BYKdb

Dataset for cluster tadcd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

747 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1T5MMH4      ------------------------------------MELAKNNIHHQPLPSEGIDFNKLK
A0A2W4R1L8      ---------------------------------------METGTFKSGNSIEGIDFSKLR
A0A2E5CV79      --------------------------------------------------------MELM
A0A2D4ZVH1      ------------------------MHFNGNSSNGYNSGYSPLENETDSYIEKEIDLIKVF
A0A0K8QSK7      --------------------------------MEDPRLEIPGLPFFPEFEQSESMIKPFL
A0A1V6CN82      --------------------------------MTEYNDTDRTQDSAAQEELPVFNYKRLV
A0A1M4XZ45      --------------------------------MTQSEINKN-NQINSSSDDDTIDLKKII
A0A399D319      --------------------------------MTQMDINKNGHQINQSQDDDSIDLKKII
A0A1V5IPN7      --------------------------------------MDQNNQPSTVPQPEEIKISDYL
A0A1M6GR99      ------------------------------------------MNQQKLPEQNILNIQDIF
A6EBM4          -------------------------------------MTGESRKGQRGPSHREVDLLKIT
A0A7C5M4P4      --------------------------------MKLNPAESEAPLSSNVEAQQALDFTKLL
A0A1M6TTV4      --------------------------MNFSPEHNVLNQTNNQNADSSGSPLDDLDFDKIK
A0A4Q8RX32      ---------------------------------------------MALYDGQIDDFNVIF
K0X1U5          ----------------------------------------MEEKYTSERKNDNIDIVALW
R5EXK3          ----------------------------------------MEEKYTSERRNDNIDIVALW
A0A401UAP7      -------------------------------------MDKGFTNESE-----TIDFSKLK
A0A1W2GF52      ---------------------------MNPRNVHIPQDIRSHHNPENDGAFENFDFEKFR
A0A2G5L7B8      -----------------------------MRPIHGGQN----HNQSEGDPLSNIDFDKLN
A0A523GAC0      ----------------------------MTNQTFDIEKDNFVVRGQHSYLGGEIDIEKLH
L8JW09          -------------------------------------MENKNIYSDTEKPTEGIDLDKAL
A0A364XUP5      ----------------------------------MMLESNKIGPPVALPNTEGIDINKLR
A0A1M5RLA9      -----------------------------------MLETPKNIQPQQSQANEALDLNKLK
A0A385SFR9      -----------------------------------MLEIPKNIPPQQSPANEPLDLNKLK
A0A5M4A9J4      --------------------------------MKEQQPQPQPVFMPFFEQEEKIDFKKYF
A0A5M4B1C7      ----------------------------------MKEKQPQLVSVPFFEEEEKIDFRKYF
A0A0D3LFR6      ----------------------------MKEDTTYVEYTDAPDEQPEGGPLQSIDFDKLF
M7N6D4          ----------------------------MKEETTYVEYTEGQDTK-GWLPIHNIDFDKLY
A0A4D7K1D4      -----------------------------------------------------MDWEKLA
A0A5C7MX19      ------------------------------------------------------------
A0A1Q3ZMZ7      ------------------------------------------------------------
A0A2D8JJW3      ---------------------------------------------MATQSNKQFSIYDFL
A0A2W2AFF7      ---------------------------------MQDKNYTNHIVAAEQQEEGSLNVHKLI
R7PCR1          ----------------------------------MANNTVSSTVNQAELKEESINFQQII
A0A2N5YXE2      -------------------------------------MENKIPIFNQ-----KFDPRTFF
A0A1G9E2A9      ----MV---------EPTEIQHLGRPIDNE---------------EEESFLSVIDWPKLL
A0A098LL25      ----MSLL-------EDEDKRSLNGSGQR--------VSFADDSEEEDDVFGDFDFAKLL
A0A6J4H627      ----MSAFNG-----RSMDFPESVSSPGNQ--------------EEEDDVLGGLDFIKIL
A0A6C0GJI1      ----MSINNGKGPDVEEPQMISFNRQAEQE---------------EEDTLLGGLDLIRLY
A0A2T2YJE8      ----MTNK-------ESIVLEELENNYAAA------------VEVEEDSGGSDIDFIMLL
A0A7L7LEW0      ----MANK-------ESIVLEDLENNYTTA------------VEVEDDNGGSDIDFIMLL
A0A127B287      ----MSVK-------TGNNLDELDYHTSNA-------------DIEEEDSGSSIDLVTLW
A0A6P1P2P6      ----MSVK-------AGNNLDELDYHTGNA-------------ELEEEDSGSSIDLVTLW
A0A3M9N829      ----MSVK-------AANDLDELDHRLGSD-------------EGEEEDGGASIDFVTLL
A0A0P0CSF9      ----MSVK-------TVNDLDELDHRLGSG-------------EDEDDDGGTSIDFVTLL
A0A5M8QQB8      ----MSVK-------TANDLDELDHRLGSG-------------EDEEDDGGTSIDFVTLL
A0A3M9MNC3      ----MSVR-------TVNDLDELDHRLGGV-------------EDEEDDGGANIDFVTLL
A0A5B6TAX2      ----MSVK-------TVNDLDELDHRLGGV-------------EDEEDDGGTSIDFVTLL
A0A7L5A132      ----MAVD-------KDAELEELIRTAGGE-------------EGTEDDAGAGLDLATLL
A0A512AYT3      ----MALE-------KFADIDEL-NSRVAD-------------TESEEEGGSDVDFVILL
A0A5M6CYN7      ----MALE-------KFADIDEL-NSRVTD-------------TDSEEEGGSDVDFVTLL
A0A369QP10      ----MANK-------ESIVLEELDNSNYAS-----------TIEVEEESRGSDIDFIMLL
A0A7G7G7M4      ----MANK-------ESIVLEELDNSNYAS-----------TIEAEEENRGGDIDFIMLL
A0A126PDF2      ----MAVN-------ENAELEALIRNAIDGGTEPPTAATVGAAADDEA--DGGLDLSTLA
A0A2Z3GKA1      ----MAVN-------ENAELEALIRNAIDGGTEPPTAATVGAAADEEA--DDGLDLSTLA
A0A502GZP7      ----MAIN-------ENAELESLIRNAIDGGAEQPAAATAGGAADEEG--SEGLDLSTLA
A0A519SBU8      ----MALS-------ENAELEELIRRATGETASQLPPT-GAAAAADEEDLGGGFDIGTLV
A0A4Q3JNZ3      ----MALS-------ENAELEELIRRATGETAGQLPPTQGPTVGDEPEDLGGGLDLNTLV
A0A519Q9V3      ----MAVS-------ENAELEELIRKATGDTAGQLPPTSGPVLAAEQDDTGSSLDLNTLV
A0A0M3RW20      ---------------------------------MNTP----EPESETE--GSGLDLSTLV
A0A495VFX4      ----MAKN-------ENTELEDLIRNSLGNQPTVSVP----EPESETE--NSGLDVSTLV
A0A418R9X5      ----MAAK-------EDAELEELIRNAGG------------EPEEEEE--GGGLDLTTLL
A0A428JSJ3      ----MAAK-------EDAELEELIRSAGG------------EPEEEED--GGGLDLSTLL
A0A428KI59      ----MAAK-------EDAELEELIRNAGA------------EPEEEEE--GGGLDLTTLL
W8F1I6          ----MAAK-------EDAELEELIRNAGA------------EPEEEEE--GGSLDLTTLL
A0A246FQC0      ----MATK-------EDAELEELIRNAGG------------EEVEEDD--GGGLDLTTLL
A0A372E5P8      ----MAVK-------EDAELEELIRQAGGG-------E---PTEDEDD--GGGLDLTTLL
A0A1H3EMW1      ----MAAK-------EDAELEELIRNAGR------------ESEEQED--GGGLDLTTLL
A0A1H9ZSN3      ----MAAK-------EDAELEELIRNAGG------------EPEEEDD--GGGLDLTTLL
A0A1S9B3W0      ----MAVN-------ENAELEELIRNATSGGVNTPAPP---ASESDDDNVGGGLDLPLLL
A0A1W1VRL3      ----MAAK-------EETELEELIRNANGI-------E---TEDKEDE--GDGLDITTLL
A0A7G6YQJ9      ----MAAK-------EEVELEELIRNAGGG-------E---AESEEDE--GTGLDLTTLL
A0A1M6R305      ----MAVN-------ENAELEELIRNATGSGGASTVSA---ESEVVEE--GGGLDFDTLL
A0A7G7W8X3      ----MAVN-------ENAELEELIRNATGSGGVSTVPT---DAEAADE--GGGLDFDTLL
A0A4Z0PHK3      ----MAVN-------ENAELEELIRNAGGT-------E---TNAAEDE--GDGIDITTLL
A0A2M9B9H9      ----MAVN-------ENAELEELIRSAGGA-------E---PNAVEDE--GGGLDLTTLL
A0A4Z0QCY9      ----MAVN-------ENAELEELIRNAGGA-------E---PNAAEDE--DGGLDIATLL
A0A5N1J2M4      ----MMPT-------QSTELDELE-------------VKPAIVDAEEESSGSDFDLVTLV
A0A519S476      ------------------------------------------------------------
A0A4Q3JRW8      ----MAVS-------ENAELEELIRKATGEAAVQLPPTASSASTPELEDIGGGLDLNTLV
A0A519M923      ----MALS-------ENAELEELIKRATSDTAGQLPAAQNQPQSAEPEDLGGGLDLNTLV
A0A4Z0ENW1      ----MAST-------ENAELEELIRRASASGET--TPPTGPSFAEEEAEDGDNFDLSTLV
A0A519UDB4      ----MAMS-------ENAELEELIRRTTTGADS--SSSISAATSEEEAE--DSFDISTLV
A0A3S0QKV1      ----MAVN-------ENAELEELIRNATGGSGA----AAPTASAPEAEEAGSGLDLPLLL
A0A328BL48      ----MAVN-------ENAELEELIRNATSGGAA----PTAPAAESEDDSVGGGLDLPLLL
A0A5R8WLY4      ----MAVN-------ENAELEELIRNATSGGAA----PTAPAAESEDDSVGGGLDLPLLL
A0A1I5WSL8      ----MAIN-------ENTELEELIRNATGGSAA--PPETPASSGADPEDDSASLDISTLV
A0A0U3JVM7      ----MAIN-------ENTELEELIRNATGGTAS--PPEAPSASGGDADDDAPGLDIATLV
A0A1G1SSV2      ----MATN-------ENRELEELIRNATGGTAS--LPEAPTVGASEPEDESASLDITTLV
A0A1G1SXV7      ----MATN-------ENRELEELIRNATGGTAF--PSEAPAVGTGETEEESASLDITTLV
A0A6G8CBJ6      ----MAAK-------EETELEEMIRNAGGM-------EAEE-----KEDAGDGLDLTTLL
A0A0W8EDI5      ----MAVN-------KEAELEELIRASG---------EET------DDVAESSFDVATLL
A0A3B7RBP8      ----MAID-------KEAELEELIRSAGST-------EGQ------EEETDTAFDISTLL
A0A3R9P8H7      ----MAAN-------EDAELEEMIRNAGGN-------ESD------GEDDGGGIDFTTLL
A0A238WIA7      ----MAVN-------EEVELEDLVRNAGGE-------A--------DEDDGGGLDLTTLI
A0A212UCJ7      ----MAVN-------EDIELEELIRGAGGD-------A--------EEDQGGGLDLTTLL
A0A4Z0MQE1      ----MALN-------EEADLEELVRGAGGE-------A--------DEDQGGGLDLTTLV
A0A4Z0PCF4      ----MALN-------EEAELEDLVRSAGGE-------A--------DEDQGGGLDLTTLV
A0A6M6BED0      ----MALN-------EEAELEELVRNAGGE-------A--------DEDEGGGLDLTTLA
A0A5D6VDG1      ----MAIN-------ENAELEDLIRNSGGT-------PPVE---VQAEEENTGIDTTTLL
A0A243WHR7      ----MAVN-------ENAELEELIRNAGGN-------EAEV-----EDDEGAGLDLVTLL
A0A5B8A0P6      ----MALK-------EEAELEELIRNSGGV-------DAEA-----ADEDSEGFDITTLL
A0A076HRT9      ----MAVN-------ENAELESLIRNATGG-------VSAVPVESEPADDGGGLDFDTLL
A0A4Z0PVM7      ----MAVN-------ENAELEELIRSAGGA-------EPTA-----EDEDG-GLDIATLL
A0A1M6DHW8      ----MAIN-------ENAELEELIRNAGGG-------DTEA-----EGEEGSGLDIATLL
A0A4Q5LC61      ----MAVN-------ENAELEDLIRNAGGG-------DVEA-----EGEDDPGFDIATLL
K0XJ09          -------------------------------------MELIQETKNDKKNEGGVTLRDIV
R5EUZ0          -------------------------------------MELIQETKNDKKNEGGVTLRDIV
W0EQS0          -------------------------------------MELIQETKNEKKNEGGITLRDIV
A0A1Y3WE15      -------------------------------------MELIQETKNEKKNEGGITLRDIV
A0A1Y4GUK3      -------------------------------------MELIQENKNEKKNEGGITLRDIV
A0A2U1FKU2      --------------------------MPTEEKRITPYGGASRS--ESGEDISFFSVEEFL
A0A0A2F954      --------------------------MNLNEGSQNTFTRQGRSYISDTEDTAFFSLEEFF
A0A0A2FW91      --------------------------MNLNEGSQNTFTRQGRSYISDTEDTAFFSLEEFF
A0A2D2N2N1      --------------------------MNLNEDSKNTFTRQSRSYISDTEDTAFFSLEEFF
Q7MWZ2          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFF
T2NDT6          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFF
W1R7P9          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFF
A0A1R4AFZ0      --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFF
A0A1R4DVZ7      --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFF
A0A7C0WKI7      ----------------------------------------MQESWNNQLEEKPVRLTDYL
A0A2A8CVM9      MNDKNLSRFDSGDMTPAPLRNGHASNRMNGSAHHGGGSSGSSSEANA-----GIDVAEIL
A0A5M4B212      ------------------------------MDALNSNSANQMTTIVR-----QRNYRKYL
