLEGDTDR------IE-T-EFPQL----------------ADLLERINGLE-KRKRS
A0A3C0ZQC7      RRDVTVAQNPTYVG---QD-I-YTQKL----------------KEIDVQINALR-EKLRK
A0A2E3R1D0      ELEVFYRQNPALRN---DT-N-PPANI----------------ARLRTELARVE-ADQER
A0A2T2USC0      EINAVRRNNPNLEPGD-SS-P-KAREF----------------ARLEEKSRQLS-READS
A0A2T2V0F3      EINAVKRNNPDLDPGG-TS-P-KAREF----------------ARLKERARQLD-READS
A0A2T2S682      EINRVKTRNPNLDADA-ST-A-RAKNL----------------RQLQRRADRLE-RQADS
D5H561          SKQQLELQS----GAP-TP-A-DSAQA----------------AQIDRRIQKLR-ARIQR
A0A2H3NWA9      QLDQALERNSNLSPNPNGN-A-LEREL----------------ARTQERIDRLD-TQAQD
A0A2A8CVB6      RIDQIERENPNLGA---GG-T-LQRDL----------------RRMKERVSRLQ-ERADS
A0A2P6C1S6      KIDRVERNNPDLEP---TS-Q-LGREL----------------QRMKTRAQTLA-RRTDS
A0A2T2UTM4      KIDRVERRNPDLDP---TS-R-LGQEL----------------QRMKARAATLD-RKTDS
R5RVP0          NRDRFANE---------SS-D-NNPLV----------------SDLNTSIAALK-IAINR
R6A0L2          KRNTMVAN---------SS-E-NQAVV----------------REMDRQLAQMR-QAIAS
R7LG80          QRNQMANN---------SS-D-DHAVV----------------RELDKQLHQMR-QSIKA
A0A2L2WX98      ERNRIAGN---------TS-E-TSPTI----------------REIDNRLASMR-SSLLA
A0A285T4L1      KRDKLIAD---------SS-E-SNPVV----------------EELNNAIHALR-QSIIR
G5GD56          ERNKNAAN---------SS-G-QSPLV----------------RDLDKQLAAQR-TSILS
R5KD55          ERNSLMAN---------GG-K-NNPLV----------------KDIDKALNQLR-RSVIS
A0A174QNT3      QRNRLVSN---------SG-E-SNPVV----------------QNMNKNLVAMR-STIAG
A0A4S2FGS1      QRNRLVTN---------SG-E-NNPVV----------------QNMNRNLDAMR-KTIAG
R9I0H0          QRNRLVTN---------SG-E-NNPVV----------------QNMNRNLDAMR-KTIAG
K5BUT9          QRNRLKES---------SG-E-KNPVV----------------QAADKNLEGMR-ATISG
A0A174FPA3      QRNRLKES---------SG-E-KNPVV----------------QAADKNLEGMR-ATISG
R6S9Y6          QRNRLKES---------SG-E-KNPVV----------------QAADKNLEGMR-ATISG
A0A642LIH6      QRNRLKES---------SG-E-KNPVV----------------QAADKNLEGMR-ATISG
C9KX15          QRNRLKES---------SG-E-KNPVV----------------QAADKNLEGMR-ATISG
R6DAG6          QRNHLLAE---------SG-A-KNPVV----------------QTADKNLAEMR-TVISG
A0A3L8AAP1      QRNHLLAE---------SG-A-KNPVV----------------QTADKNLAEMR-TVISG
A0A4S2AYX2      QRNHLLAE---------SG-A-KNPVV----------------QTADKNLAEMR-TVISG
A0A4Y9H477      QRNHLLAE---------SG-A-KNPVV----------------QTADKKLAEMR-TVISG
A0A0E2M2Y7      KYDRLKQS---------SS-E-SNPLV----------------QEMAMQLVAMR-KSINA
A0A0K2J6Z0      KYDRLKQS---------SS-E-SNPLV----------------QEMAMQLVAMR-KSINA
B2RKZ8          KYDRLKQS---------SS-E-SNPLV----------------QEMAMQLVAMR-KSINA
A0A212GC82      KYDRLKQS---------SS-E-SNPLV----------------QEMAMQLVAMR-KSINA
A0A254MU12      KYDRLKQS---------SS-E-SNPLV----------------QEMAMQLVAMR-KSINA
R6CQ93          KRDKLIAD---------SS-E-NNPVV----------------KELDNSIHALK-QSIIR
A0A3D1NQW3      RYMKLNSE---------SS-E-NNPII----------------QNLGNGLASTR-RSIIA
B0MT10          RYMKLNSE---------SS-E-NNPII----------------QNLGNGLASTR-RSIIA
R7JGW9          RYMKLNSE---------SS-E-NNPII----------------QNLGNGLASTR-RSIIA
A0A414Q925      RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
A0A415PUS9      RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
A0A108TCU0      RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
A0A413BA42      RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
S3Y344          RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
A0A4Q5G8Y8      RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
A0A412TGL3      RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
A0A413VJ33      RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
A0A414L0W6      RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
A0A412DP39      RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
A0A413ZSE8      RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
B0NP84          RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
R6AK43          RRNKLIAN---------SS-A-NNPLV----------------RDLNGTLMSMR-LSIAK
A0A412N2D9      RRNKLIAN---------SS-E-GNPLV----------------RDLNGTLMSMR-LSIAK
A0A1Y4JYS9      RRNKLIAN---------SS-E-GNPLV----------------RDLNGTLMSMR-LSIAK
R6LHA4          RRNKLIAN---------SS-E-GNPLV----------------RDLNGTLMSIR-LSIAK
A0A3D2BF46      RRDKLAGN---------AS-S-NSPVI----------------QDFDSELAALR-RAIIA
A0A4Y1WUN1      RRDKLAGN---------AS-S-NSPVI----------------QDFDSELAALR-RAIIA
A0A4Y1XL94      RRDKLAGN---------AS-S-NSPVI----------------QDFDSELAALR-RAIIA
A0A358R538      TRSRLLAN---------GS-E-QNPVI----------------GEMDRELAAVR-RSILA
A0A1Y4AAB8      RREKLSEN---------SS-A-NNPVM----------------QELDNNLAAVR-RSIIA
A0A1Y3WWY9      QREKLLEN---------SS-E-NSPVI----------------RDLDNLLAAIR-RTIIA
A0A1Y4U5L4      QREKLLEN---------SS-E-NSPVI----------------RDLDNLLAAIR-RTIIA
A0A1Y3VCJ1      QREKLLDN---------SS-P-NNPVI----------------RNLDNLLASIR-RAIIA
A0A1Y3QTW7      RRQKLLEN---------SS-E-RSPVI----------------QDMDNVLAAVR-RSIIA
R6XWY7          RRQKLLEN---------SS-E-RSPVI----------------QDMDNVLAAVR-RSIIA
A0A4Y1X9Y9      RRQKLLEN---------SS-E-RNPVI----------------QDMDNVLAAVR-RSIIA
A0A4Y1WM66      RRQKLLEN---------SS-E-RSPVI----------------QDMDNVLAAVR-RSIIA
A0A174AVF1      RRQKLLEN---------SS-E-RSPVI----------------QDMDNVLAAVR-RSIIA
A0A656Q4F4      RRQKLLEN---------SS-E-RSPVI----------------QDMDNVLAAVR-RSIIA
A0A1Q6EIY0      RREKLLEN---------SS-E-RSPVI----------------QDLDNGLAAVR-RSIIA
A0A5B5VN71      RREKLLEN---------SS-E-RSPVI----------------QDLDNGLAAVR-RSIIA
E4M8L3          RREKLLEN---------SS-E-RSPVI----------------QDLDNGLAAVR-RSIIA
I3YQ50          RREKLLEN---------SS-E-RSPVI----------------QDLDNGLAAVR-RSIIA
R5UEY8          RREKLLEN---------SS-E-RSPVI----------------QDLDNGLAAVR-RSIIA
A0A1H4D866      RREKLMEN---------SS-D-RSPVI----------------QDLDNLLASVR-RSIVA
A0A5B3G4Y7      RREKLLEN---------SS-E-RSPVI----------------QDLDNLLAAVR-RSIIS
A0A374A9J5      RREKLLEN---------SS-E-RSPVI----------------QDLDNLLAAVR-RSIIS
A0A5B3GQN5      RREKLLEN---------SS-E-RSPVI----------------QDLDNLLAAVR-RSIIS
A0A1Q6E9S3      RREKLLEN---------SS-E-RSPVI----------------QDLDNLLAAVR-RSIIS
D4IJ36          RREKLLEN---------SS-E-RSPVI----------------QDLDNLLAAVR-RSIIS
A0A3E5HPT8      RRNRLVSG---------SS-S-NNPVV----------------QELNRIMQTMK-QNIYM
C6IJ48          RRNRLVSG---------SS-S-NNPVV----------------QELNRIMQTMK-QNIYM
Q8A3U2          RRNRLVSG---------SS-S-NNPVV----------------QELNRIMQTMK-QNIYM
A0A3R6S1H6      KRNKLQEN---------SS-E-KNPII----------------QELNGSLSAMR-QTIVR
A0A3R6SD81      KRNKLQEN---------SS-E-KNPII----------------QELNGSLSAMR-QTIVR
A0A354WXN6      KRDKLISN---------SS-S-KNPVI----------------QDLNNSLNAMR-QTIIR
R5IP14          KRDRLMSN---------SS-D-RNPMV----------------IDLNQTLSTMR-NSIIQ
A0A316SZX7      NRDRLIAN---------SG-N-NSPVV----------------QDLNSSLVSMR-KSLLR
A0A1Y4AIY1      KRDNLIRN---------SS-N-KNPVV----------------MDLNNSLSAMK-QTIIR
F3ZRU7          QRDRLLSN---------SS-D-KNPVV----------------SDLNKSLFAME-QTINR
A0A0J6CIR2      KRDKLIGN---------SS-N-KNPVV----------------MDLNNSLSAMK-QTIIR
A0A3D8HG59      KRDRLVSS---------SS-N-RNPVV----------------MSLNSSIQAMK-QTIVR
A0A3R6S408      KRDRLVSS---------SS-N-RNPVV----------------MSLNSSIQAMK-QTIVR
A0A1C5Q1F3      QRDKLIGN---------SS-N-KNPVV----------------MDMNNSLASMK-QTIVR
R7A239          QRDKLIGN---------SS-N-KNPVV----------------MDMNNSLASMK-QTIVR
A0A3R6HIK7      KRDNFIAN---------SS-D-KNPVV----------------MDLNNSLSAMK-QSIIR
K5ZVW7          KRDNFIAN---------SS-D-KNPVV----------------MDLNNSLSAMK-QSIIR
A0A1Y4D5Z0      KRDRLISN---------SS-N-KNPVV----------------MDLNNSLNALK-QTIIR
A0A413VXJ7      KRDKLVSG---------SS-S-KNPIV----------------IDLNNSLAAMK-QTIIR
I9RSN9          KRDKLVSG---------SS-S-KNPIV----------------IDLNNSLAAMK-QTIIR
U6RJK5          KRDKLVSG---------SS-S-KNPIV----------------IDLNNSLAAMK-QTIIR
A0A1Q6GA32      KRDKLVSG---------SS-S-KNPIV----------------IDLNNSLAAMK-QTIIR
I9RPU6          KRDKLVVG---------SS-S-KNPIV----------------IDLNNSLGAMK-QTIIR
I8YFS5          KRDKLVSG---------SS-N-KNPIV----------------IDLNNSLGAMK-QTIIR
A0A4Q5F7I7      KRDKLVAG---------SS-N-KNPIV----------------IDLNNSLGAMK-QTIIR
I8Y597          KRDKLVAG---------SS-N-KNPIV----------------IDLNNSLGAMK-QTIIR