A0A3D1KEX9      -----------------------------MAEQYIEGAQQLQQEENE-----EMDIFSIL
A0A358Y7S2      ----------------------------------MSTGPIKKRVLNK-----EFNPLILE
A0A1X7J248      --------------------------MSNQQTRYQRNLEGNNSHRPQNQETEVVDFFKLK
E4TQD2          --------------------------MSNQQTRYQRNLEGNTSQKPQNQESEVVDFYKLK
A0A2J6HHN3      -------------------------------------MKQKIAKFND-----EFDFKLFL
A0A1Y3WMT8      -----------------------------------MEENYTSERRND-----SVDVLALW
A0A1Y4GQU1      -----------------------------------MEENYTSERRND-----SVDVVALW
A0A6A0R272      ---------------------------------------MNKNILAD-----KLELANFI
A0A1V5W8T5      -------------------------------------------MFND-----SFDVSKLI
A0A2T8HKA9      ----------------------------------MLKDTNIAGAEDK-----SINVLDLL
A0A2I0QZ80      -----------------------------------MEVNKKKLFVNT-----TFDTNILK
A0A3E1F1A3      -----------------------------------MINQKGKIFVNT-----TLDFKVLK
A0A2U2XBJ3      -----------------------------------MINQRGKIFVNT-----TFDLKVLK
A0A4Q4KU94      -----------------------------------MNSQKGKIFVNT-----TFDLKVLK
A0A3B8INU3      --------------------MAETNQEDYRARIQGGYPGERLEPFGNSSVLDKIDTEKIA
A0A2W1NDY9      ------------------------------MNNFHINNENAISSLNK-----DIDIDILK
A0A5C8AQR5      -----------------------------------MGSSERKIIINK-----EYNPHILS
A0A1G0CI31      ----------------------------------MNGAQQPSLLINR-----EYNPLIAA
A0A556N0M0      -----------------------------------MNSSNSSIFINK-----DYNPIIVN
F2IKD6          -----------------------------------MNNSNTSIFINK-----DYNPIIAQ
A0A1I7BM74      -----------------------------------MNSSKNRFFVNT-----EFDLDIIR
A0A2G2FJ17      -----------------------------------MEKRNNSIYVNT-----NFDTDILR
A0A2E3R1D0      MIDQPYPTAADRGA---------------------PGAPVRGEDPFYYGDRDGIDLRALL
A0A2T2USC0      --------------------------------------MNGQVGGMPAPQEDEITLQEII
A0A2T2V0F3      MHDGSAPSGNGHSNRWNSMN---------------PVNGQSQPSGEHGARDDEITLQELV
A0A2T2S682      -----MPRSSSFEYAGDGHPGNGRSAPDDEPSLY-DSAPDGPTGVD--------RLRALL
D5H561          --------MAHLQRRDPDQNGQG-----DIVRSW-EGGTNGAAGPSSGRQGIKGQIEELL
A0A2H3NWA9      -MASPSLPPNGQNGRHDAAPTPWPAQGQLYDEVY-HPEGNGVS-----------QLREMA
A0A2A8CVB6      MSPSSNMSSNGHRP--AGGPVNGIAGASLF---Y-DDNPQRGS-----------QLHELL
A0A2P6C1S6      -----MASTNGHPG-----SSQSVSVEDLL---YEDTTSRRSS-----------QLHDLI
A0A2T2UTM4      -----MASTNGYPSGEEGPGSRSLAVEDLL---Y-DNSDRRSS-----------QLHDLI
A0A414ZBF2      -------------------------------MRKDKFEDFDFIDFNESRSEESTVMADMI
A0A1Q3Q573      -----------------------MENKLDLTGSGGSAPKGQQTNFAE-----GFNLGLLI
A0A662BAY3      ---------------------------MTNNDNSGPVLRNLSSQTSE-----DYEIKKIL
A0A4U3L369      -----------------------------MEYNLNGNGAASNGSISHTDDADIFDIKKVI
A0A357YNR3      ------------------------------MSMYSEVEYEFNKLADK-----PVDVLSIL
A0A5E8AX52      -----------------------------MTENSNTSGSGLGADVNESDAFNDLDVEKLL
F4KK08          --------------------------------MEYQTASTQQEPIRSSEEVSTFSLRDIL
A0A6B5PK86      -----------------------------------MAENQNSFIINK-----SYDSLLFR
A0A2G2F510      -------------------------------------MSNKSFIINK-----NYDPLILR
A0A316JZ08      -------------------------------------MAKQKLFINT-----SYDPLILR
A0A496LCF9      --------------------------------MKNINSDNHSNPIFDEEDNPSFNILEWI
A0A5P2G2A9      ------------------------------MAENLLSNSGKGENAEE-----AIDFEKIL
A0A3C0ZQC7      ----------------------------------MNIGKGDIERIHRDGISQEPTFQDYV
A0A3N2N6F7      --------------------MQNNTQQPLSQQMPVYQAAPVVSEEED-----SINISDFL
A0A419VXB7      -----------------------------------MDRKEELLKLLLQKEEQPQNIKDFL
A0A0B0BTJ4      -----------------------------MTENNKDIIDGRKEEENK-----SITLRDIF
A0A3B9CNN6      -----------------------------MTENNKDIIDGRKEEENK-----SITLRDIF
R5X290          -----------------------------MTENNKDIIDGRKEEENK-----SITLRDIF
A0A1Q6E6I7      -----------------------------MTENNQDIIDGRKEEENK-----SITLRDIF
C3J7R8          ------------------------MEYRESETKSIEQELKRPSLVEAASFITLSDIGL--
A0A1G8BVM8      --------------------------------MSKNSEQFDFVDFNDGNSNDNTAIADLL
A0A1I1FXP9      ----------------------MLQNAEAINNALVELEEEEELRAEK-----GINSDKLL
A0A4P7VVU7      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSSFNLHDFF
A0A2V1ILM4      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSSFNLHDFF
A0A3N2L0E8      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSSFNLHDFF
A0A3N2LFC5      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSSFNLHDFF
A0A7K3KWJ8      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSSFNLHDFF
A0A3N4H5N3      --------------------------------MYMKRVLGNKMGNEE-----PIDLSVVF
A0A2P8EAX2      ----------------------------------MNQNKARNKGAGE-----PIDLFKSV
A0A4V2F6N9      ----------------------------------MSHNRTKNKGAGE-----PIDLMRSV
A0A3B9FXJ0      ---------------------------MSNNAKFQAAPQQESTSGSS-----GVDLQLLL
R5GSU5          ------------------------------MANQNYINPPAVQQETE-----DIDWLSIV
A0A2A3UE91      -------------------------MFNPQVESANNQLKDITEKFNS-----GFDIGVIA
A0A0A2G557      ------------------------------MNNNLYTNPEEGFIENNLSEEQMISLSDIF
A0A2N2WFW8      ------------------------------------MAEYKKSKLND-----DFDFKLFL
A0A1F3IU95      ------------------------------------MTDSRKIKFND-----EFDFKLFL
A0A3D0VUF6      ------------------------------------MTDSRKIKFND-----EFDFKLFL
A0A1T4PT95      ----------------------------MNSNPYSNSSDVIMEKHQEIPEENMISLSDIF
A0A6I6JYY3      ----------------------------------MTTQRFQNNGIEHNNDEDSIDLKKLV
A0A2A4PYG9      -----------------------MYNQTTSGTDNVNAYQDRMSNFSQ-----EFDLGVFI
A0A1F3K695      ------------------------------------MEEKKIPLINE-----KFDLGLFL
A0A353KZR1      ------------------------------------MEEKKIPLINE-----KFDLGLFL
A0A2N2WYB5      ------------------------------------MYQGKIPLIND-----KFDFAIFM
A0A1F3K4G0      ------------------------------------MYQGKIPIIND-----KFDLAIFL
A0A356H8Y3      ------------------------------------MYQGKIPIIND-----KFDLAIFL
A0A351HSA6      ------------------------------------MYQGKIPIIND-----KFDLAIFL
A0A1F3Q014      ----------------------MLQEDISKTNDNFERYKERISNFSG-----EFELGLFI
A0A2D5KD44      ----------------------MQEQLSPHELEKLKQSQSSLSSFNT-----DFDLGLFL
A0A6N9NIX1      -----------------------------------MDENSNLSSPNTVNSSNEFDLGLLL
A0A2A4YXP3      ------------------------MEENTSSNNLNEERARKRSNLNT-----ESDPILFF
A0A1F3R158      ----------------------------MSEEYRDKQNNEAISNFNT-----ELDIILLL
A0A2M8ADX2      ----------------------------MNDEFNNKENKETVSNFNT-----ELDIILLL
A0A1J5B2H0      ------------------------------------MQPKKFSIINE-----EIDPKLFL
A0A1V5N756      ------------------------------------MANIKISYLND-----EFDLKLLL
A0A651GU15      ----------------------MIDENISKVNQSYEGYKERLTNFGS-----QFELGLFL
A0A3Q9FR88      ---------------------------MTDFDKEWDDLNNEGDNLSN-----NIDFDKLE
A0A553GEX3      ---------------------------MTDFDKEWDDHDNDGDNLSN-----NIDFDKLE
A0A150ADJ9      ---------------------------MTDFDKEFDDFDREDGNIAD-----SIDFDKLE
A0A1B1FWQ4      ---------------------------MSDFEKEWEDLENNEESSAN-----DIDFDKLE
A0A1S1Z228      ---------------------------MSDFEKEWEDLDNNEESSAN-----DIDFDKLE
A1ZKR2          --------------------------MTDQSNIPNINTPSEDDDFLN-----ALDLEKVW
A0A1Q3GX01      --------------------------MEEQNHILPNNNSSENDDFFS-----SIDLEKIW
A0A349DQI4      --------------------------MEERNHILPTNNDSENDDFLS-----NIDLEKIW
A0A4P5TMD1      ------------------------------MLEKKIILSPMQKILGE-----DFNPGLLM
A0A2N3IIZ0      -------------------MAQYLTEEERFRRLLQTDDIDSGESPLE-----AIDFAKIL
A0A7K3WUF2      ----------------------MYNEDINKLNSNFDSYRERLTNFSN-----EFELGLFL
A0A1F3SJM1      ------------------------------------MSNKKSLIINK-----SYDPLILR
A0A2G2EB96      -------------------------------------MSSKGIIINT-----SYDPLILR
A0A2G6PRA9      -------------------------------------MNNKGLIINK-----SYDPLILR
A0A497D5Z2      ---------------------------MTPPNQRNNKPVSGKSASNE-----DMDVRRLV
A0A662B170      ---------------------------MTPPNQRNNKPVSGKSASNE-----DMDVRRLA
A0A2A5FYT6      ---------------------------METSSFSNNNEHNAFAKQQS-----DFDFGLLL
A0A2E6SYP1      ------------------------------------MEKEKLSILND-----EFDLGLAL
A0A2E5RLE8      ------------------------------------MEKEKLSILND-----EFDLGLAI
A0A2E7TQF6      ------------------------------------MEKEKLSILND-----EFDLGLAI
A0A2E6GVY9      ------------------------------------MEKEKLSILND-----EFDLSLAI
A0A350JJ90      --------------------------------MTEETNTNNLGVHSS-----QFDLGLLL
A0A3M1CDV2      -------------------------MLVANTDNEYHSYKQRLENFSN-----NLDIGLLI
A0A6C1QGZ7      ---------------------------------MTNPSLKKISTIND-----EIDIKLFL
A0A4P5U6G4      -----------------------------MQEEKKIILSPLQKLIGS-----DFNPGLLF
A0A2E2TFD1      ----------------------MIQDAREEQNESLDLYKERLTKFSQ-----DFEIGLFI
A0A2E4ELE6      ----------------------MIHEDTSRNNENLDKYKERLTNFSQ-----EFEIGLFV
A0A522EYA6      ----------------------MLADQFSNSSNSFSQYKERVSNLSQ-----EFEIGLFI
A0A2E3XZI5      ----------------------MKQENFVQTEENINRYKENITSLTQ-----DFELGLFL
A0A6I7QXV0      ------------------------------MSRGNSILSILQNFLGK-----DFNLSLLV
A0A2M7NLQ9      ---------------------MSDFDENPFINPAQAADASNEENFLA-----DFDVSKLI
I4AFR0          ---------------------MSDFDENPFINTVPTAETSNEENMLA-----DFDVSKLI
A0A2N2Y3E5      ------------------------------------MEERRIPILNE-----TFDIPLFL
A0A2D9D7T6      ----------------------------------MSSLNQRKLIVNK-----DYNPLILG
A0A1F3PPL5      -------------------------------------MQKKIPLINE-----TFDVRIFT
A0A357QK06      -------------------------------------MQKKIPLINE-----TFDVRIFT
A0A662AEA4      ------------------------------------MQQNKIPIINE-----KFDLQIFL
A0A0S2HYK8      ------------------------------------MQNRKIPIIND-----TFDIITFK
A0A2N5ZWN6      ------------------------------------MQKNKIPIIND-----TFDITTFK
A0A2E0FJ09      ----------------MIEEEISKRNDSFER------YRERLTNFSS-----EFEIGLFL
A0A1F3FZ62      -------------------------------------MAAKISQINT-----EFDLGLLF
A0A1F3K211      -------------------------------------MAAKISQINT-----EFDLGLLF
A0A1V6I2U9      ------------------------------------MDENKTSLFNQ-----KFDARTFL
A0A2H0B957      ------------------------------------MEQKNIPILNE-----KFDFNISL
A0A1F3CFW6      ------------------------------------MEQKRIPILNE-----KFDVNIFL
A0A2M7E2T8      ------------------------------------MEQKRIPILNE-----KFDVNIFL
A0A2M7NC69      ------------------------------------MEQKRIPILNE-----KFDVNIFL
A0A1F3KLL5      ----------------------------MKQ------QQRLIPVIND-----KFDLPIFL
A0A359D1M1      ----------------------------MKQ------QQRLIPVIND-----KFDLPIFL
A0A0F2NS19      -----------------------MQEDQFAH------KKEVVSNFNT-----ELDIILLL
A0A2A5H8X6      -----------------------MQEDQFAH------KKEVVSNFNT-----ELDIILLL
A0A2H0GAU8      -----------------------MEEEQFSN------KREPISNFNT-----ELDIILLL
A0A2M8FTK1      -----------------------MEEEQFSN------KREPISNFNT-----ELDIILLL
A0A2A5B3B0      -----------------------MEENNSSNNINEE-KTRKRSNLNT-----ESDPILFF
A0A5C6RXM7      -----------------------MESNNQINSNQDVIKNRKHSTFNT-----ESDPILLL
A0A1F3C1M2      ------------------------------M------SEKKIPLINE-----KFDIGLFV
A0A1F3DS87      ------------------------------M------TEKKIPLINE-----KFDFALFI
A0A6A0R6K9      ----------------MYNQIEKNEIENVNR------YKDRLSNINK-----DFDIGLFI
A0A2E7CT70      ----------------MIPEEIKNTEDNLLR------YRERIANFSK-----DFEIGLFL
A0A2D5V560      ----------------MESENFKXVEXNFQR------YKENVADLTQ-----EFELGLFL
A0A2D7K5A8      ------MVNHYSNQSIMGAEEFKGAEENIQR------YKENVSDLTQ-----EFELGLFL
A0A2E1XQ82      ------MVNHYSNKSIMGVEDFKGTEDSIQR------YKENVADLTQ-----EFELGLFL
A0A5C8A5B4      -------------------------------------MNVAPSADT-------IDLRAIF
A0A7C1LGX3      ------------------------------MTETPFNLDYDQKQDR-------FDLGEIL
A0A4Y9ITE2      -------------------------------MKEINITSNKGKDKK-------IDIIELL
A0A5M8NYX7      --------------------------------METTNMQAEQSGEE-------GSLADIF
A0A0E3V905      ---------------------------MSANTYTYTQHQLVESDGL-------NIRALLS
A0A553ETH6      ---------------------------------MNSINENNQEYEG-------IDLDKAQ
A0A640Q161      -----------------------------MAVNSREELNVGVFENE-------TIDIAHY
A0A640QU49      -----------------------------MAVNSREEFHNGMFENE-------TIDVAHY
A0A1Q3PII2      ------------------------------MLATKIPSTDLALSRD-------WTANPLW
A0A351BXT2      ----------------------MNKPSLNGKSNHTAVNSPELRESK-------DNFKIYL
A0A2K8Z965      --------------------------MTNESNYSYTTHQVVESEGL-------NLRNLIS
A0A418M8U8      --------------------------MNNQFQHSYVPYKMMEPEEL-------RVSDLLP
I2GTA4          --------------------------MNNQFNHSYVPYKMMEPEEL-------RVSDLLP
A0A2K8ZAJ2      ---------------------------MNMNPNVYTPYQTADVESK-------YNLGTLL
A0A368JPA3      --------------------------MKSSNMYSYPMYPQGEINSS-------DGQGTLK
A0A5N1JI29      --------------------------MKSSNMYSYPMYPQGEINSS-------DAKGTLK
A0A7K0EGC9      --------------------------MKSSHMYSYPTYPQGEISSS-------DVRGTLK
A0A3P1BT12      --------------------------MKSSNMYGYPMYPQGEITSS-------DVPGTLK
A0A3P1CI15      --------------------------MKSANMYNYPMYPQGEMSSS-------DGKGTLK
A0A4R8CUK1      --------------------------------MHTNPINLRRKISS-------SDGRGAW
A0A3D0MYJ7      --------------------------MNKNQDIFIDETKSGTETTI-------NDIRFYF
A0A662AH13      -----------------------------MNSGYNNNNSGFEIEET-------NSLKDYI
A0A5C7QA01      ----------------------------------MNQNQNTHTEDT-------IDLKELF
A0A3D3LS70      ----------------------------MSDKSNNIPSVLKKDKEI-------DNLHLFL
A0A1G1TM36      ------------------------------------------------------------
A0A1G7ZF38      ------------------------------MLANKTQIAD---FQD-------WTKNPFW
C6VS52          ------------------------------MLTTKGPTNDYPPFQD-------WANHPLW
A0A2A4G4B1      ------------------------------MISSGSPLKHDDEME--------IDLQELL
A0A0P7X1V8      -------MTDTNGHNTNGYNGRYRGEEIANQYSGQAGLQREDNDDE-------IDLLQIF
A0A6P1P355      ----------------------------------MTDNNQTTQEE--------SLFDSLA
A0A5C8KAD6      ------------------------------------------------------MFLDLV
A0A5N1J695      --------------------------------MLQVNKDIPNSEE--------SMFSSLM
A0A3N2M1H3      --------------------------------MDNTKTKPEGISGFSD-----FSIKDYI
A0A4S2G8T2      --------------------------------MDNTKTKPEGISGFSD-----FSIKDYI
A0A212K7W5      -------------------------------------MKRNTEEDF-------IQIQDLW
F5IU11          -------------------------------------MKKNTEEDF-------IRIQDLW
A0A7C1QWC7      -------------------------------MSNKNDIRPDT-----------FNVKEFI
A0A352Z1R7      --------------------------MTSNVSIPPSQPLLRSGEN--------AHIYDYL
A0A0A2F501      --------------------------MKQEENSRSAQGALAEQDSF-------LSLRDLW
R5B7P0          -----------------------------MENNINTDNNTRQQEET-------VQIGQLV
R5B0L5          ------------------------------MEEPTEHTPQQLSTTQ-------VKISDVI
A0A6I1TEC0      ------------------------------------MLRRNQGDDF-------LRLQDLF
A0A3R5XWG1      ------------------------------------MLRRNQGDDF-------LRLQDLF
A0A5P0Y910      ------------------------------------MLRRNQGDDF-------LRLQDLF
A0A414YFM3      ------------------------------------MLRRNQGDDF-------LRLQDLF
A0A6A7UIA7      ------------------------------------MLRRNQGDDF-------LRLQDLF
A0A6A7VPS3      ------------------------------------MLRRNQGDDF-------LRLQDLF
A0A374THP7      ------------------------------------MLRRNQADDF-------IRLQDLF
A0A6G1VND1      --------------------MIQNTTPANQPAQVNPLLRRNQADDF-------IRLQDLF
A0A0A2EVS5      -------------------------------MDEKVTTYKRNVEEY-------FSLKEIF
A0A1T4NAJ7      -------------------------------MDEKVTTYKRNVEEY-------FSLKEIF
A0A255T941      ------------------------------METNNNNQTNEQNDDF-------LRLQDLW
A0A4P7VSV0      ----------------------------MAETIKSEARKSVNAGSA-------VPLTDIL
A0A7J0AX49      ----------------------------MAETIKSEARKSVNAGSA-------VPLTDIL
A0A3N2KCL3      ----------------------------MAETIKSEARKSVNAGSA-------VPLTDIL
A0A2V1IJY1      ----------------------------MAETIKSEARKSVNAGSA-------VPLTDIL
A0A4P7VXK7      ----------------------------MAETIKSEVRKSVNAGSA-------VPLTDIL
A0A1Y4CHN5      -----------------------------MADNISANNQVKQSEDF-------ISIQDFL
A0A1M6I2S6      -------------------------------MIEKKTAVGKPADDF-------IRIQDLW
A0A1Y3V692      -------------------------------MIEKKTAVGKPADDF-------IRIQDLW
F3PXM2          -------------------------------MIENKNAVGKPADDF-------IRIQDLG
A0A174AHH7      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A174JCE8      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A3E4JMC4      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A412SND6      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A414IEQ9      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A7K0HNT3      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A0M1W8D8      -------------------------------MIKNRTNAGKPADNF-------IRIQDLW
A0A3R6GKX5      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A7V4S1          -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
B0NU19          -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
D4V601          -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A4Q0U3M9      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A7J5G2G2      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A7J5HH13      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A397WLT5      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A6A2J529      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A6N8DDD8      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A015XH67      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A078RZN2      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A0A6M4L7F4      -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A6L0K5          -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A7ACT5          -------------------------------MIKNRTNTGKPTDDF-------IRIQDLW
A6KY94          -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
A0A173UQR8      -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
A0A3R6HK75      -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
A0A412B7D1      -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
A0A412VNY9      -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
A0A414LTU9      -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
I9Q4U4          -------------------------------MIENRTSVGKSAEDF-------IRLQDLW
A0A373ISF0      -------------------------------MIEKKAAAGKPADDF-------IRIQDLW
U6RF62          -------------------------------MIEKKAAAGKPADDF-------IRIQDLW
A0A662ZZD5      -MDQRRFIPHFVGCANIQVTFRKGITLYFYNMTEKKTTASKPADDF-------IRIQDLW
A0A3A5TI83      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A415NEB6      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A7AJ60          -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A7J5MKN5      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A6A2JF01      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A7J4Y8G3      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A015UXN7      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A6I2NTL0      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A6I2Q447      -------------------------------MTEKKTTASKPADDF-------IRIQDLW
A0A016E4F9      -------------------------------MIEKKTIVGKSTDDF-------IRIQDLW
A0A6N3HG44      -------------------------------MIEKKTIVGKPTDDF-------IRIQDLW
A0A7K0HSP7      -------------------------------MIEKKTIVGKPTDDF-------IRIQDLW
A0A7K1HEJ5      -------------------------------MIEKKTIVGKPTDDF-------IRIQDLW