A0A1Q6GBF5      KRDKLVAG---------SS-S-KNPIV----------------MDLNNSLSAMK-QTIIR
I8YFZ3          KRDKLVVG---------SS-S-KNPIV----------------MDLNNSLSAMK-QTIIR
A0A4V1YNX8      KRDKLVVG---------SS-S-KNPIV----------------IDLNNSLSAMK-QTIIR
A0A1Q6GDH2      KRDKLVVG---------SS-S-KNPIV----------------IDLNNSLSAMK-QTIIR
U6RSB0          KRDKLVVG---------SS-S-KNPIV----------------IDLNNSLSAMK-QTIIR
I9GXM2          KRDKLVVG---------SS-S-KNPIV----------------MDLNNSLSAMK-QTIIR
I9SIK1          KRDKLVVG---------SS-S-KNPIV----------------MDLNNSLSAMK-QTIIR
A0A4Q5FNG1      KRDKLVVG---------SS-S-KNPIV----------------MDLNNSLGAMK-QTIIR
I9TP59          KRDKLVVG---------SS-S-KNPIV----------------MDLNNSLGAMK-QTIIR
R5S343          KRDRLIEN---------SS-D-NNPVV----------------ADMNRSLLAMK-QTIVN
A0A1M6K7I9      KRDKFVTG---------SS-D-RNPVV----------------MDLNNSLGAMR-QSILR
A0A5M6A8C8      KRDKFVTG---------SS-D-RNPVV----------------MDLNNSLGAMR-QSILR
A0A4V1YPN7      KRDKLVAG---------SS-N-KNPIV----------------IDLNNSLGAMK-QTIIR
A0A4Q5F874      KRDKLITG---------SS-N-KNPIV----------------IDLNNSLSAMK-QTIIR
A0A641LV22      KRDKLITG---------SS-N-KNPIV----------------IDLNNSLSAMK-QTIIR
A0A3R5ZMK1      KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A3E4ZTK7      KRDKLISN---------SS-N-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A1Y3ZIA4      KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
K5Y1A4          KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A4Q5CIT0      KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A3R6K8X4      KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A414GI87      KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A415BDM7      KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A412DM15      KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A7AEU7          KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A1Q6I3T6      KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A414XX40      KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A3R6BKI7      KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A414LPI6      KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A412M2W1      KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
K5ZX55          KRDKLISN---------SS-S-KNPVV----------------QDLNNSLIAMK-QTIIR
A0A5F0U645      KRDKLIGN---------SS-N-RNPVV----------------MDLNNSLGAMK-QTIIR
K5ZBN2          KRDKLIGN---------SS-N-RNPVV----------------MDLNNSLGAMK-QTIIR
A0A0J6CKW3      KRDKLIGN---------SS-N-RNPVV----------------MDLNNSLGAMK-QTIIR
A0A0F5IQM7      KRDKLIGN---------SS-N-RNPVV----------------MDLNNSLGAMK-QTIIR
A0A496CDT3      KRDKLIGN---------SS-N-RNPVV----------------MDLNNSLGAMK-QTIIR
S0GLB0          KRDKLIGN---------SS-N-RNPVV----------------MDLNNSLGAMK-QTIIR
A0A3R6NLC1      KRDKLIGN---------SS-N-KNPVV----------------MDLNNSLGAMK-QTIIR
A0A416WYC9      KRDKLIGN---------SS-N-KNPVV----------------MDLNNSLGAMK-QTIIR
A0A0F5IT40      KRDKLIGN---------SS-N-KNPVV----------------MDLNNSLSAMK-QTIIR
A0A496CX20      KRDKLIGN---------SS-N-KNPVV----------------MDLNNSLSAMK-QTIIR
A0A5F0UBI0      KRDKLIGN---------SS-N-KNPVV----------------MDLNNSLSAMK-QTIIR
S0GSI7          KRDKLIGN---------SS-N-KNPVV----------------MDLNNSLSAMK-QTIIR
K5YB65          KRDKLIGN---------SS-N-KNPVV----------------MDLNNSLSAMK-QTIIR
A0A0F5IWP9      KRDKLISN---------SS-N-KNPVV----------------MDLNNSLGAMK-QTIIR
A0A0F5IZT8      KRDKLISN---------SS-N-KNPVV----------------MDLNNSLGAMK-QTIIR
A0A417LKQ2      KRDKLISN---------SS-N-KNPVV----------------MDLNNSLNAMK-QTIIR
A0A416TME1      KRDKLISN---------SS-N-KNPVV----------------MDLNNSLNAMK-QTIIR
A0A416XPE8      KRDKLISN---------SS-N-KNPVV----------------MDLNNSLNAMK-QTIIR
A0A5C8KAD6      QYQKLKNT---------TA-E-NNPIL----------------ISLAEEIGKVK-PGIIE
A0A5N1J695      QYNNLKNT---------TA-E-NNPIL----------------LALADEIQKVR-PGILE
A0A1H4ADG3      QKERVLLS---------AT-P-DHPVV----------------KNLDNQIKGLR-SDMLS
A0A5B8VUR8      QKERALLS---------AT-A-DHPVV----------------KNLDNQIRSLR-SDMLS
A0A2A4G4B1      EKNQLLES---------AS-E-NHPTI----------------LTMNERLTELQ-KGIAI
A0A3N2M1H3      ARNNLVSN---------SS-E-RNPLV----------------EDYDSQLNGLR-ESITR
A0A4S2G8T2      ARNNLVSN---------SS-E-RNPLV----------------EDYDSQLNGLR-ESITR
A0A212K7W5      KRNTLLAN---------SS-D-NNPLV----------------LDIKQSLLFVR-EAIIS
F5IU11          KRNTLQAN---------SS-D-NNPLV----------------LDMKQSLLFMR-EAIIS
A0A3N2N6F7      ERDQLLST---------TG-E-NSPLV----------------KDRDNSLASIR-AALAS
A0A4P7VVU7      ERDKLSNS---------TG-D-TNPLL----------------QDYDKNLRSMR-SALVS
A0A2V1ILM4      ERDKLSNS---------TG-D-TNPLL----------------QDYDKNLRSMR-SALVS
A0A3N2L0E8      ERDKLSNS---------TG-D-TNPLL----------------QDYDKNLRSMR-SALVS
A0A3N2LFC5      ERDKLSNS---------TG-D-TNPLL----------------QDYDKNLRSMR-SALVS
A0A553LCN8      QRNHLLAE---------SG-E-KNPVV----------------QTADKNLAEMR-TVISG
K0XJ09          QRERLAAN---------SG-E-NNPLV----------------KDLDNNLAAVR-VNLTA
R5EUZ0          QRERLAAN---------SG-E-NNPLV----------------KDLDNNLAAVR-VNLTA
W0EQS0          QRERLVAN---------SG-E-SNPLV----------------RDLDSNLASVR-ENLSS
A0A1Y3WE15      QRERLAAN---------SG-E-NNPLV----------------RDLDNNLASVR-VNLAS
A0A1Y4GUK3      QRERLAAN---------SG-E-NNPLV----------------RDLDKNLASVR-INLAS
A0A352Z1R7      QKRTLLTD---------YT-E-NHPAV----------------RTIQGQIDEIQ-KKIRS
A0A0A2F501      ERNSLRAN---------SS-D-ENPIV----------------QDLTTQIGAMR-SIILS
R5B7P0          QRNNLVAN---------SG-E-ENVLV----------------KDLDQALASMR-GSISR
R5B0L5          ERNQLAAN---------SS-H-THPMV----------------VDMDNRLASMR-STILS
A0A374THP7      ERNNLVAN---------SS-E-QNPLV----------------ADYDQSLGSMR-KSITA
A0A3R5XWG1      ERNNIVAN---------SS-E-QNPLV----------------ADYDQNLNAMR-RSITA
A0A5P0Y910      ERNNIVAN---------SS-E-QNPLV----------------ADYDQNLNAMR-RSITA
A0A5P0XQC0      ERNNIVAN---------SS-E-QNPLV----------------ADYDQNLNAMR-RSITA
A0A414YFM3      ERNNIVAN---------SS-E-QNPLV----------------ADYDQNLNAMR-RSITA
A0A5P0VXP6      ERNNIVAN---------SS-E-QNPLV----------------ADYDQNLNAMR-RSITA
A0A5P0W892      ERNNIVAN---------SS-E-QNPLV----------------ADYDQNLNAMR-RSITA
A0A0A2EVS5      QLNRLLSN---------SS-E-KNPLV----------------IDMDRTLTAMR-RSILL
A0A1T4NAJ7      QLNRLLSN---------SS-E-KNPLV----------------IDMDRTLTAMR-RSILL
A0A255T941      DRNRLISN---------SS-E-ANPLV----------------QDLTSSLQSMQ-KTIVQ
A0A3N2KCL3      QRNSLLAK---------SS-D-KNPLV----------------VQLNEQMDQMR-HAILA
A0A4P7VSV0      QRNSLLAK---------SS-D-KNPLV----------------VQLNEQMDQMR-HAILA
A0A2V1IJY1      QRNSLLAK---------SS-D-KNPLV----------------VQLNEQMDQMR-HAILA
A0A4P7VXK7      QRNSLLAK---------SS-D-KNPLV----------------VQLNEQMDQMR-HAILA
A0A1Y4CHN5      QRNNLVAN---------SS-D-ENPLV----------------KDMDNALKSMR-EAIIT
A0A1M6I2S6      DRNRLIAN---------SS-E-KNPLA----------------KDMANSLQSMQ-RTIIQ
A0A1Y3V692      DRNRLIAN---------SS-E-KNPLA----------------KDMANSLQSMQ-RTIIQ
F3PXM2          ERNRLAAN---------SS-E-KNPLV----------------VDLTASLRNLH-HTVVQ
A0A3E4ZNL4      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A174AHH7      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A174JCE8      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A3E4JMC4      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A412SND6      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A414IEQ9      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A415UKN5      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A0M1W8D8      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A3R6GKX5      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A7V4S1          DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
B0NU19          DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