A0A6H9P0U9      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A108TH71      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
I8VXH0          -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A412S0N6      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A412IIJ0      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A0P0FM97      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
R6KTP3          -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A139LU87      -------------------------------MVEKKTPVGNPADDF-------IRIQDLW
A0A1C6B3Y5      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A6L3KCD1      -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
E2NMQ4          -------------------------------MVEKKTPVGKPADDF-------IRIQDLW
A0A412YDB9      -------------------------------MVEKKTPAGKPADDF-------IRIQDLW
R7DY01          -------------------------------MVEKKTPAGKPADDF-------IRIQDLW
A0A414LGK8      -------------------------------MVEKKTPAGKPADDF-------IRIQDLW
A0A415IPQ4      -------------------------------MVEKKTPAGKPADDF-------IRIQDLW
A0A3E5BRW7      -------------------------------MVEKK----KPADDF-------IRIQDLW
K9DXS6          -------------------------------MVEKK----KPADDF-------IRIQDLW
A0A1M6KFV3      -------------------------------MVEKK----KPADDF-------IRIQDLW
A0A1Q6G7L3      -------------------------------MVEKK----KPADDF-------IRIQDLW
A0A413H235      -------------------------------MVEKK----KPADDF-------IRIQDLW
A0A1M5B2J8      ------------------------------MATIQKKIQVHNTQDF-------IRIQDLL
A0A255RCT5      ------------------------------MATIQKKTQVQNTQDF-------IRIQDLL
A0A1Y4GLF5      ------------------------------MAINKDTTKNKQTDDF-------LRIQDLF
A0A1H3XSC0      ------------------------------MSINQK--RPTQTDDF-------IRVQDLL
A6LE40          -----------------------------MMTINPKNTKPGQQDDF-------LRIQDLL
A0A4Y1VPX5      -----------------------------MMTVNQKNIKPGQQDDF-------LRIQDLL
A0A6N2XMM4      -----------------------------MMTVNQKNIKPGQQDDF-------LRIQDLL
B3JI46          -----------------------------MMTVNQKNIKPGQQDDF-------LRIQDLL
A0A358R8U0      ------------------------------MEMTQNTSPAEPMDDS-------IQIKDLL
R6WSB6          ------------------------------MEMTQNTSPAEPMDDS-------IQIKDLL
A0A401LPX7      ------------------------------MATIQNKSTVQNMQDF-------ITIQDLF
A0A6G0GNY9      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A6I1BFM0      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A3A5Z900      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A7K0GW19      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A285TGL6      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A3A5RFX4      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A1Q6IUW9      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A413XDP6      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A6N8CVT6      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
K6AP24          ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A6I2NHV3      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A078RYI7      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A7I0QD01      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
C7XEQ8          ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
D7INX6          ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
K5ZG55          ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A662ZYI7      ------------------------------MATIQNKSTVQNTQDF-------ITIQDLF
A0A3N2N9B8      -------------------MAELLDLSSAPASPSATTRKKTAASNT-------LPISDIL
A0A3N2NMI0      -------------------------MAENNATAPAQRRKKTPESTP-------VPIVDII
A0A359I8H7      ------------------------------MSDNINVTQESEAAEE-------FSLKDFL
A0A3N2KA63      ------------------------------MSDNINVTQESEAAEE-------FSLKDFL
A0A4Q0IMT7      ------------------------------MSDNINVTQESEAAEE-------FSLKDFL
A0A7J0B660      ------------------------------MSDNINVTQESEAAEE-------FSLKDFL
A0A3B9FAU3      ------------------------MATNNSLESEKNYSATAENNELENGG---FNLRMLL
A0A3C1E5L7      ------------------------MATNNSLESEKNYSATAENNELENGG---FNLRMLL
A0A4Q0UAV1      -------------------------------MPTKMQAAPKRPADS-------INIKELL
A0A354SN68      -------------------------MYTNMDNNENTSLSTEKVEDE-------FVLKDFL
A0A6L5XFL0      -----------------------MAEDYYYGQDQDKNENQS------------LNIQDFL
A0A3N2N595      --------------------------MAEVNKI--QSNKKSGAAGA-------VPLSDII
A0A7J0ACS3      --------------------------MAEIKEPINKSRKNSIASGT-------VPLSDIF
A0A0A2DUD9      -------------------------MIQNTTTVVEKPAAEGQQENF-------FSLQDLW
A0A3P1ZBJ5      ------------------------------MVENEVNAPQNEQTTG-------VDIQDIL
R5FHS9          --------------------------MPNNQIQSQQPQQNQQSDDS-------VVITDFL
A0A413TW79      -------------------------------MQNAPGRRPQQAEDF-------IRLQDLM
A0A7K0AAG2      -----------------------MIQNNQATMQNVPGRRPQQAEDF-------IRLQDLM
A0A7K0ASF1      -------------------------------MQNALGRRPQQAEDF-------IRLQDLM
A0A3E5E9M7      -----------------------MIQNNQATMQNVLVRRPQQAEDF-------IRLQDLM
A0A3E4SK73      -----------------------MIQNNQATMQNVPGRRPQQAEDF-------IRLQDLM
A0A415GGC6      -----------------------MIQNNQATMQNVPGRRPQQAEDF-------IRLQDLM
A0A413DBH9      -----------------------MIQNNQATMQNVLVRRPQQAEDF-------IRLQDLM
A0A495WI87      ------------------------------MAAVQNNPKSKQSEEF-------MRIQDLL
A0A354M4S6      ------------------------------MAAVQNNPKSKQSEEF-------MRIQDLL
R7DH52          ------------------------------MAAVQNNPKSKQSEEF-------MRIQDLL
A0A7J5IAE7      ------------------------------MTINQKNTKPGQQNDF-------LRIQDLL
A0A016CWA4      ------------------------------MAVNQKNTRPGQADDF-------LRIQDLL
A0A4P8LP09      ------------------------------MAVNQKNTRPGQADDF-------LRIQDLL
A0A0M1W0V2      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A139KA16      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A174VQ92      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A1Q6HCG0      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A1Y4JYM9      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A3A5QW67      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A3A5RQE6      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A3A6BP07      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A3E5E153      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A3Q9IP20      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A412WV15      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A413ICP6      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A414KYB9      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A5B3FWR2      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A7J5QHB9      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
E5WX00          ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
K0X3P3          ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A1C6H117      ------------------------------MAVNQKNTKPGQPDDF-------LRIQDLL
A0A6I1AQV4      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A5C6L2P1      ------------------------------MTVNQKNIKPGQQDAF-------LRIQDLL
A0A412MJT7      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3E4WKT5      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3A5YY33      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A1E9CFZ7      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A373FYU5      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3A5TZ72      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3A5XBP2      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3A6MEG9      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3E4JP35      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3E4KP40      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3E4NX82      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A3E4XFU8      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A412RG70      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A412TD37      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A413GAA4      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A414M7I4      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A496BTA0      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A496D2V6      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A5C6KCA6      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A5M5AHM5      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I0Y5K7      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I1BFB8      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6I2P5W5      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6N8DC51      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A7J5HGP0      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A7J5HVL8      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A7J5JHD3      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
E5UZA2          ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A069SMG6      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
C3RFN5          ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A3A5Z014      ------------------------------MTINQKNIKPGQQDDF-------LRIQDLL
A0A7J5GD93      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A7K0HGR5      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A078S3Q8      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A069SJV7      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A3E5DXI5      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A3E5EM98      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A6N2YYD4      ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