D4V601          DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A4Q0U3M9      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A4R4H1Q2      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A397WLT5      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A3R6GM96      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A015XH67      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A078RZN2      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A4R4I3T9      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A6L0K5          DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A7ACT5          DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A6KY94          DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A173UQR8      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A3R6HK75      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A412B7D1      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A412VNY9      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A414LTU9      DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
I9Q4U4          DRNRLIAN---------SS-E-KNPLV----------------KDLGNSMQSMK-RTILQ
A0A373ISF0      NRNRLIDN---------SS-E-KNPLV----------------KDLASSLQSMQ-RTIIQ
U6RF62          NRNRLIAN---------SS-E-KNPLV----------------KDLANSLQSMQ-RTIIQ
A0A662ZZD5      ERNRLIAN---------SS-E-KNPLA----------------KDMANSLQSMQ-RTIIQ
A0A395YYT3      ERNRLIAN---------SS-E-KNPLA----------------KDMANSLQSMQ-RTIIQ
A0A642JYJ3      ERNRLIAN---------SS-E-KNPLA----------------KDMANSLQSMQ-RTIIQ
A0A015UXN7      ERNRLIAN---------SS-E-KNPLA----------------KDMANSLQSMQ-RTIIQ
A0A5M5W148      ERNRLIAN---------SS-E-KNPLA----------------KDMANSLQSMQ-RTIIQ
A0A3A5TI83      ERNRLIAN---------SS-E-KNPLA----------------KDMANSLQSMQ-RTIIQ
A0A415NEB6      ERNRLIAN---------SS-E-KNPLA----------------KDMANSLQSMQ-RTIIQ
A7AJ60          ERNRLIAN---------SS-E-KNPLA----------------KDMANSLQSMQ-RTIIQ
A0A016E4F9      DRNRLIAN---------SS-E-KNPLA----------------KDMANSLQSMQ-RIIIQ
A0A4Q5CFJ7      DRNRLIAN---------SS-E-KNPLV----------------KDMANSLQSMQ-RTIIQ
A0A108TH71      DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
I8VXH0          DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
A0A412S0N6      DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
A0A412IIJ0      DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
A0A0P0FM97      DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
R6KTP3          DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
A0A139LU87      DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
A0A1C6B3Y5      DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
E2NMQ4          DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
A0A412YDB9      DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
R7DY01          DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
A0A414LGK8      DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
A0A415IPQ4      DRNRLIAN---------SS-E-KNPLV----------------SNMANSLQSMQ-RTIIQ
A0A3E5BRW7      DRNRLIAN---------SS-E-KNPLV----------------KNMANSLQSMQ-RTIIQ
K9DXS6          DRNRLIAN---------SS-E-KNPLV----------------KNMANSLQSMQ-RTIIQ
A0A1M6KFV3      DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
A0A1Q6G7L3      DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
A0A413H235      DRNRLIAN---------SS-E-KNPLV----------------KNMASSLQSMQ-RTIIQ
A0A1M5B2J8      ERNNLVSK---------SS-V-KNPLV----------------VEMDASLAAMR-KALVS
A0A255RCT5      ERNNLVSK---------SS-D-KNPLV----------------VEMDASLASMR-KALVS
A0A1Y4GLF5      QRNNLVAN---------SS-T-DNPLV----------------VDMDQALKSMR-KAIIG
A0A1H3XSC0      QRNSLVAN---------SS-T-QNPLV----------------VDMDQALTAMR-HAIVQ
A6LE40          QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A4Y1VPX5      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
B3JI46          QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
R6NN15          QRNNLVAN---------SS-E-QNPLV----------------VDMDESLRSMR-RSIVS
A0A358R8U0      QRNSLVAN---------SS-T-QNPLV----------------VDMDQALSEMR-RAIIT
R6WSB6          QRNSLVAN---------SS-T-QNPLV----------------VDMDQALSEMR-RAIIT
A0A4Q5ENK6      ERNSLVSH---------SS-V-KNPLV----------------REMDKLLEDMR-SALIT
A0A401LPX7      ERNSLVSH---------SS-V-KNPLV----------------REMDKSLDDMR-SALIT
A0A3A5Z900      ERNSLVSH---------SS-A-KNPLV----------------REMDKSLDDMR-SALIT
A0A3R6EGW5      ERNSLVSH---------SS-A-KNPLV----------------REMDKSLDDMR-SALIT
A0A285TGL6      ERNSLVSH---------SS-A-KNPLV----------------REMDKSLDDMR-SALIT
A0A3A5RFX4      ERNSLVSH---------SS-A-KNPLV----------------REMDKSLDDMR-SALIT
A0A1Q6IUW9      ERNSLVSH---------SS-V-KNPLV----------------REMDKSLDDMR-SALIT
A0A3R6NPG7      ERNSLVSH---------SS-V-KNPLV----------------REMDKSLDDMR-SALIT
A0A413XDP6      ERNSLVSH---------SS-V-KNPLV----------------REMDKSLDDMR-SALIT
K6AP24          ERNSLVSH---------SS-V-KNPLV----------------REMDKSLDDMR-SALIT
A0A662ZYI7      ERNSLVSH---------SS-V-KNPLV----------------REMDKSLDDMR-SALIT
A0A078RYI7      ERNSLVSH---------SS-V-KNPLV----------------REMDKSLDDMR-SALIT
C7XEQ8          ERNSLVSH---------SS-V-KNPLV----------------REMDKSLDDMR-SALIT
D7INX6          ERNSLVSH---------SS-V-KNPLV----------------REMDKSLDDMR-SALIT
K5ZG55          ERNSLVSH---------SS-V-KNPLV----------------REMDKSLDDMR-SALIT
A0A3N2N9B8      QRNSLVEK---------SS-E-SNPLV----------------ISMDGQLAAMR-NAIIT
A0A3N2NMI0      QRNALVEK---------SS-D-TNPLV----------------VTIDQQLAALR-NAIVA
A0A359I8H7      TRNTLAAS---------SS-D-TNPLV----------------VDYDGQIKGLR-EAIVN
A0A3N2KA63      TRNTLAAS---------SS-D-TNPLV----------------VDYDGQIKGLR-EAIVN
A0A4Q0IMT7      TRNTLAAS---------SS-D-TNPLV----------------VDYDGQIKGLR-EAIVN
A0A3B9FAU3      QRNSLIAN---------SS-E-RNPIV----------------SDYDEQLAQIR-KVILE
A0A3C1E5L7      QRNSLIAN---------SS-E-RNPIV----------------SDYDEQLAQIR-KVILE
A0A4Q0UAV1      ERNRMLAT---------SS-D-NNPLV----------------QDRTNTLNTLR-KTMVQ
A0A354SN68      QRNNIVSN---------SS-E-SNPLI----------------KDIDTGLGTLR-EAILS
A0A3N2N595      QRNSLVDK---------SS-D-KNPLV----------------VSIDAQLSSIR-SVILK
A0A0A2DUD9      KRNNLVKN---------SS-E-SNPLV----------------VDLDANLNDLK-SVIVA
A0A3P1ZBJ5      QRNRLIMN---------SS-E-KSPTV----------------IELEARISKQR-QAIIA
R5FHS9          ERNQLLAN---------SS-E-ANPLV----------------KDLDQSLRLQR-SSIIT
A0A413TW79      ERNNLVAN---------SS-E-QNPLV----------------ADYDQSLASMR-HSIVT
A0A3E5E9M7      ERNNLVAN---------SS-E-QNPLV----------------ADYDQSLASMR-HSIVT
A0A3E4SK73      ERNNLVAN---------SS-E-QNPLV----------------ADYDQSLASMR-HSIVT
A0A415GGC6      ERNNLVAN---------SS-E-QNPLV----------------ADYDQSLASMR-HSIVT
A0A413DBH9      ERNNLVAN---------SS-E-QNPLV----------------ADYDQSLASMR-HSIVT
A0A495WI87      QRNSLVAN---------SS-D-QNPLV----------------IDLDHALAAMR-KAIVA
A0A354M4S6      QRNSLVAN---------SS-D-QNPLV----------------IDLDHALAAMR-EAIIA
R7DH52          QRNSLVAN---------SS-D-QNPLV----------------IDLDHALAAMR-EAIIA
A0A4Q5E7L5      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIVR
A0A4P8LP09      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A4R4GZU7      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A016CWA4      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A1C6H117      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A415TAH7      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A0M1W0V2      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A139KA16      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A174VQ92      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A1Q6HCG0      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A1Y4JYM9      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3A5QW67      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3A5RQE6      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3A6BP07      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3E5E153      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3Q9IP20      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A412WV15      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A413ICP6      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A414KYB9      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A5B3FWR2      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
E5WX00          QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
K0X3P3          QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3A5Z014      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A1M4YZ07      QRNSLVAN---------SS-A-ENPLV----------------MDMDQALASMR-GAIIR
A0A078S3Q8      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A069SJV7      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A3E5DXI5      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A3E5EM98      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A3E5F453      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
I9T3G6          QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A4Q5E5M7      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A0P0FQW1      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A5M5C0W6      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A642LZ22      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A5M5YM86      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A642LE65      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A5M5Y0P8      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
A0A642NJ89      QRNSLVAN---------SS-A-ENPLV----------------VDMDQALASMR-GAIIR
C3RFN5          QRNSLVAN---------SS-A-ENPLV----------------MDMDQALASMR-GAIIR
A0A3E4SYU0      QRNSLVAN---------SS-A-ENPLV----------------MDMDQALASMR-GAIIR
A6LGY1          QRNSLVAN---------SS-A-ENPLV----------------MDMDQALASMR-GAIIR
K5ZSH4          QRNSLVAN---------SS-A-ENPLV----------------MDMDQALASMR-GAIIR
A0A078T2W6      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3R6EAF7      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A5C6L2P1      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A412MJT7      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3E4WKT5      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3A5YY33      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A078TAH2      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A1E9CFZ7      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A373FYU5      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3A5TZ72      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3A5XBP2      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3A6MEG9      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3E4JP35      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3E4KP40      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3E4NX82      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A3E4XFU8      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A412RG70      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A412TD37      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A413GAA4      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A414M7I4      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A496BTA0      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A496D2V6      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A4Q5EN83      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A4Q5G1P5      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A5C6KCA6      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A5M5AHM5      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A641WNS6      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
E5UZA2          QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A069SMG6      QRNSLVAN---------SS-T-ENPLV----------------VDMDQALASMR-GAIIR
A0A1Y4PQK7      QRNNLVAN---------SS-E-QNPLV----------------MDIDQSLATIR-EAIIS
A0A1Y4IH41      QRNNLVAN---------SS-E-QNPLV----------------MDLDQSLATIR-GAIIS
A0A3A6AAP4      QRNNLVAN---------SS-E-QNPLV----------------MDLDQSLATIR-GAIIS
A0A1Y4DYA7      QRNNLVAN---------SS-V-NNPLV----------------ADMDQSLQNMR-NAIIS
A0A1Y3X4I9      QRNNLVAN---------SS-E-SNPLV----------------VDLDQSLQNMR-RAIIS
A0A1Y4FNK8      RRNDLVAN---------SS-E-KNPLV----------------IDMDQSLENMR-HAIVT
A0A355FD59      QRNNLLAN---------SS-E-QNPLI----------------KDLDQSLESMR-KAIVS
A0A359CEZ9      QRNNLLAN---------SS-E-QNPLI----------------KDLDQSLESMR-KAIVS
A0A353Q7B4      QRNNLLAN---------SS-E-QNPLI----------------KDLDQSLESMR-KAIVS
F8X3A5          QRNNLVSN---------SS-E-QNPLV----------------VDLDQSLQSMR-KAIVS
A0A1M3KVR9      QRNNLVSN---------SS-E-QNPLV----------------VDLDQSLQSMR-KAIVS
A0A4Y9IJS3      QRNNLVSN---------SS-E-QNPLV----------------VDLDQSLQSMR-KAIVS
A0A4Q5WS95      ERDRLSRT---------TA-E-NHPVM----------------QALDEQIDKLR-PSILD
A0A501VZX6      EYQKLRNT---------TA-E-NNPML----------------LTLAEEIQNVR-PGILE
A0A399SH26      QYQRLRKT---------TA-V-NNPIL----------------LSIADEIEKIR-PSILE
A0A501W1A9      QYQQLRKT---------TA-E-NNPLL----------------LSLREEIESIR-PGILE
A0A0E3ZGV6      QYQQLSKT---------TA-E-NNPLL----------------VSLREEIESIR-PGILE
A0A1I2N4S1      QYQQLKKT---------TA-E-NNPLL----------------ISLREEIDNMR-PGVLE
A0A2T5YE44      QYQQLKKT---------TA-E-NNPLL----------------ASLREEIDNMR-PGVLE
A0A1V9FHD0      EYGKLMKT---------TG-E-NNPAA----------------IELAKVIEQTR-PMILE
A0A4V4H170      EYEKLMKS---------TG-E-NNPFA----------------IAVAKEIEQLR-PLIAE
A0A1V9F098      EYEKLMKS---------TG-E-NNPFA----------------TAIAKEIEQIR-PIILE
A0A4R2VU64      EYEKMMKS---------TG-E-NNPFA----------------IALAKEIEQLR-PLILD
A0A4S8HY23      EYEKMMKS---------TA-E-NNPFA----------------IEVAKEIEQTR-PLILE
A0A1V9F383      EYETLLKT---------TA-E-NNPYA----------------VGVAKEIEQLR-PLVLE
G8TRZ6          EYESLLKT---------TT-V-NNPAA----------------TSAAKEIEALR-PLVLE
A0A543WA52      EYTKLKKT---------TA-E-NNPIL----------------VSIANEIEKIR-PSILE
A0A1M5BA90      QYERLKKT---------IP-G-GNPAM----------------FSLEAEIDNMR-PAILE
A0A512B879      QYERLRKT---------IP-G-GNPIM----------------FSLRNEIDKMK-PTILE
A0A559PPI3      EYERLKKT---------TA-V-NNPML----------------TSLADEINKIR-PNILD
A0A1T5CS78      DYERLKKT---------TG-E-NNPIL----------------TSISNQISKIR-PSILE
A0A0Q9Z8F1      EYERLKRT---------TA-E-NNPVL----------------TSISNQISKIR-PSILE
A0A2N0U0M7      EYERLKKT---------TA-E-NNPVL----------------TSISNQISKIR-PSILE
                                                                            

A0A1T5MMH4      QLAEL----------------------------------------------------KK-
A0A2W4R1L8      QLTEL----------------------------------------------------RD-
A0A2E5CV79      KVQQL----------------------------------------------------IA-
A0A2D4ZVH1      RTNNL----------------------------------------------------LSS
A0A0K8QSK7      NINSS----------------------------------------------------IS-
A0A1V6CN82      NINNI----------------------------------------------------VD-
A0A1M4XZ45      NVNNI----------------------------------------------------IS-
A0A399D319      NVNNI----------------------------------------------------IS-
A0A1M6GR99      NIAAA----------------------------------------------------AR-
A0A1M6TTV4      RLTSY----------------------------------------------------LD-
A0A4Q8RX32      NLQYA----------------------------------------------------VE-
K0X1U5          TVSKA----------------------------------------------------KE-
R5EXK3          TVSKA----------------------------------------------------KE-
A0A401UAP7      QLTEL----------------------------------------------------EK-
A0A1W2GF52      RLLAY----------------------------------------------------KN-
A0A2G5L7B8      RLVSY----------------------------------------------------QE-
A0A523GAC0      YLQAH----------------------------------------------------EK-
L8JW09          QLEKL----------------------------------------------------KT-
A0A5C7MX19      NLDNG----------------------------------------------------LV-
A0A364XUP5      HINAL----------------------------------------------------RT-
A0A1M5RLA9      QLEEQ----------------------------------------------------RA-
A0A385SFR9      QLEEQ----------------------------------------------------RA-
A0A5M4A9J4      NSRTM----------------------------------------------------LH-
A0A5M4B1C7      NSLNI----------------------------------------------------LK-
A0A0D3LFR6      ALQLY----------------------------------------------------ES-
M7N6D4          AIQGY----------------------------------------------------ES-
A0A1Q3ZMZ7      SIEVL----------------------------------------------------EK-