I9T3G6          ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A3E4SYU0      ------------------------------MAINQKNTKPGQPDDF-------LRIQDLL
A6LGY1          ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
K5ZSH4          ------------------------------MAINQKNIKPGQQDDF-------LRIQDLL
A0A6A2RTB3      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A7J5PEN4      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A1M4YZ07      ------------------------------MSINQKNTKPGQPDDF-------LRIQDLL
A0A7J5I238      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A0P0FQW1      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A7K0I229      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A5M5C0W6      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A642NJ89      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6L3JTQ2      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A7J5FQU6      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A7J4YLH7      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6N3AEV2      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6G0G4T5      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A6L3KG29      ------------------------------MTVNQKNIKPGQQDDF-------LRIQDLL
A0A1Y4PQK7      -------------------------------MTIQNNTKPGQADDF-------LRIQDLF
A0A1Y4IH41      -------------------------------MAIQNNTKPGEADDF-------LSIQDLF
A0A3A6AAP4      -------------------------------MAIQNNTKPGQADDF-------LRIQDLF
A0A6I0ZRD2      -------------------------------MAIQNNTKPGQADDF-------LRIQDLF
A0A7L4SP06      -------------------------------MAIQNNTKPGQADDF-------LRIQDLF
A0A1Y4DYA7      -------------------------------MNENNTKSDLFLQES-------LNLKDLL
A0A1Y3X4I9      ------------------------------MSTLSDKETELFLDELEKSSSSGINFKDLM
A0A1Y4FNK8      ------------------------------MATQNNPARPKQADDL-------IRIQDLF
A0A355FD59      -----------------------------MALSQNNNVKQKQPEDF-------IRIQDLF
A0A359CEZ9      -----------------------------MALSQNNNVKQKQPEDF-------IRIQDLF
A0A353Q7B4      -----------------------------MALSQNNNVKQKQPEDF-------IRIQDLF
F8X3A5          -----------------------------MTSVQHNKTERKQTEDL-------IRLQDLL
A0A1M3KVR9      -----------------------------MTPVQHNKTEQKQTEDL-------IRLQDLL
A0A4Y9IJS3      -----------------------------MTSVQHNKTEQKQTEDL-------IRLQDLL
A0A1H4ADG3      -----------------------------MQTTTLDQLVPVKETK--------FDFTKIF
A0A5B8VUR8      -----------------------------MHTNTLDRLVPIKESK--------FDFTKVI
A0A0D3L8Q3      -----------------------------MTDQDNLLL--EDSEQ--------INFKEII
A0A7G7G5F9      -----------------------------MVNREVLPFETEPV-----------NLKNVI
A0A2N3U785      -----------------------------MNKKDIF---LAEPEN--------FDLRGVL
A0A5B6TJH8      -------------------------MQRLAGTEELFPLKAEKKDN--------NDIRNTF
A0A519U664      -----------------------------MDNKELFPLSSEQPES--------KDFKRII
A0A519MA34      ----------------------------MDNNKELFPLSSEQPES--------KDFRRMI
A0A519UCX0      ----------------------------MDNNKELFPLASEQPES--------RDFKRVL
A0A0E3ZG78      -----------------------------MMDKELFPLSSERAGE--------KDIRRIL
A0A1I6BRK6      -----------------------------MDSQELFSSDLSQAKA--------GDLKNIV
A0A243WAB1      -----------------------------MNTRELFPLNSEQVEE--------KDIKRMV
A0A6G8C8X6      -----------------------------MENKELFPLSSEQTEA--------KDIRGLI
A0A416GA42      -----------------------------MEQQNKQNVS-GSGLE--------LNPMDLL
A0A1T3IYP5      ---------------------------MDTIKQKNYIIENKKEQS--------INVLDLL
A0A1T5K9D4      ---------------------------------MENGNNQKNSGQ--------INLVDIF
A0A077ENE7      ---------------------------MNTINQKGYTIGDKKEHS--------INLLDIL
A0A7H1Z2Z7      ---------------------------MNTINQKGYTIGDKKEHS--------INLLDIL
A0A6I5UW06      ---------------------------MNTINQKGYTIGDKKEHS--------INLLDIL
T0NN57          ---------------------------MNMASQKINMTKESKEQF--------INVLDLL
X5K347          -----------------------------MASQKINMTKESKEQF--------INVLDLL
A0A060RD97      -------------------------------MVENKINNEQDPKS--------LTARQVV
A0A3C1ITV0      -------------------------MKEDYNSIGAAETE-DQKNE--------FQLSDMI
R7HN19          -------------------------MKEDYNSIGAAETE-DQKNE--------FQLSDMI
A0A350IHV0      --------------------MALENNNIDNRPALRNANGEEDGDI--------LSLTEIW
R5RVP0          -----------------------MPIDNNLDNRPSQVRNEEENDL--------LNLADLW
R6A0L2          -----------------------------METKSINPQE-QQDEE--------MQLIPLL
R7LG80          ------------------------------MNNVPDTFK-RDEEE--------MQIIPLL
A0A2L2WX98      -------------------------------MENTNNAT-IEKEE--------AQLIPLL
G5GD56          --------------------------------MSGSVQNKNKEED--------IQLIPLF
R5KD55          -----------------------------METNPVTQQTEETTEE--------ISIRDIL
A0A174QNT3      ---------------------------METNKTTDLKRTEN---V--------VTLRDLL
A0A4S2FGS1      ---------------------------METKKTTTSSPKEN---V--------ITLRDIV
A0A7K3KG59      ---------------------------METKKTTISSSKEN---V--------ITLRDIV
R9I0H0          ---------------------------METKKTTTSSPKEN---V--------ITLRDIV
K5BUT9          ---------------------------MEYIQENERTLKKDEG-G--------INLRDVV
A0A174FPA3      ---------------------------MEYIQENERTPKKDEG-G--------INLRDVV
R6S9Y6          ---------------------------MEYIQENERTPKKDEG-G--------INLRDVV
A0A7J4YSB2      ---------------------------MEYIQENERTPKKDEG-G--------INLRDVV
C9KX15          ---------------------------MEYIQENERTPKKDEG-G--------INLRDVV
A0A6H0KRK1      ---------------------------MEYTQENNEKTVKESGFN--------INLRDIV
R6DAG6          ---------------------------MEYTQENNEKTVKESGFN--------INLRDIV
A0A3L8AAP1      ---------------------------MEYTQENNEKTVKESGLN--------INLRDIV
A0A4S2AYX2      ---------------------------MEYTQENNEKTVKESGLN--------INLRDIV
A0A7J0A2L4      ---------------------------MEYTQENNEKTVKESGLN--------INLRDIV
A0A7K3MN31      ---------------------------MEYTQENNEKTVKESGLN--------INLRDIV
A0A0E2M2Y7      ------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------FSIEEYL
A0A0K2J6Z0      ------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------FSIEEYL
B2RKZ8          ------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------FSIEEYL
A0A212GC82      ------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------FSIEEYL
A0A254MU12      ------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------FSIEEYL
R6CQ93          --------------------------------MQNNNLSGKNEQS--------INLVDLF
A0A3D1NQW3      ----------------------MTPNNINPNSANSDTKQ-EEHIT--------FSVHDLI
B0MT10          ----------------------MTPNNINPNSANSDTKQ-EEHIT--------FSVHDLI
R7JGW9          ----------------------MTPNNINPNSANSDTKQ-EEHIT--------FSVHDLI
A0A3D2BF46      -----------------------MEE-NRNVNNVPAEGN-EDSIN--------FSIHDLI
A0A358R538      -----------------------MTE-RTINPQ---PAE-ETTGN--------VTLHDIL
A0A1Y4AAB8      -----------------------MIEQTPNTQHAPQNET-SEAGM--------FSLHDLI
A0A1Y3WWY9      -----------------------MIEQQPNNIPQQAFND-DQAGT--------INLHDII
A0A1Y4U5L4      -----------------------MIEQQPNNIPQQAFND-DQAGA--------INLHDII
A0A1Y3VCJ1      -----------------------MAE-IQFNTQTRDKIH-DQTPA--------IDLHDII
A0A1Y3QTW7      -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
R6XWY7          -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
A0A4Y1X9Y9      -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
A0A4Y1WM66      -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
A0A6N4GYT3      -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
A0A174AVF1      -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
A0A656Q4F4      -----------------------MTEYNNQQQHLQNDEN-ENGSG--------LTLHDLL
A0A1Q6EIY0      -----------------------MTE-QNINPHLLNGES-ENTNG--------ITLHDLI
A0A5B5VN71      -----------------------MTE-QNINPHLLNEES-ENTNG--------ITLHDLI
E4M8L3          -----------------------MTE-QNINPHLLNEES-ENTNG--------ITLHDLI
I3YQ50          -----------------------MTE-QNINPHLLNEES-ENTNG--------ITLHDLI
R5UEY8          -----------------------MTE-QNINPHLLNEES-ENTNG--------ITLHDLI
A0A1H4D866      -----------------------MTE-QQINSPQQQGND-EMTGA--------VTLHDII
A0A5B3G4Y7      -----------------------MAE-QQINSQIQTNNE-ELTNT--------ITLHDII
A0A374A9J5      -----------------------MAE-QQINSQIQTNNE-ELTNT--------ITLHDII
A0A5B3GQN5      -----------------------MAE-QQINSQIQTNNE-ELTNT--------ITLHDII
A0A1Q6E9S3      -----------------------MAE-QQINSQIQTNNE-ELTNT--------ITLHDII
D4IJ36          -----------------------MAE-QQINSQIQTNNE-ELTNT--------ITLHDII
A0A414Q925      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A415PUS9      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A108TCU0      ---------------------MGKDRFEDLDFIDFNDNR-RQEGT--------V-IADML
A0A413BA42      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
S3Y344          ---------------------MRKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A7J5LEW3      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A412TGL3      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A413VJ33      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A414L0W6      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------M-IADML
A0A412DP39      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADVL
A0A413ZSE8      ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
B0NP84          ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
R6AK43          ---------------------MGKDRFEDLDFIDFNDSR-RQEGT--------V-IADML
A0A412N2D9      ---------------------MGKDRFEDLDFIDFNDSR-QQEST--------V-IADML
A0A1Y4JYS9      ---------------------MGKDRFEDLDFIDFNDSR-QQEST--------V-IADML
R6LHA4          ---------------------MGKDRFEDLDFIDFNDSR-QQEST--------V-IADML
A0A3E5HPT8      -----------------------------------MALT-EEEKS--------INIVDLF
C6IJ48          -----------------------------------MALT-EEEKS--------INIVDLF
Q8A3U2          -----------------------------------MALT-EEEKS--------INIVDLF
A0A3R6S1H6      -------------------------------MKNEELIE-DGTNA--------LNLIDLW
A0A3R6SD81      -------------------------------MKNEELIE-DGTNA--------LNLIDLW
A0A354WXN6      -MVVCSIRLGGCSLLNCHIIQQITQSTVMEQQENNKNIE-QEEQE--------LNILDLV
A0A7G1HW11      -------------------------MAKEQQEIYGQQVEESTDNG--------LSLRDIL
R5IP14          -------------------------MAKEQQEIYGQQVEESTDNG--------LSLRDIL
A0A316SZX7      ---------------------------MSEQNINQPQQNAPAEEE--------INLRDIL
A0A1Y4AIY1      ---------------------------MKVENPSNGPRWNEANSG--------VTLGDIF
A0A0J6CIR2      -----------------------------------MNLR-REENE--------LNLSDLF
A0A3D8HG59      ---------------------------MEPNQELENLQQ-QEENE--------LNLGDII
A0A3R6S408      ---------------------------MEPNQELENLQQ-QEENE--------LNLGDII
F3ZRU7          ---------------------------MEQQNLDNKIQQEHTEQE--------IDLVEIG
A0A1C5Q1F3      --------------MDLRDFGFNFNCHLNIGCEMTNRKNTQSDHT--------LHVGDWL
R7A239          --------------MDLRDFGFNFNCHLNIGCEMTNRKNTQSDHT--------LHVGDWL
A0A3R6HIK7      ---------------------------MSTEYNPENNIRIEEESV--------LNLWDLF
K5ZVW7          ---------------------------MSTEYNPENNIRTEEEST--------LNLWDLF
A0A1Y4D5Z0      -------------------------MIDNRENTQRDYAQ-ENENT--------LNLWDLL
A0A413VXJ7      ---------------------MSTEQNINKESKT-SKNS-KQEEE--------ISIADIL
I9RSN9          ---------------------MSTEQKINKESKA-SKSS-EKEEE--------INIADIL
U6RJK5          ---------------------MSTEQKINKESKA-SKSS-EKEEE--------INIADIL
A0A1Q6GA32      ---------------------MSTEQKINKESKA-SKSS-EKEEE--------INIADIL
I9RPU6          ---------------------------MNTEYKN-NDVR-KQEPE--------INITDIL
I8YFS5          ---------------------------MSIESQN-SELR-EKESE--------ISIVDIF
A0A7J4XCM0      ---------------------------MSIESQN-SELR-EKESE--------ISIVDIF
I8Y597          ---------------------------MSIESQN-SELR-EKESE--------ISIVDIF
A0A1Q6GBF5      ---------------------------MNTEQKN-NNNP-GQESE--------INITDIF
I8YFZ3          ---------------------------MSAEYKN-NDIR-KQESE--------INITDIF
A0A7J4XFW0      ---------------------------MNTEYKN-NDAR-KQESE--------INISDIF
A0A1Q6GDH2      ---------------------------MNTEYKN-TDVR-KQEPE--------INITDIL
U6RSB0          ---------------------------MNTEYKN-NDVR-KQEPE--------INITDIL
I9GXM2          ---------------------------MNTEYKN-NDVR-KQESE--------INISDIF
I9SIK1          ---------------------------MNTEYKN-NDVR-KQESE--------INISDIF
A0A7J4XIJ5      ---------------------------MNTEYKN-NDVR-KQESE--------INISDIF
I9TP59          ---------------------------MNTEYKN-NDAR-KQESE--------INISDIF
R5S343          --------------------------MKNTEQDL-FEFE-EEKSG--------LTLRDMI
A0A1M6K7I9      ---------------------------MNEEQKVQSNMT-AQEEQ--------INIADLL
A0A5M6A8C8      ---------------------MKSEQQMNEEQKVQTNMA-VQEEQ--------INIVDLL
A0A7J4XCJ1      ---------------------------MNTESQNNNDIR-EQDLE--------INLIDIF
A0A7J4XNQ7      ---------------------------MNTEPQNNNEIR-DQESE--------ISIVDIF
A0A3R5ZMK1      ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
A0A7K1HMX0      ---------------------------MNTEQET-N-TR-VEENE--------LNLEDIL
A0A1Y3ZIA4      ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
K5Y1A4          ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
A0A7K1HDC0      ---------------------------MNTEQET-N-IR-MEENE--------LNLGDIL
A0A3R6K8X4      ---------------------------MNIEQET-N-IR-MEENE--------LNLGDIL
A0A6N8D6C8      ---------------------------MNIEQET-N-IR-MEENE--------LNLGDIL
A0A3R6BKI7      ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
A0A412M2W1      ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
K5ZX55          ---------------------------MNTEQET-N-TR-VEESE--------LNLGDIL
A0A415BDM7      ---------------------------MNTEQET-N-IR-MEENE--------LNLGDIL
A0A1Q6I3T6      ---------------------------MNTEQET-N-IR-MEENE--------LNLGDIL
A0A414XX40      ---------------------------MNTEQET-N-IR-MEENE--------LNLGDIL
A7AEU7          ---------------------------MNTEQET-N-IR-MEENE--------LNLGDIL
A0A5F0U645      ---------------------------MNPEQET-NMLR-EEENE--------LNLIDMY
K5ZBN2          ---------------------------MNPEQET-NMLR-EEENE--------LNLIDMY
A0A0J6CKW3      ---------------------------MNPEQET-NMLR-EEENE--------LNLIDMY
A0A0F5IQM7      ---------------------------MNPEQET-NMLR-EEENE--------LNLIDMY
A0A496CDT3      ---------------------------MNPEQET-NMLR-EEENE--------LNLIDIY
A0A6G1ZKM3      ---------------------------MNPEQET-NMLR-EEENE--------LNLIDMY
S0GLB0          ---------------------------MNPEQET-NMLR-EEENE--------LNLIDMY
A0A3R6NLC1      ---------------------------MNPEQET-NMLR-AEENE--------LNLIDIY
A0A416WYC9      ---------------------------MNPEQET-NMLR-AEENE--------LNLIDIY
A0A0F5IT40      ---------------------------MNSEQET-INLR-REENE--------LNLSDLF
A0A496CX20      ---------------------------MNSEQET-INLR-REENE--------LNLSDLF
A0A5F0UBI0      ---------------------------MNSEQET-INLR-REENE--------LNLSDLF
A0A6G1ZHG0      ---------------------------MNSEQET-INLR-REENE--------LNLSDLF
S0GSI7          ---------------------------MNSEQET-INLR-REENE--------LNLSDLF
K5YB65          ---------------------------MNSEQET-INLR-REENE--------LNLSDLF
A0A0F5IWP9      ---------------------------MNSEQET-TYLR-GEENE--------LNLKDLF
A0A0F5IZT8      ---------------------------MNSEQET-TYLR-GEENE--------LNLKDLF
A0A417LKQ2      ---------------------------MNSEQET-TYLR-EEENE--------LNLRDLF
A0A416TME1      ---------------------------MNSEQET-TYLR-EKENE--------LNLNDLF
A0A416XPE8      ---------------------------MNSEQET-TYLR-EKENE--------LNLNDLF
A0A3B0C2S4      -MPILGCLFKIVSVFLPHIFNLKKRMAESPFSLDYDET---------------EESVNLW
L8JI02          -------------------------------------M---------------NDKINIK
A0A4Q5WS95      --------------------------------MINRPD---------------QKSTPFV
A0A501VZX6      ------------------------------------MP---------------SSENNIF
A0A399SH26      -----------------------------MSSSINNAP---------------NNEENLL
A0A501W1A9      --------------------------------MDKNKS---------------TKEDNLF
A0A0E3ZGV6      --------------------------------MDKNKV---------------NAEDNLV
A0A1I2N4S1      --------------------------------MDKNKT---------------NSEDNLA
A0A2T5YE44      --------------------------------MDKNKT---------------NSEDNLA
A0A1M5BA90      -----------------------------MEPKRHAT----------------EKEKNAV
A0A512B879      -----------------------------MEAKRPIIL---------------KKEKGVV
A0A559PPI3      -------------------------------MSYNNKS---------------AKNENLF
A0A1T5CS78      -------------------------------MKYNSNT---------------GKEDNLF
A0A0Q9Z8F1      -------------------------------MKYNSKT---------------GKEDNLF
A0A2N0U0M7      -------------------------------MKYNSKT---------------GKEDNLF
A0A1V9FHD0      -------------------------------MQTHKKT---------------GNEMNII
A0A4V4H170      -------------------------------MQTNKKT---------------GNEMNIV
A0A1V9F098      -------------------------------MQTNKKT---------------GNEMNII
A0A4R2VU64      -------------------------------MQTNKKT---------------GSEMNII
A0A4S8HY23      -------------------------------MITNKKT---------------GNEMNFV
A0A1V9F383      -----------------------------MQPNIN--T---------------KNEKNIG
G8TRZ6          -----------------------------MQTNINSKS---------------KSEKNIG
A0A4R5DL69      --------MASYLENITSIESGS--------TVNHTLT---------------QTIRRLI
A0A1M4YED3      -----------------------------MSAPKHTQE---------------PQEENIL
A0A2H3NSN0      --------MNTNDQNALDIRRKKVEQIGLSRSDNSDTE---------------SNAVDLN
A0A2P6C324      --------MNDTSQNLTPYRKQA-EKIGLQSSNSGS-D---------------DNTLDLG
A0A7C2DZI7      --------MARYRHHSLIVARGG-QAGGLHPNGAERHD---------------EGRINFA
A0A1M6XHU0      --------MAHYRHHSLIVARGG-QRGGLPPASSETRD---------------EGRINFA
G2SF81          --------MAHYRHHSLIVARGG-QRGGLPPASGETRD---------------EGRINFA
A0A5S9EYW1      --------MAHYRHHSLIVARGG-QRGGLPPASDEKRD---------------EGRINFA
D0MHQ9          --------MAHYRHHSLIVARGG-QRGGLPPASDEKRD---------------EGRINFA
A0A126PFG0      --------MEPFNGQVSTFYTAA-------------TA---------------SQPLNLR
A0A3M1N7Z3      ----------------------M-------------PI---------------QQEWDLR
                                                                            

A0A1T5MMH4      V----I----VRNNLVWIALIFLVIN-LTAYLI-IRY-TQDRYESFSEIKLDVK-DEASE
A0A2W4R1L8      T----I----IRNNRLWILAIFVVIN-LLTYLLFIRY-SPDLYESHSEIKLDIR-NEATE
A0A2E5CV79      G----I----LRFHYKLILTITLFGI-MIFTYR-TYT-IHPVYRSTSSIIIKEK-PGTSM
A0A2D4ZVH1      N----I----LLLHKWALIGITVLFT-VVAIIF-AQL-QTPIFQSTGTLIVSES-K----
A0A0K8QSK7      L----K----LLGKWYWFVLSVVLFL-AAAWLL-TRY-SMPVYQSSSSLLILER-SGGSP
A0A1V6CN82      S----E----LISHWYLFVLFMGIGL-AGAWLY-NRY-TTTMYSARASIMILEE--GSTT
A0A1M4XZ45      F----K----LLHNWYWFVLSIIVAL-SLAFLY-NRY-TTPVYEIKASMLVEEG-KASSP
A0A399D319      F----R----FLRNWYWFAFVVAITL-GMAFLY-NRY-TTPIYEISSSLLVEEE-KAGSP
A0A1V5IPN7      R----I----LLQYRYLIILIFVVVL-AGTIIY-TLR-QPRIYSASGRILMENQ-SSGAD
A0A1M6GR99      K----L----FFKNIWIVISCIIVAL-GIAYFY-NWY-SIPTFKVSATLLLKDN-SGS--
A6EBM4          M----V----LFSRWYIIASTTLICL-IAAYAY-LWY-TPKTYATTAILKFEEQ-K----
A0A7C5M4P4      I----V----LRKSIPWLLLLLLGCL-TAGYLV-YRY-TKPLYESYSEIKLDQE-NQSNI
A0A1M6TTV4      Q----V----FVKNVIWMLLILLLIN-ASTVLY-VRY-TKPIYSSESILKLDIK-SEAGI
A0A4Q8RX32      R----K----LAKYWKVFPISILFFV-SLGVIY-NKL-AEPIYEIGAKVVVHER-QRNIA
K0X1U5          R----A----ACRKWYLFAGSVVVCV-ALVVCY-LKI-AKPVYEVSADILVNED-EKKGG
R5EXK3          R----A----ACRKWYLFVGSIVVCV-ALVVCY-LKI-AKPVYEVSADILVNED-EKKGG
A0A401UAP7      S----I----LLKNTVWILLLFILCN-LSAYLY-IRY-TKNVYEAEAEIKLEVN-NEANE