A0A2D8JJW3      FLDIR----------------------------------------------------VK-
A0A2W2AFF7      SLASL----------------------------------------------------KR-
A0A2N5YXE2      FIGST----------------------------------------------------IE-
A0A2W1NDY9      TLKAI----------------------------------------------------KN-
A0A5C8AQR5      SMSVI----------------------------------------------------QE-
A0A1G0CI31      SVDAI----------------------------------------------------EE-
A0A556N0M0      SVEVI----------------------------------------------------QE-
F2IKD6          SIEVI----------------------------------------------------QE-
A0A1I7BM74      IINAL----------------------------------------------------EE-
A0A2G2FJ17      IIIVL----------------------------------------------------KD-
A0A077ENE7      AVDNA----------------------------------------------------LR-
T0NN57          AVDNS----------------------------------------------------LR-
X5K347          AVDNS----------------------------------------------------LR-
A0A2I0QZ80      IIDAL----------------------------------------------------IE-
A0A3E1F1A3      VVVLL----------------------------------------------------SS-
A0A2U2XBJ3      VIDLL----------------------------------------------------SQ-
A0A4Q4KU94      IIALL----------------------------------------------------SS-
A0A2U1FKU2      AVDNY----------------------------------------------------IK-
A0A0A2F954      AVDNY----------------------------------------------------IK-
A0A0A2FW91      AVDNY----------------------------------------------------IK-
A0A2D2N2N1      AVDNY----------------------------------------------------IK-
Q7MWZ2          AVDNY----------------------------------------------------IK-
T2NDT6          AVDNY----------------------------------------------------IK-
W1R7P9          AVDNY----------------------------------------------------IK-
A0A1R4AFZ0      AVDNY----------------------------------------------------IK-
A0A1R4DVZ7      AVDNY----------------------------------------------------IK-
A0A5M4B212      NSRNI----------------------------------------------------MR-
A0A1T5K9D4      TIDNL----------------------------------------------------MT-
A0A3D1KEX9      SLDNY----------------------------------------------------VN-
A0A358Y7S2      SMKVI----------------------------------------------------ED-
A0A1X7J248      YLSSK----------------------------------------------------VS-
E4TQD2          YLNNK----------------------------------------------------VE-
A0A2J6HHN3      SAASL----------------------------------------------------LD-
A0A1Y3WMT8      TVSKA----------------------------------------------------KE-
A0A1Y4GQU1      TVSKA----------------------------------------------------KE-
A0A1V5W8T5      FIKIS----------------------------------------------------ND-
A0A2T8HKA9      AVDNA----------------------------------------------------VS-
A0A3B8INU3      AIDQE----------------------------------------------------RS-
A0A414ZBF2      AVDNL----------------------------------------------------VA-
A0A1Q3Q573      RTEYV----------------------------------------------------ID-
A0A662BAY3      NVNNI----------------------------------------------------IS-
A0A4U3L369      NLSSS----------------------------------------------------QA-
A0A357YNR3      SLQNE----------------------------------------------------KN-
A0A5E8AX52      ITEEY----------------------------------------------------KE-
F4KK08          SIDNL----------------------------------------------------IS-
A0A496LCF9      LMASV----------------------------------------------------DD-
A0A5P2G2A9      NLVNM----------------------------------------------------KN-
A0A419VXB7      NLDNL----------------------------------------------------IF-
C3J7R8          SVDNL----------------------------------------------------IK-
A0A0B0BTJ4      SIENV----------------------------------------------------AN-
A0A3B9CNN6      SIENV----------------------------------------------------AN-
R5X290          SIENV----------------------------------------------------AN-
A0A1Q6E6I7      SIENV----------------------------------------------------AN-
A0A1G8BVM8      SVDNL----------------------------------------------------VA-
A0A2G2F510      SVSAI----------------------------------------------------EN-
A0A316JZ08      SIATI----------------------------------------------------KL-
A0A1I1FXP9      IINET----------------------------------------------------TR-
A0A3N4H5N3      NISST----------------------------------------------------KT-
A0A2P8EAX2      NIRSN----------------------------------------------------RS-
A0A4V2F6N9      NIRSN----------------------------------------------------RS-
A0A3B9FXJ0      ALVNA----------------------------------------------------QE-
R5GSU5          SVHSL----------------------------------------------------VN-
A0A2A3UE91      SLDGV----------------------------------------------------RL-
A0A0A2G557      SIDNY----------------------------------------------------IK-
A0A2N2WFW8      SASGI----------------------------------------------------IA-
A0A1F3IU95      STIGL----------------------------------------------------LT-
A0A3D0VUF6      STIGL----------------------------------------------------LT-
A0A1T4PT95      SIDNY----------------------------------------------------IK-
A0A4P5TMD1      NINNS----------------------------------------------------KL-
A0A651GU15      AIQSM----------------------------------------------------RS-
A0A3Q9FR88      SIKFA----------------------------------------------------EE-
A0A553GEX3      SIKFA----------------------------------------------------EA-
A0A150ADJ9      SIKFA----------------------------------------------------EE-
A0A1B1FWQ4      SIRFA----------------------------------------------------EQ-
A0A1S1Z228      SIKFA----------------------------------------------------EQ-
A0A2A4PYG9      SIKSL----------------------------------------------------SR-
A0A1F3K695      FITSA----------------------------------------------------IS-
A0A353KZR1      FITSA----------------------------------------------------IS-
A0A2N2WYB5      FINST----------------------------------------------------VQ-
A0A1F3K4G0      FVNST----------------------------------------------------IV-
A0A356H8Y3      FVNST----------------------------------------------------IV-
A0A351HSA6      FVNST----------------------------------------------------IV-
A0A1F3Q014      SINSV----------------------------------------------------KN-
A0A2A4YXP3      SINSS----------------------------------------------------ND-
A0A2D5KD44      SINSL----------------------------------------------------ID-
A0A1F3R158      TILSL----------------------------------------------------VE-
A0A2M8ADX2      TIISL----------------------------------------------------VE-
A0A1J5B2H0      SIKSL----------------------------------------------------KN-
A0A1V5N756      SIKIA----------------------------------------------------LD-
A0A1F3SJM1      SVSTI----------------------------------------------------RN-
A0A2G2EB96      SIGAI----------------------------------------------------EN-
A0A2G6PRA9      SIAAI----------------------------------------------------EE-
A1ZKR2          LLARV----------------------------------------------------RK-
A0A1Q3GX01      IITKA----------------------------------------------------RK-
A0A349DQI4      LIAKA----------------------------------------------------RK-
A0A2N3IIZ0      SIDRY----------------------------------------------------KK-
A0A497D5Z2      NTNNI----------------------------------------------------IT-
A0A662B170      NTNNI----------------------------------------------------IT-
A0A2A5FYT6      SLKAM----------------------------------------------------KD-
A0A2E6SYP1      VVSNL----------------------------------------------------IV-
A0A2E5RLE8      VTKNI----------------------------------------------------IL-
A0A2E7TQF6      VTKNI----------------------------------------------------IL-
A0A2E6GVY9      VTKNI----------------------------------------------------IL-
A0A350JJ90      SLEVL----------------------------------------------------QK-