A0A1W2GF52      Q----V----FASGWPWVLGILITTM-SLSFLY-MRY-TKPIYSAESILKLDIK-ND---
A0A2G5L7B8      Q----V----FIKNLPWIILILILFN-AGTFLY-LRY-TKPIYSSESILKLDIK-SD---
A0A523GAC0      T----V----LGKSWLWIMLIVLSTN-LTAYLV-IRW-TKPLFESYSDIKLNVK-KDANF
L8JW09          T----V----LRKSIPWILLIFIVTN-LSAYLY-IRW-TKPLYESESELKLDVK-SDASE
A0A364XUP5      V----T----IWDNILWILLIFVVTN-TAAYLV-IRY-SKDIYQSVSELKLDIK-NEATE
A0A1M5RLA9      T----T----LKRNWLWLIILFLVIN-SVAYLK-VRY-TKNLYESSSELKLDIK-NEATE
A0A385SFR9      I----I----FKRNWLWLVVLFLVIN-SIAYLK-VRY-TKNVYESSSELKLDIK-KEATE
A0A5M4A9J4      F----L----FLSNWYWFVLAVFFTI-GAAWVY-HRF-TNPLYAVSASLLINED-K-GSN
A0A5M4B1C7      S----I----YRSYWYVFALTAGIAL-ITAWFY-HKL-TNPQYAVSASLLVNES-K-GNN
A0A0D3LFR6      S----V----LKKSLPIIVVIFLVCN-MGAYLY-IRY-TKPLFQSNSELQLTEN-KPAAS
M7N6D4          N----V----MKKSLPIIIVIFLVCN-LSAYLY-LRY-TKPLYRSDSELQLGVN-KQADF
A0A4D7K1D4      S----I----SRKSIPFIILIFALTI-SAAIFY-VRY-IPPLFESSSELKLDVK-DETSV
A0A5C7MX19      ---------------LWIIVLTIITI-IISLVY-LRY-APKIYESNATMLFSTE-KK---
A0A1Q3ZMZ7      ----------------------------MGYIY-LRY-TKSVYESSAIIQIQDN-DQG--
A0A2D8JJW3      Y----F----LKRNYIYILIITLFCF-LVGCFL-TLR-IKPIYSSYAEIEIVKD-DNSGI
A0A2W2AFF7      G----I----VMSHWVWFAVSLFLTL-ILSFVL-LRY-STPAYKINATVLINDD-QKA--
R7PCR1          GICIVI----LQKHWMWFLTSVVLFV-VLAFVY-SRT-QPQVYQRTAVLEIEDN-NDSGS
A0A2N5YXE2      T----I----FKKNFWLILIIFVVSL-AAGYAY-FRY-TRPVYKTTTVLQIKNE-NKT--
A0A1G9E2A9      S----I----VNRSIVWVLLFVALGV-LAAWIS-LRY-IKPVYESASLLKLEVK-RNANV
A0A098LL25      V----I----ANKSLVWVILLVVLSI-TGAFLY-VRY-TKPVYESSSILKLDLK-SEAGV
A0A6J4H627      S----I----VRKNIIWILLIPALCL-FGGYMY-LRY-TSPVYESSSSIKLEIK-QKANL
A0A6C0GJI1      H----I----LKRNIFWLILIPMISL-LGGYLY-LRY-TKPLYESSSSIKLEVK-REASV
A0A2T2YJE8      S----I----IRKSLIWVSLLIVLGL-IGAFLF-LRY-TKPLFKSSSTLKIDEQ-SEAGR
A0A7L7LEW0      S----L----IRKSLIWVGLLIVVGL-IGAFLF-LRY-TKPLFKSSSTLKIDEQ-SEAGR
A0A127B287      H----V----VRRSIPWVILLVLLGL-TGSYLF-LRY-TKKVYESSSVIKLEEQ-TEAKV
A0A6P1P2P6      H----V----VRRSIPWVLLLVLLGL-TGSYLF-LRY-TKKVYESSSVIKLEEQ-TEAKV
A0A3M9N829      D----V----VKRSILWVVLLILLGG-AGAYLY-LRY-TKKVYESSSTIKLDEQ-SEAGV
A0A0P0CSF9      H----V----AKRSIPWIILLVLLGI-GGSYLY-LRY-TKKVYESSSTIKLDEQ-SQAGV
A0A5M8QQB8      H----V----VKRSIPWVLLLILLGA-GGSYLY-LRY-TKKVYESSSTLKLDEQ-SEAGV
A0A3M9MNC3      H----V----VRRSIPWVLLLVLLGV-SASYVY-LRY-TKKVYESSSTIKLDEQ-SEAGV
A0A5B6TAX2      H----V----VRRSIPWVLLLVLLGG-SASYLY-LRY-TKKVYESSSTIKLDEQ-SEAGV
A0A7L5A132      M----V----TRRSLPWMVFLILLGV-TAAWLY-LRY-TPPIYQSSSTLKIDQK-SQSGV
A0A512AYT3      A----V----ARKSLIWVVLLIMLGL-AASYLF-LRY-TKPVYKSSSIIKIDEQ-SQAGA
A0A5M6CYN7      A----V----ARKSLVWVILLILLGL-TASYLF-LRY-TKPIYKSSSIIKIDEQ-SQAGA
A0A369QP10      S----L----VRKSLIWVALLIVLGL-IGSFLF-LRY-TKPLYKSSSTLKIDEQ-SEAGR
A0A7G7G7M4      S----L----VRKSLIWVALLIVMGL-IGAFLF-LRY-TKPLYKSSSTLKIDEE-SEAGR
A0A126PDF2      L----V----ARRSLLWLLLLLALGG-SAAWLY-LRY-TKPVYKSTSLLKIDQR-SEAGV
A0A2Z3GKA1      L----V----ARRSLLWLLLLLALGG-SAAWLY-LRY-TKPVYKSTSLLKIDQR-SEAGV
A0A502GZP7      L----V----ARRSLLWVLLLLVLGG-SASWLY-LRY-TKPVYKSTSLLKIDQR-SEAGV
A0A519SBU8      M----V----ARRSLVWVALLLALGF-TASWLF-LRY-TKPVYKSASLLKLDEH-SEAAK
A0A4Q3JNZ3      M----V----ARRSLVWVALLLALGF-TSSWLF-LRY-TKPVYKAASLLKLDEH-SEADK
A0A519Q9V3      L----V----ARQSLVWVVLLLALGF-TGAWLF-LRY-TKPIYKAASILKLDER-SEAAN
A0A0M3RW20      M----V----VRKSLPWMLLFILLGL-LTSWTY-LRY-TKPVYKSSSILKIDEK-QEAGT
A0A495VFX4      M----V----VRKSLPWMILFILLGL-LTSWTY-LRY-TRPLYKSSSILKIDEK-QEAGT
A0A418R9X5      M----V----ARRSLPWMVLLIMIGL-TASWLF-LRY-TPPVYRASSTLKIDEK-SEAGV
A0A428JSJ3      M----V----ARKSLPWMLLLIALGV-TASWLF-LRY-TPPLYKASSTLKIDEK-SEAGL
A0A428KI59      M----V----ARKSLPWMLLLIALGV-TASWLF-LRY-TPPLYKASSTLKIDEK-SEAGV
W8F1I6          M----V----ARKSLPWMLLLIVLGV-TASWLF-LRY-TPPLYKAASTLKIDEK-SEAGV
A0A246FQC0      M----V----VRKSLPWMVLLIALGL-TASWLF-LRY-TPPLYKSTSALKIDEK-SEAGV
A0A372E5P8      T----V----ARRSLPWIILLVALGL-TAAWLF-LRY-TPPLYKSSSTLKIDEK-TEAGV
A0A1H3EMW1      A----V----ARKSLPWMVLLIGLGL-TAAWLF-LRY-TPPLYKSTSTLKIDEK-TEAGV
A0A1H9ZSN3      T----V----ARRSLPWMVLLVVLGL-TASWLF-LRY-TPPLYKSTSTLKIDEK-TEAGV
A0A1S9B3W0      S----V----TRRSLPWMILLILLGL-GASWTY-LRY-TKPIYQSSSTIKIDEK-TEAGQ
A0A1W1VRL3      Q----V----ARKSLPWIALLIALGL-TSSWLF-LRY-TKPVYQSSSVLKIDEK-TEAGL
A0A7G6YQJ9      M----V----ARKSLPWVILLIGLGL-TASWLF-LRY-TPSIYRSSSVLKIDEK-TEAGV
A0A1M6R305      M----V----VRRSLIWLLLLIGLGI-TGSWLF-LRY-TKPVYKSSSLLKIDEK-TEAGA
A0A7G7W8X3      L----V----ARRSLLWLLLLIGLGL-TGSWLF-LRY-TKPIYKSSSLLKIDEK-TEAGA
A0A4Z0PHK3      L----V----ARRSLLWIVLLIALGL-SASWLL-LRY-TKPVYKSSSLLKIDEK-TEAGA
A0A2M9B9H9      L----V----ARRSILWIILLIALGL-SASWLL-LRY-TKPVYKSSSLLKIDEK-TEAGI
A0A4Z0QCY9      L----V----ARRSLLWIVLLIALGL-SASWLL-LRY-TKPVYKSSSLLKIDEK-TEAGV
A0A5N1J2M4      Q----V----TRKSLVWVLLLIMLGL-FGAYMV-IRY-TPKLYDSTSLIKIDEK-KEAGL
A0A519S476      M----V----ARRSLIWVVLLLALGF-TSSWLF-LRY-TKPVYQSASLLKLDEK-SEAAN
A0A4Q3JRW8      M----V----ARRSLVWMLLLLALGF-TASWLI-LRY-TKPIYKAASVIKLDER-SEAAN
A0A519M923      L----V----ARRSLVWVVLLLALGF-TASWLF-LRY-TKPVYRAASLLKLDER-SEAAN
A0A4Z0ENW1      L----V----ARRSLLWVIVLLALGI-TASWLY-LRY-TKPIYEATSILKIDDR-SDASA
A0A519UDB4      L----A----VRRSLPWAALLILLGL-TSSWLY-LRY-TKPIYRASSILKIDER-SNAND
A0A3S0QKV1      S----V----TRRSLPWMLLLLLLGL-AASWTY-LRY-TKPVYQSSSTIKIDEK-RQDAE
A0A328BL48      S----V----ARRSLPWMILLVLIGL-AASWSY-LRY-TKPLYRSSSTIKIDEK-QQAGD
A0A5R8WLY4      S----V----ARRSLPWMILLVLIGL-AASWSY-LRY-TKPLYRSSSTIKIDEK-QQAGD
A0A1I5WSL8      L----V----ARRSLLWLILLIALGL-TASWLY-LRY-TKPVYKSQSLLKIDER-NEGSA
A0A0U3JVM7      L----V----ARRSLLWMLLLVGLGV-TASWLY-LRY-TKPVYKSASLLKIDER-NEGSA
A0A1G1SSV2      L----V----ARRSLLWMLLLIMLGT-TASWLY-LRY-TKPVYKSASLLKIDER-NEGSA
A0A1G1SXV7      L----V----ARRSLLWMLLLITLGL-TASWLY-LRY-TKPVYKSASLLKIDER-NEGSA
A0A6G8CBJ6      Q----V----ARKSLPWIALLIALGL-TGAWLF-LRY-TKPVYQSSSVIKIDER-TEAGL
A0A0W8EDI5      M----V----TRRSLPWMVLLIALGL-TAAWLY-LRY-TQPVYQSASTLKIDQK-TQSAV
A0A3B7RBP8      M----V----VRRSLPWMILLVLLGV-TAAWLY-LRY-TQPIYQSSSTLKIDQK-TQTAV
A0A3R9P8H7      T----V----ARKSLPWMLLLIALGL-TAAWLF-LRY-TPPLYQSSSTLKIDEK-TEAGV
A0A238WIA7      M----V----ARKSLPWVLLLVMLGL-LTSWLF-LRY-TRPVYQSSSVLKIDEK-TEAGV
A0A212UCJ7      M----V----ARKSLPWVLLLISLGL-LASWLF-LRY-TSPVYQSSSTLKIDEK-TEAGV
A0A4Z0MQE1      M----V----ARKSLPWVLLLVILGL-LSSWLF-LRY-TSPVYQSTSLLKIDEK-TEAGV
A0A4Z0PCF4      M----V----ARKSLPWVLLLVILGL-LSSWLF-LRY-TSPVYQSSSVLKIDEK-TEAGV
A0A6M6BED0      M----V----ARKSLPWVLLLVALGL-LCSWLF-LRY-TSPVYQSSSTLKIDEK-TEAGV
A0A5D6VDG1      M----V----ARRSLPWMMLLILLGL-AAAWTF-LRY-TKPLYKSSSTLKIDEK-EDAGA
A0A243WHR7      L----V----ARRSLIWVVLLIVLGL-TGSWLY-LRY-TKPVYQSLSILKIDEK-TEAGA
A0A5B8A0P6      T----V----ARKSLPWIVLLIALGL-TGSWLF-LRY-TKPVYKSSSLLKIDER-TEAGA
A0A076HRT9      M----V----VRRSLLWLLLLIGLGL-TGSWLF-LRY-TKPVYKSSSLLKIDEK-TEAGT
A0A4Z0PVM7      L----V----ARRSLLWIILLIALGL-SASWLM-LRY-TKPVFKSSSLLKIDEK-TEAGA
A0A1M6DHW8      L----V----ARRSLIWIVLLIALGL-TASWLF-LRY-TKPIYKSTSLLKIDEK-TEAGA
A0A4Q5LC61      L----V----ARRSLIWIVLLIALGL-TASWLF-LRY-TKPVYKSTSLLKIDEK-TEAGA
K0XJ09          E----L----VFDNWYWIVLSVVICM-SVAWFY-LAM-QTPLYKRSAVMLVKSE-NKSGN
R5EUZ0          E----L----VFDNWYWIVLSVVICM-SVAWFY-LAM-QTPLYKRSAVMLVKSE-NKSGN
W0EQS0          E----L----IFDNWYWIVLSIAVCV-SVAWLY-LAM-QTPLYKRTAVMLVKSE-NKSSN
A0A1Y3WE15      E----L----IFDNWYWIVLSVAVCV-LVAWLY-LAK-QTPLYKRSAVMLVKAE-NKSNN
A0A1Y4GUK3      E----L----IFDNWYWIVLSVAVCV-SVAWFY-LAM-QTPLYKRSAVMLVKAE-NKSNN
A0A2U1FKU2      F----S----LLSSWKWIVGSVVACA-LIAYIY-VQN-QSPVYHAQATVLIKSA-EKNGV
A0A0A2F954      L----G----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
A0A0A2FW91      L----G----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
A0A2D2N2N1      L----S----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
Q7MWZ2          L----S----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
T2NDT6          L----S----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
W1R7P9          L----S----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
A0A1R4AFZ0      L----S----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
A0A1R4DVZ7      L----S----LLTSWKWIVASVLACL-LIAYIY-IQR-QSPIYHAQATVLIKSA-EKSGA
A0A7C0WKI7      R----V----LYGGKWIIIFSFIIVV-AATAYF-TFT-TPPVYEAESSVIISQK-G-GIE
A0A2A8CVM9      D----M----LRRGKWIIAATTIVVV-ALVGAY-TYT-VDPVYEAKSIVKIDLG-A----
A0A5M4B212      F----L----LLSHWYWFAIAIVLTS-IGTWLY-YRY-AHPTYAVSATMLIHEQ-QNQSP
A0A3D1KEX9      RICVAV----FLRNWKWFLLSVVACL-LFALLF-VKK-QPRVYSRQSTLLIENN-D-NNG
A0A358Y7S2      E----I----LKRHWRAPIFYSTIFL-IFAYLY-IRY-SVPIYQTKALVQVVEE-NKT--
A0A1X7J248      T----I----LKKNLPWAILLIIIAV-FVAFLY-VRY-TNVKFQSYAELKLNKR-S-E--
E4TQD2          T----I----LKKNLPWAILLIAIAV-FVAFIY-VRY-TNVKFQSYAELKLNKR-S-E--
A0A2J6HHN3      Y----I----AKRNLKRIILFFIVLF-LFLFLY-LRY-TQPIYESSTIVQLNSD-DKG--
A0A1Y3WMT8      R----A----ARKRWYLFAGSVFICV-VLVACY-LKI-AKPQYAISADILVNED-D-KQG
A0A1Y4GQU1      R----A----ICRKWYLFVGSVVVCV-ALVACY-LKI-AKPQYEVLADILVNED-E-KKG
A0A6A0R272      N----Q----VKLKLPWLLLFLFIGL-SSGYLV-SKY-KKQVFSAKATIKIDDK-S-SNV
A0A1V5W8T5      H----I----LRQNFIFYIIFGLIAG-ISAFTY-LRY-TPPIFDAYTVIQINEE-Q-N--
A0A2T8HKA9      K----Y----LFVHWKWFLLSVLFFG-GYYYYQ-YSK-TPFVYSKAAILMIKTP-Q-N-T
A0A2I0QZ80      I----V----IKRNWYWCVLIFSLFI-VLGFLY-LRY-TKPVYESRMLIQINSE-NQG--
A0A3E1F1A3      I----V----IKRNWYWCVLISLILG-ILAFSY-VRY-TKPIYESKMLIQINSE-NQG--
A0A2U2XBJ3      I----V----IKRNWYWCALISILLV-VSAFIY-VRY-TKPVYESSMLIQLNSE-NQG--
A0A4Q4KU94      I----V----IKRNWYWCAIISILFF-VFAFIY-VRY-TKPVYESKMLIQLNSE-NQG--
A0A3B8INU3      S----V----LRRSIVWVVLIIVGAV-ASAYLV-VRY-TKPLYESVSDIKLNFK-S-E--
A0A2W1NDY9      T----V----FKKNWIWLLLCVIIGV-SIAFVY-LRY-TKPIYESRAIIQRSLK-DEG--
A0A5C8AQR5      S----V----LRRNWYWPLAFIFLFF-CFAFLY-LRY-TKAIYSSNTLIQIENK-DQA--
A0A1G0CI31      T----I----VKRYWWWTLLFVTCFT-AIAFVY-LRY-TKPIYDSSMVIQLGEK-DQG--
A0A556N0M0      V----V----LRRYWWWVLLLILFFL-GVAFFY-LRY-TKPVYDSTMVIQLVEK-DQA--