A0A3M1CDV2      TLYTL----------------------------------------------------KQ-
A0A522EYA6      SVKSI----------------------------------------------------KE-
A0A4P5U6G4      NIGNT----------------------------------------------------LK-
A0A2E2TFD1      SIISM----------------------------------------------------EV-
A0A2E4ELE6      SINSS----------------------------------------------------SN-
A0A2E3XZI5      YIKKA----------------------------------------------------VK-
A0A2M7NLQ9      FITLN----------------------------------------------------QR-
I4AFR0          FITLH----------------------------------------------------QR-
A0A2N2Y3E5      FLQTS----------------------------------------------------IN-
A0A2D9D7T6      SLIII----------------------------------------------------EE-
A0A1F3PPL5      FIKNT----------------------------------------------------IK-
A0A357QK06      FIKNT----------------------------------------------------IK-
A0A662AEA4      LLSTT----------------------------------------------------IN-
A0A0S2HYK8      FVKNN----------------------------------------------------IN-
A0A2N5ZWN6      FVNNN----------------------------------------------------LS-
A0A0F2NS19      TINSL----------------------------------------------------IS-
A0A2A5H8X6      TINSL----------------------------------------------------IT-
A0A2H0GAU8      TISSL----------------------------------------------------VV-
A0A2M8FTK1      TISSL----------------------------------------------------VV-
A0A2A5B3B0      SINSS----------------------------------------------------IS-
A0A5C6RXM7      SINTL----------------------------------------------------IK-
A0A2E0FJ09      GIKSL----------------------------------------------------LN-
A0A1F3FZ62      TLKSY----------------------------------------------------KS-
A0A1F3K211      TLKSY----------------------------------------------------KS-
A0A1F3KLL5      FVKTT----------------------------------------------------II-
A0A359D1M1      FVKTT----------------------------------------------------II-
A0A2E7CT70      YISKA----------------------------------------------------IE-
A0A2D5V560      YIKKA----------------------------------------------------VK-
A0A2D7K5A8      YIKKA----------------------------------------------------VK-
A0A2E1XQ82      YIKKA----------------------------------------------------VK-
A0A1V6I2U9      FTRST----------------------------------------------------IK-
A0A1F3C1M2      FISST----------------------------------------------------LS-
A0A1F3DS87      FISST----------------------------------------------------LS-
A0A2H0B957      LIKSN----------------------------------------------------YN-
A0A1F3CFW6      LIKSN----------------------------------------------------YN-
A0A2M7E2T8      LIKSN----------------------------------------------------YN-
A0A2M7NC69      LIKSN----------------------------------------------------YN-
A0A5C8A5B4      TAESL----------------------------------------------------VE-
A0A4Y9ITE2      TLDRS----------------------------------------------------LA-
A0A5M8NYX7      GIDIA----------------------------------------------------EN-
A0A3D5KRY6      NIESL----------------------------------------------------IS-
A0A1V5IPN7      EIQKFIAISLSQDPLSA----------------------------------------RN-
A0A0E3V905      TILTM----------------------------------------------------KN-
A0A553ETH6      NLKEL----------------------------------------------------YE-
A0A640Q161      QIRDL----------------------------------------------------IT-
A0A640QU49      QIRDL----------------------------------------------------IT-
A0A1Q3PII2      AIQYQ----------------------------------------------------KQ-
A0A351BXT2      STPEE----------------------------------------------------RR-
A0A2K8Z965      NILTM----------------------------------------------------KN-
A0A418M8U8      NIRTM----------------------------------------------------KT-
I2GTA4          NIRTM----------------------------------------------------KT-
A0A2K8ZAJ2      NIETI----------------------------------------------------RQ-
A0A368JPA3      TLATL----------------------------------------------------RG-
A0A5N1JI29      TLATL----------------------------------------------------RG-
A0A3P1BT12      TIATL----------------------------------------------------RS-
A0A3P1CI15      TIATL----------------------------------------------------RS-
A0A4R8CUK1      TVAIL----------------------------------------------------RN-
A0A3D0MYJ7      LTPDI----------------------------------------------------KN-
A0A662AH13      ASPEE----------------------------------------------------IR-
A0A5C7QA01      ------------------------------------------------------------
A0A3D3LS70      GTPEE----------------------------------------------------RK-
A0A1G1TM36      SVQNI----------------------------------------------------KA-
A0A1G7ZF38      AIEHQ----------------------------------------------------KR-
C6VS52          AIHQQ----------------------------------------------------KQ-
A0A0P7X1V8      LTNDL------------------IQSDAGLSFFGSSDGNVSNRFMTLRNEVLLLEVERQ-
A0A3B0C2S4      SLNVY----------------------------------------------------QT-
L8JI02          NVQNI----------------------------------------------------IN-
A6EBM4          NINAS----------------------------------------------------QS-
A0A416GA42      TMDNH----------------------------------------------------IE-
A0A4R5DL69      HIESK----------------------------------------------------RN-
A0A1T3IYP5      AVDNV----------------------------------------------------LK-
A0A1M4YED3      NVRNQ----------------------------------------------------KA-
A0A3P1Z8V4      SLANH----------------------------------------------------VK-
A0A2N3U785      NLRNI----------------------------------------------------KQ-
A0A0E3ZG78      NLRNI----------------------------------------------------KK-
A0A1I6BRK6      TLRNI----------------------------------------------------KN-
A0A243WAB1      NLRNI----------------------------------------------------KK-
A0A126PFG0      SVKNI----------------------------------------------------KA-
A0A3M1N7Z3      QVEQR----------------------------------------------------KQ-
A0A2H3NSN0      QIEGLEDRKERLTAEMVELAADPEVRVGQGA--------ALGRLTELRARIDEQEATVR-
A0A2P6C324      RIDGFEDRKMDLTEDLVEASREASGTAGGVATAEGGGIASIGQLGTLQGRIEEQTIKIE-
A0A1M6XHU0      QIDHFEKQREALQAQLV---QEMLGRSGQTPATE-----PLSYVEQLRARRIEKQLAIQ-
A0A5S9C8G0      QIDHFEKQREQLQAQLV---KEMIGRDSQAPASE-----PLSYVEQLRARRIEKQLAIQ-
G2SF81          QIDHFEKQREQLQAQLV---KEMIGRDSQAPASE-----PLSYVEQLRARRIEKQLAIQ-
A0A5S9EYW1      QIDHFEKQREQLQAQLV---KEMIGRDSQAPASE-----PLSYVEQLRARRIEKQLAIQ-
D0MHQ9          QIDHFEKQREQLQAQLV---KEMIGRDSQAPASE-----PLSYVEQLRARRIEKQLAIQ-
A0A4D7K1D4      QLAYL----------------------------------------------------EK-
A0A3C1ITV0      SVDNH----------------------------------------------------IS-
R7HN19          SVDNH----------------------------------------------------IS-
A0A060RD97      AINNT----------------------------------------------------VN-
A0A0D3L8Q3      NLSNI----------------------------------------------------RQ-
A0A5B6TJH8      NLRNI----------------------------------------------------KR-
A0A519U664      ------------------------------------------------------------
A0A519UDD1      NLRNI----------------------------------------------------KK-
A0A519MA34      NLQNI----------------------------------------------------KR-
A0A519UCX0      NLQNI----------------------------------------------------KQ-
R7PCR1          GVRSY----------------------------------------------------VN-
A0A350IHV0      SMDNL----------------------------------------------------IS-
A0A1G9E2A9      LIDFN----------------------------------------------------RT-
A0A098LL25      LIDIN----------------------------------------------------KR-
A0A2T2YJE8      LLAQN----------------------------------------------------IV-
A0A127B287      LLKEG----------------------------------------------------RG-
A0A3M9N829      IINSN----------------------------------------------------KA-
A0A0P0CSF9      VINGS----------------------------------------------------KG-
A0A5M8QQB8      IISSS----------------------------------------------------RA-
A0A3M9MNC3      AINGS----------------------------------------------------RS-
A0A5B6TAX2      ILNSS----------------------------------------------------RA-
A0A5N1IQ33      LLQGT----------------------------------------------------KE-
A0A512AYT3      LLEQN----------------------------------------------------IQ-
A0A5M6CYN7      LLDQN----------------------------------------------------IQ-
A0A369QP10      LLAQN----------------------------------------------------KL-
A0A126PDF2      QITQA----------------------------------------------------RK-
A0A2Z3GKA1      QITQA----------------------------------------------------RK-
A0A502GZP7      QITQA----------------------------------------------------RK-
A0A519SBU8      QLQQN----------------------------------------------------QR-
A0A4Q3JNZ3      QIQQN----------------------------------------------------LQ-
A0A519Q9V3      QLQQD----------------------------------------------------LQ-
A0A0M3RW20      ALQQS----------------------------------------------------MQ-
A0A495VFX4      ALQQS----------------------------------------------------MQ-
A0A1S9B3W0      LLQQD----------------------------------------------------VK-
A0A1W1VRL3      LLEQN----------------------------------------------------KL-
A0A1M6R305      TLKQS----------------------------------------------------RD-
A0A4Z0PHK3      LLQQN----------------------------------------------------RR-
A0A2M9B9H9      LIQQN----------------------------------------------------RR-
A0A4Z0QCY9      LLQQN----------------------------------------------------RR-
A0A418R9X5      LLSKD----------------------------------------------------RQ-
A0A428JSJ3      LLRKN----------------------------------------------------QQ-
A0A428KI59      LLRKN----------------------------------------------------QQ-
W8F1I6          LLRKN----------------------------------------------------QQ-
A0A246FQC0      LLRKN----------------------------------------------------QQ-
A0A372E5P8      LLRKN----------------------------------------------------QQ-
A0A1H3EMW1      LLRKN----------------------------------------------------QQ-
A0A1H9ZSN3      LLRKN----------------------------------------------------QQ-
A0A5N1J2M4      LLQRS----------------------------------------------------RD-
A0A519S476      QLAQD----------------------------------------------------LK-
A0A4Q3JRW8      QLQQD----------------------------------------------------LQ-
A0A519M923      QLEQD----------------------------------------------------LQ-
A0A4Z0ENW1      QLVQA----------------------------------------------------QK-
A0A519UDB4      QLSQS----------------------------------------------------QQ-
A0A3S0QKV1      LLQQN----------------------------------------------------AE-
A0A328BL48      LLQQT----------------------------------------------------LK-
A0A5R8WLY4      LMQQT----------------------------------------------------LK-
A0A1I5WSL8      LLRQS----------------------------------------------------QK-
A0A0U3JVM7      LLQQN----------------------------------------------------QK-
A0A1G1SSV2      LLRQN----------------------------------------------------QI-
A0A1G1SXV7      LLRQN----------------------------------------------------QV-
A0A0W8EDI5      LLQQA----------------------------------------------------SQ-
A0A3B7RBP8      LLQQA----------------------------------------------------RQ-
A0A3R9P8H7      LLRKD----------------------------------------------------QQ-
A0A238WIA7      LLVQN----------------------------------------------------QQ-
A0A212UCJ7      LLRQN----------------------------------------------------EQ-
A0A4Z0MQE1      LLRQN----------------------------------------------------QQ-
A0A4Z0PCF4      LLRQN----------------------------------------------------QQ-
A0A5D6VDG1      SLQQS----------------------------------------------------LQ-
A0A243WHR7      LLQQN----------------------------------------------------RR-
A0A5B8A0P6      SLQQS----------------------------------------------------RI-
A0A076HRT9      TMRQN----------------------------------------------------QE-
A0A4Z0PVM7      LLQQN----------------------------------------------------RR-
A0A1M6DHW8      QLQQN----------------------------------------------------RQ-
A0A4Q5LC61      QLQQN----------------------------------------------------RK-
A0A2A8CVM9      LTNQL---VAEATQSSGLPGATAGNDSQMGTS-------ALNRIMQLKTRITEQEIRIG-
A0A3C0ZQC7      RTEEFLLSLLPGQRSTG-----------SSND-------PASFLSEAKQKIIETQIQIQ-
A0A2E3R1D0      IARQLSAQSLASGSSPD-----------DQRS-------GFVRAADLRAQISAARVAVR-
A0A2T2USC0      LAQQYVQQTIAAGGVGSIPAKGEETTRRGQGR-------GLSYVVDLQRKVAQRRIEVN-
A0A2T2V0F3      LAQKYVSEAIAAGGIGSIPAEDRQGGGRQQGR-------GVGYVVELQREVAQKRIEVS-
A0A2T2S682      LADAYVEKTLAAGGIGA----GEGGEEGGGER-------GISYVVQLQRQIAQKEIQVN-
D5H561          LSDRYVEE-LMGGGLSP----KQGAQR----------------INELKRRIAEKKIQIT-
A0A2H3NWA9      IAARYVDQALAAGGAGP----GEDSE-----R-------GVGYVAEQREQLVQQRIQIS-
A0A2A8CVB6      LASKYVNESLAAGGVGS----QSGEN----SR-------SLTYVVEQRRAIAQHRIEVS-
A0A2P6C1S6      LANRYVEESLSAGGVAS----SSGEDG--GPS-------GVSYVAQQRREIAQKRIEIN-
A0A2T2UTM4      LASRYVRESLSAGGVAA----GGGGEG--GGS-------GVSYVAQQRREIAQQRIEVN-
R5RVP0          SVENL----------------------------------------------------IS-
R6A0L2          SLRSY----------------------------------------------------VN-
R7LG80          SVANY----------------------------------------------------IS-
A0A2L2WX98      SIQSY----------------------------------------------------VK-
A0A285T4L1      AVDNM----------------------------------------------------IV-
G5GD56          SVRSY----------------------------------------------------VR-
R5KD55          SINNM----------------------------------------------------IV-
A0A174QNT3      SIDNY----------------------------------------------------MR-
A0A4S2FGS1      SIDNY----------------------------------------------------VR-
R9I0H0          SIDNY----------------------------------------------------VR-
K5BUT9          SMDNY----------------------------------------------------MK-
A0A174FPA3      SMDNY----------------------------------------------------MK-
R6S9Y6          SMDNY----------------------------------------------------MK-
A0A642LIH6      SMDNY----------------------------------------------------MK-
C9KX15          SMDNY----------------------------------------------------MK-
R6DAG6          SMDNY----------------------------------------------------IK-
A0A3L8AAP1      SMDNY----------------------------------------------------IK-
A0A4S2AYX2      SMDNY----------------------------------------------------IK-
A0A4Y9H477      SMDNY----------------------------------------------------IK-
A0A0E2M2Y7      AVDNY----------------------------------------------------IK-
A0A0K2J6Z0      AVDNY----------------------------------------------------IK-
B2RKZ8          AVDNY----------------------------------------------------IK-
A0A212GC82      AVDNY----------------------------------------------------IK-
A0A254MU12      AVDNY----------------------------------------------------IK-
R6CQ93          AVDNM----------------------------------------------------IV-
A0A3D1NQW3      TLDSY----------------------------------------------------IS-
B0MT10          TLDSY----------------------------------------------------IS-
R7JGW9          TLDSY----------------------------------------------------IS-
A0A414Q925      AVDNL----------------------------------------------------IA-
A0A415PUS9      AVDNL----------------------------------------------------IA-
A0A108TCU0      AVDNL----------------------------------------------------IA-
A0A413BA42      AVDNL----------------------------------------------------IA-
S3Y344          AVDNL----------------------------------------------------IA-
A0A4Q5G8Y8      AVDNL----------------------------------------------------IA-
A0A412TGL3      AVDNL----------------------------------------------------IA-
A0A413VJ33      AVDNL----------------------------------------------------IA-
A0A414L0W6      AVDNL----------------------------------------------------IA-
A0A412DP39      AVDNL----------------------------------------------------IA-
A0A413ZSE8      AVDNL----------------------------------------------------IA-
B0NP84          AVDNL----------------------------------------------------IA-
R6AK43          AVDNL----------------------------------------------------IA-
A0A412N2D9      AVDNL----------------------------------------------------IA-
A0A1Y4JYS9      AVDNL----------------------------------------------------IA-
R6LHA4          AVDNL----------------------------------------------------IA-
A0A3D2BF46      SLQSH----------------------------------------------------IS-
A0A4Y1WUN1      SLQSH----------------------------------------------------IS-
A0A4Y1XL94      SLQSH----------------------------------------------------IS-
A0A358R538      SLDSH----------------------------------------------------IA-
A0A1Y4AAB8      SLDSH----------------------------------------------------IR-
A0A1Y3WWY9      SLDSH----------------------------------------------------IS-
A0A1Y4U5L4      SLDSH----------------------------------------------------IS-
A0A1Y3VCJ1      SLDSH----------------------------------------------------IA-
A0A1Y3QTW7      SLNSH----------------------------------------------------VS-
R6XWY7          SLNSH----------------------------------------------------VS-
A0A4Y1X9Y9      SLNSH----------------------------------------------------VS-
A0A4Y1WM66      SLNSH----------------------------------------------------VS-
A0A174AVF1      SLNSH----------------------------------------------------VS-
A0A656Q4F4      SLNSH----------------------------------------------------VS-
A0A1Q6EIY0      SLNSH----------------------------------------------------IS-
A0A5B5VN71      SLNSH----------------------------------------------------IS-
E4M8L3          SLNSH----------------------------------------------------IS-
I3YQ50          SLNSH----------------------------------------------------IS-
R5UEY8          SLNSH----------------------------------------------------IS-
A0A1H4D866      SLDSH----------------------------------------------------IS-
A0A5B3G4Y7      SLDSN----------------------------------------------------IS-
A0A374A9J5      SLDSN----------------------------------------------------IS-
A0A5B3GQN5      SLDSN----------------------------------------------------IS-
A0A1Q6E9S3      SLDSN----------------------------------------------------IS-
D4IJ36          SLDSN----------------------------------------------------IS-
A0A3E5HPT8      AVDNL----------------------------------------------------SK-
C6IJ48          AVDNL----------------------------------------------------SK-
Q8A3U2          AVDNL----------------------------------------------------SK-
A0A3R6S1H6      TVDNL----------------------------------------------------IA-
A0A3R6SD81      TVDNL----------------------------------------------------IA-
A0A354WXN6      SIDNL----------------------------------------------------IV-
R5IP14          SIDNL----------------------------------------------------LV-
A0A316SZX7      SVDNL----------------------------------------------------LA-
A0A1Y4AIY1      SVDNL----------------------------------------------------IA-
F3ZRU7          SVDNV----------------------------------------------------IS-
A0A0J6CIR2      AIDNL----------------------------------------------------IV-
A0A3D8HG59      SVDNL----------------------------------------------------IV-
A0A3R6S408      SVDNL----------------------------------------------------IV-
A0A1C5Q1F3      TVDNL----------------------------------------------------IA-
R7A239          TVDNL----------------------------------------------------IA-
A0A3R6HIK7      SVDNL----------------------------------------------------IK-
K5ZVW7          SVDNL----------------------------------------------------IK-
A0A1Y4D5Z0      SVDNL----------------------------------------------------IV-
A0A413VXJ7      SVDNL----------------------------------------------------IV-
I9RSN9          SVDNL----------------------------------------------------IV-
U6RJK5          SVDNL----------------------------------------------------IV-
A0A1Q6GA32      SVDNL----------------------------------------------------IV-
I9RPU6          SVDNL----------------------------------------------------IV-
I8YFS5          SVDNL----------------------------------------------------IV-
A0A4Q5F7I7      SVDNL----------------------------------------------------IV-
I8Y597          SVDNL----------------------------------------------------IV-
A0A1Q6GBF5      SVDNL----------------------------------------------------IV-
I8YFZ3          SVDNL----------------------------------------------------IV-
A0A4V1YNX8      SVDNL----------------------------------------------------IV-
A0A1Q6GDH2      SVDNL----------------------------------------------------IV-
U6RSB0          SVDNL----------------------------------------------------IV-
I9GXM2          SVDNL----------------------------------------------------IV-
I9SIK1          SVDNL----------------------------------------------------IV-
A0A4Q5FNG1      SVDNL----------------------------------------------------IV-
I9TP59          SVDNL----------------------------------------------------IV-
R5S343          TMDNL----------------------------------------------------IE-
A0A1M6K7I9      SVDNL----------------------------------------------------IV-
A0A5M6A8C8      SVDNL----------------------------------------------------IV-
A0A4V1YPN7      SVDNL----------------------------------------------------IV-
A0A4Q5F874      SVDNL----------------------------------------------------IV-
A0A641LV22      SVDNL----------------------------------------------------IV-
A0A3R5ZMK1      SVDNL----------------------------------------------------IV-
A0A3E4ZTK7      SVDNL----------------------------------------------------IV-
A0A1Y3ZIA4      SVDNL----------------------------------------------------IV-
K5Y1A4          SVDNL----------------------------------------------------IV-
A0A4Q5CIT0      SVDNL----------------------------------------------------IV-
A0A3R6K8X4      SVDNL----------------------------------------------------IV-
A0A414GI87      SVDNL----------------------------------------------------IV-
A0A415BDM7      SVDNL----------------------------------------------------IV-
A0A412DM15      SVDNL----------------------------------------------------IV-
A7AEU7          SVDNL----------------------------------------------------IV-
A0A1Q6I3T6      SVDNL----------------------------------------------------IV-
A0A414XX40      SVDNL----------------------------------------------------IV-
A0A3R6BKI7      SVDNL----------------------------------------------------IV-
A0A414LPI6      SVDNL----------------------------------------------------IV-
A0A412M2W1      SVDNL----------------------------------------------------IV-
K5ZX55          SVDNL----------------------------------------------------IV-
A0A5F0U645      AVDNL----------------------------------------------------IV-
K5ZBN2          AVDNL----------------------------------------------------IV-
A0A0J6CKW3      AVDNL----------------------------------------------------IV-
A0A0F5IQM7      AVDNL----------------------------------------------------IV-
A0A496CDT3      AVDNL----------------------------------------------------IV-
S0GLB0          AVDNL----------------------------------------------------IV-
A0A3R6NLC1      AVDNL----------------------------------------------------IV-
A0A416WYC9      AVDNL----------------------------------------------------IV-
A0A0F5IT40      AIDNL----------------------------------------------------IV-
A0A496CX20      AIDNL----------------------------------------------------IV-
A0A5F0UBI0      AIDNL----------------------------------------------------IV-
S0GSI7          AIDNL----------------------------------------------------IV-
K5YB65          AIDNL----------------------------------------------------IV-
A0A0F5IWP9      AIDNL----------------------------------------------------IV-
A0A0F5IZT8      AIDNL----------------------------------------------------IV-
A0A417LKQ2      AVDNL----------------------------------------------------IV-
A0A416T