F2IKD6          V----I----LRRYWWWVLLLIIFFM-SVAFFY-LRY-TKPVYDSTTLIQLVEK-DQG--
A0A1I7BM74      N----V----LKKNFLFALLIIAFFG-ALSFLY-LRY-TKPVYQSQMVIQIDNE-DQG--
A0A2G2FJ17      I----V----IRKNWIWLMLIATILL-SSAFLY-LRY-TKPVYESKMLIQISNE-DQG--
A0A2E3R1D0      D----I----LLRGKWIILGAVLALT-IPVMVY-SML-SPSKYRSYAILLVDKT-D-TDL
A0A2T2USC0      G----M----LWGGKWVILATFVVVV-ALGAAY-TFT-QTPIYESSNLVLVEKQ-Q-RQV
A0A2T2V0F3      G----M----LWGGKWVILATFAVVL-ALGAAY-TFS-QTPIYETSSLVLVEKQ-G-EGV
A0A2T2S682      S----T----LWGGKWILLTVFVLVV-GTVAVY-TYT-RTPQYKTSTLLLVDLG-Q-SR-
D5H561          D----L----LRRRKWLIVLVCLATV-AGAALY-TYT-QVPVYRTSSLVLVEKG-Q-QS-
A0A2H3NWA9      G----L----LWAHKWIILGVFVVVM-AAAGVY-TYT-LPNQYQTSSLLLIKPD-S-PS-
A0A2A8CVB6      G----T----LWRGKWIILGVLIVVL-AAGTAY-TLS-IPTTYRTSSLLLVDKQ-S-QSG
A0A2P6C1S6      Q----T----LWEGKWIILGVVTAVV-LAAAAY-MYT-IPTTYRTSSLLLVDRN-Q-QS-
A0A2T2UTM4      Q----M----LWDRKWIILGIVAVAV-LSAAVY-TYT-IPATYRTSSLLLVDRE-G-QT-
A0A414ZBF2      G----V----LAHHRKWFILSVAVCL-LVGFIY-VRS-TPKTFSRTATILVKDE-Q-GGG
A0A1Q3Q573      Y----I----LNKSILWIILIVAITV-FASFIY-LRY-TPRIYEATTKMILQLE-K-S--
A0A662BAY3      K----R----LLSYWYWFLICIILAV-SIAYVY-NRY-ATPIYEITSSLLLEVG-NSNSP
A0A4U3L369      G----N----IIANWYYFVLGLVLML-VLAFLY-VRY-TEPVYQVNAGIMVEDQ-SGGSS
A0A357YNR3      M----K----YLIHWKWFLVSIFICI-FLAVVY-VYF-TLPKYMIQTSILFNDD-Q-K--
A0A5E8AX52      Q----V----VRSSILYVVAIFAVAG-TASYAF-LRY-TKPVYESESQLKLNIQ-N-E--
F4KK08          M----I----LKANWLFILLSFLVCL-ALGFLY-IKS-SSHQYSRSASLLIKSE-T-SIN
A0A6B5PK86      T----V----LRRFWWLVPIFMAFFF-FVAIIY-LRY-TKPVYESQLILQIENE-D-N-A
A0A2G2F510      T----I----LKRYWWWPLTFILLFS-ALAFTY-LRY-TKPVYESAMILQLSEK-D-T-A
A0A316JZ08      T----I----VRRYWLWVLGFVGIFV-VLAYFY-LRY-TKPVYESSLMLQISNQ-D-K-A
A0A496LCF9      M----R----FIKYWYLFVISVLIFM-AVAYYQ-NRS-FVPTYNSTLRMLLKQE-S-GSL
A0A5P2G2A9      A----D----IIDHWKWFVIGVVLMI-ILGLLY-IQH-SAPRYNVNATVMVDDD-Q-KGG
A0A3C0ZQC7      Q----I----VLRGKWMILASFLLVL-AGTAVF-TFT-TSPVYESTATVLVDTK-G-QQS
A0A3N2N6F7      S----L----CVRCWKWFAFSVAACL-IIGALY-VLT-SPKIYTRTAQVVVQDD-E-AGS
A0A419VXB7      F----K----LLYHWKWFVLTVVVGV-GIAFVF-NRY-TPATYRVKSLLFIKDK-E-SSG
A0A0B0BTJ4      D----F----IVFNWYWFALSAIAFA-GIGIVY-ALS-RPDVYRSSAMVLIDEQ-Y-NRS
A0A3B9CNN6      D----F----IVFNWYWFALSAIAFA-GIGIVY-ALS-RPDVYRSSAMVLIDEQ-Y-NRS
R5X290          D----F----IVFNWYWFALSAIAFA-GIGIVY-ALS-RPDVYRSSAMVLIDEQ-Y-NRS
A0A1Q6E6I7      D----F----IVFNWYWFALSAIAFA-GIGIVY-ALS-RPDVYRSSAMVLIDEQ-Y-NRS
C3J7R8          -----I----LRSNWYWFAITLCVAI-GGASAY-LLH-TPNVYKREASILVKDK-M-DAS
A0A1G8BVM8      G----I----LWRNRFWFALSIIIAV-SIAVFY-VRS-TPKTYSRTATILIKDD-K-KGG
A0A1I1FXP9      S----I----LNKSLWWIIMFVVVAT-LGAYTY-VRY-TRPTYEAYSVLKLDIK-Q-QAS
A0A4P7VVU7      I----L----CLNKWKWFVISIIIFL-GLGVLY-IMS-TPETYTRTASVMINED-T-ESG
A0A2V1ILM4      I----L----CLNKWKWFVISIIIFL-GLGVLY-IMS-TPETYTRTASVMINED-T-ESG
A0A3N2L0E8      I----L----CLNKWKWFVISIIIFL-GLGVLY-IMS-TPETYTRTASVMINED-T-ESG
A0A3N2LFC5      I----L----CLNKWKWFVISIIIFL-GLGVLY-IMS-TPETYTRTASVMINED-T-ESG
A0A7K3KWJ8      I----L----CLNKWKWFVISIIIFL-GLGVLY-IMS-TPETYTRTASVMINED-T-ESG
A0A3N4H5N3      K----S----LVKHWYLFIICVIIFL-GLAFLY-LRI-ATPVYEISGSVIIKEG-D-R-P
A0A2P8EAX2      R----L----LLPYWPYIIASILLFV-GLSFLY-LKS-ATPFYEITSSVLIREG-E-R-A
A0A4V2F6N9      K----V----VLPFWPYILASILLFV-GLSFLY-LKS-ATPYYEITSSVLIREG-E-R-A
A0A3B9FXJ0      L----F----TWKNRYIILLIMMLSL-LAGYMV-NKY-SVPRYSAKSVVQFKEF-D-P--
R5GSU5          RACTGT----LRRQWRWFVFSIIVCG-CLAFLY-ERK-QPRVYQRQAVIEIEGA-D-GSS
A0A2A3UE91      F----L----FMKSRIYIVLFFVISF-SLAFLY-LRY-SQPIYESRAIIQINDA-N-Q-A
A0A0A2G557      Y----L----LRQNWYYFIACLLIAL-ICGYVY-IKS-TPNSYERTASVLVNTK-S-DIS
A0A2N2WFW8      F----I----ARRNLKFILVFFALLF-ALIFMY-LRY-TLPVYEASSVVQINSD-D-K-A
A0A1F3IU95      N----I----TRKSLIYIIVFSALLF-TAVYVY-LRY-TQPVYESACIVQINTD-D-K-A
A0A3D0VUF6      N----I----TRKSLIYIIVFSALLF-TAVYVY-LRY-TQPVYESACIVQINTD-D-K-A
A0A1T4PT95      Y----L----LQQNWYYFIFWLIIAL-AGGYIY-IKS-TPNSYEKTASVLINTE-S-NMS
A0A6I6JYY3      F----K----LLSNWYWFILCIVVAV-GAAFLY-NRY-ATPVYELSTTVLVEED-K-VTS
A0A2A4PYG9      G----I----LKKQFKWIVLFFLLAG-IGAFLY-LRY-TPLLFEASALLQMTSQ-N-T-A
A0A1F3K695      F----V----FRKSILLIGIFLFLIV-AVMYAY-LRY-TPPLYRASSVIQINDQ-N-Q-A
A0A353KZR1      F----V----FRKSILLIGIFLFLIV-AVMYAY-LRY-TPPLYRASSVIQINDQ-N-Q-A
A0A2N2WYB5      Q----I----LKKSLWVSIVLILLSF-FAAFLY-LRY-TQPLYSTQTIIQINEN-D-R-T
A0A1F3K4G0      Q----I----VRKNYWAPILFVAVSF-VASFLY-LRY-TQPVYQTQSIIQINET-N-N-T
A0A356H8Y3      Q----I----VRKNYWAPILFVAVSF-VASFLY-LRY-TQPVYQTQSIIQINET-N-N-T
A0A351HSA6      Q----I----VRKNYWAPILFVAVSF-VASFLY-LRY-TQPVYQTQSIIQINET-N-N-T
A0A1F3Q014      F----I----ARKSFFWIILFFILAF-LGASAY-LRY-TTPIFESSSVLQIETT-N-Q-A
A0A2D5KD44      Y----I----IKKNLLWVMLTIGMSI-LGSFLY-IRY-TAPVYRASADIQIEKS-N-Q-A
A0A6N9NIX1      F----I----LRKNLVWIAVILLISF-IAIFLT-LRY-SVPTYRVSSVIQIEKN-D-R-A
A0A2A4YXP3      H----L----LKRNLLLFAVIIICCL-LVSLVY-LRY-TAPVYEAKLVYQVNSL-N-T-A
A0A1F3R158      Q----I----FKKNLLLFIAIIITTS-IVAFIY-LRY-TVPLYQSQLVLQVGSK-N-T-A
A0A2M8ADX2      Q----I----FKRNLFLFAAIILACA-VISFIY-LRY-TIPLYQSQLVLQVGSK-N-T-A
A0A1J5B2H0      F----L----VKRNLLLFAILFIMAI-AGSYIY-LRY-TPPIYETHSIIQLSSD-N-E-A
A0A1V5N756      S----I----VKKNIPYVLIIFAFFF-TLAFLY-LRY-TYPKYETSGTIQIYTE-E-E-V
A0A651GU15      Y----I----ARKSLKWIALLAVFTF-TFAYLY-LRY-NAPVYQASTIIQLSKS-D-N-A
A0A3Q9FR88      F----V----IKKKFIWVILILMMAG-ICAFLY-IRW-TPRIYEASTLNQIKLT-S-SSQ
A0A553GEX3      F----V----IKKKFIWVILILMMAG-MCAFLY-IRW-TPRIYEASTLNQIKLT-S-SSQ
A0A150ADJ9      Y----V----VKKNIVWVLLLISLTT-ICAYLY-IRW-SPRIYEATTLNQIKLT-S-SSQ
A0A1B1FWQ4      F----V----VKKNIIWVILLLILSG-VAAYLY-IRW-TPEIYQANTLNQVKLT-S-SSQ
A0A1S1Z228      Y----V----VKKNIIWVILLLMLSG-IAAYLY-IRW-TPEIYQAHTLNQVKLT-S-SSQ
A1ZKR2          E----I----FRKSIIWMLLLPLFTI-SIGHLW-LRY-TKPVYKSSSTLKLAIK-D-E-G
A0A1Q3GX01      E----I----LKKSILWMLLLPLLTL-SVAHIW-LRY-TKPIYESSSNLKLAIK-D-E-G
A0A349DQI4      E----I----LKKSILWMLILPLLTL-SVAHIW-LRY-TKPVYESSSSLKLAIK-D-E-G
A0A4P5TMD1      I----I----TRKSLIWCILIVLLTV-STSILY-LRY-TTPLYEVTAQIMIKQV-N-TSS
A0A2N3IIZ0      Y----I----LRKNWYWLIVFPLLSV-SLAYLY-LRY-TKPIFQSTANLKMEFK-D-E--
A0A7K3WUF2      H----I----LRKNFYLVAIIICVAL-VGSYIY-LRY-TAPVYEARTIIQLSNK-D-N-A
A0A1F3SJM1      T----I----LRRYWWWPLTFVFIFG-LLAFSY-LRY-TKPIYESSMILQLSDK-D-E-A
A0A2G2EB96      T----V----LKRYWWWAALLVMAFA-SFAYIY-LRY-TKPTFESSMVLQLGDQ-D-S-A
A0A2G6PRA9      T----V----LRRYWWWAALLVLTFA-ACAWVY-LRY-TKPTYESSMVLQLGDK-D-N-A
A0A497D5Z2      I----S----VLRNWYWFILAVVVAL-AIAFLY-NRY-TTPLYKICSSILIEEK-N-TGS
A0A662B170      I----S----VLRNWYWFILAVVVAL-AIAFVY-NRY-TTPLYKICSSILIEEK-N-TGS
A0A2A5FYT6      Y----I----TQRNIFWIIAILIVAG-TAAYFY-IRY-TPPIYESIGIIQVRTD-N-T-A
A0A2E6SYP1      L----I----IRRNLFLTILLILMGA-GFAFFV-NRY-TTPTYYASSVVKISEK-N-D-V
A0A2E5RLE8      L----I----IRKNLISILFSISIGF-CVAFFI-NRY-TTPQYSASSIVKISEK-N-D-V
A0A2E7TQF6      L----I----IRKNLISILFSISIGF-CVAFFI-NRY-TTPQYSASSIVKISEK-N-D-V
A0A2E6GVY9      L----I----IRKNLLFIVLSIFLGF-CIAFFI-NRY-TTPQYYSSSIVKISEK-N-D-V
A0A350JJ90      M----I----TSKSLIWIVSIILLLG-GLAFTY-VYY-TQPKYESTSIIQIINE-N-Q-A
A0A3M1CDV2      D----I----TLKSKWWYVLFFSIAG-ISVFLY-LRY-SERIYSSQSIIQIVNS-D---A
A0A6C1QGZ7      Y----I----AKKNILFPIIFILIAV-AGAWIY-LRY-TPPVFQTSAIIQMEGQ-F-Q-A
A0A4P5U6G4      I----I----IKKSFIWCVLIVLITM-SSSLLY-LRY-TPPLYEVGSTLMIKPE-N---T
A0A2E2TFD1      H----L----IQKSFIWILLFVSLAF-GGAYLY-LRY-YQPMYQSTSILQLKES-N-Q-A
A0A2E4ELE6      H----L----AQKSLLFVLAFFVIAF-ISSSLY-LRY-TQPIYSSSSILQLKEQ-N-R-A
A0A522EYA6      F----L----IKKSFLWIILFFSVSF-AAAFIF-LRY-TPEVFESRTILQVNND-N-Q-A
A0A2E3XZI5      Y----L----INKIKWVLITILIIFL-LGSRIY-LRY-KPEIYKTETRLQLAVK-D-E-P
A0A6I7QXV0      S----I----IRKTFGWFLLILFITV-LSVWLF-LRY-TQPIYETSSEIIQKTE-K---T
A0A2M7NLQ9      R----V----VKKKLIYVIFLLIICV-VASWIV-LRY-TKRVYSSSSTLKLEMK-G---T
I4AFR0          R----V----VKKNIIYVILLLIICV-AASWVV-LRY-THRIYNSSSTLKLEMK-G---T
A0A2N2Y3E5      L----V----FRKSLLYFTIIAVLCG-AGAYAY-LRY-TQPLFQASAIIQLKDE-A-DKT
A0A2D9D7T6      E----I----LRKHWFAPILFIVFFS-TVAFFY-LRY-TKPIFQSKAVIQIVEE-D-R-V
A0A1F3PPL5      Y----I----IKKSMFLVAIIMGISI-VGAFLY-LRY-TPPLYQSITVLQISNN-N-N-A
A0A357QK06      Y----I----IKKSMFLVAIIMGISI-VGAFLY-LRY-TPPLYQSITVLQISNN-N-N-A
A0A662AEA4      L----I----LKKNVWLTFLFIILSL-FGTFIF-LRY-TPPVYKSVSIIQINNE-G-SKA
A0A0S2HYK8      R----I----LYRSVWIGLFIILLAL-GAGFLK-IRY-TAPLYEAKSVIQIQED-K-K-T
A0A2N5ZWN6      R----I----FIRSFWMGIIIMMLVI-GGAFLK-IRY-TSPVFEAKSVLQIQED-N-K-N
A0A2E0FJ09      Y----L----TRQIWVWMLLIVIVCF-GLGFLY-IRY-TPPQYKAKALIQRTSQ-D-N-A
A0A1F3FZ62      K----I----IQKTILPIFILFIISS-TIAFLY-LRY-THPVFEASSVIQLSSS-N-S-A
A0A1F3K211      K----I----IQKTILPIFILFIISS-TIAFLY-LRY-THPVFEASSVIQLSSS-N-S-A
A0A1V6I2U9      I----I----FKKNVWVVILLILISL-GAGFAY-HRY-STPRYKTSTIIQVKNE-N-K-T
A0A2H0B957      Q----V----FKKSIILSVLVFILAA-VGAFVY-LRY-TQLIYKSVSIIQLKNE-N-TNA
A0A1F3CFW6      Q----V----FKRSIILSIIIFFAAI-VGVYVY-LRY-TLPIYKSSSIIQLKNE-G-TTA
A0A2M7E2T8      Q----V----FKRSIILSIIIFFAAI-VGVYVY-LRY-TLPIYKSSSIIQLKNE-G-TTA
A0A2M7NC69      Q----V----FKRSIILSIIIFFAAI-VGVYVY-LRY-TLPIYKSSSIIQLKNE-G-TTA
A0A1F3KLL5      M----I----IRKSIWWIVIIFILAL-FSAFAF-LRY-TPPIYQSNSILQINEQ-N-Q-T
A0A359D1M1      M----I----IRKSIWWIVIIFILAL-FSAFAF-LRY-TPPIYQSNSILQINEQ-N-Q-T
A0A0F2NS19      K----V----FKKTFIYFVGIIAICV-TLSLIY-LRY-TVPIYQSKLVLQVGSE-N-T-A
A0A2A5H8X6      K----V----FKKTFIYFVGIIAICV-TLSLIY-LRY-TVPIYQSKLVLQVGSE-N-T-A
A0A2H0GAU8      K----I----FKRNLFLFIAIITICV-VVSFVY-LRY-TIPIYQSQLVLQVGSE-N-T-A
A0A2M8FTK1      K----I----FKRNLFLFIAIITICV-VVSFVY-LRY-TIPIYQSQLVLQVGSE-N-T-A
A0A2A5B3B0      H----L----LKQNLLSFAIIIAVCL-MGAFIY-LRY-TTPIYESVLVYQVSSL-N-T-A
A0A5C6RXM7      H----L----LRSHLKWFFVIILFCL-LSSYLY-LRY-TIPVYQSNLIFQVGSL-N-T-A
A0A1F3C1M2      Y----I----VKKSLILIGLLIGIAA-VSVFAY-LRY-TLPTYKSSSIIQINTK-N-Q-T
A0A1F3DS87      Y----I----IKKSAILIGLLIGIAI-FSVFAY-LRY-TLPTYKSSSIIQINTK-N-Q-T
A0A6A0R6K9      Y----I----TKKNSLWILLTIILMV-LAAFLY-LRY-TAPIFSSQSIIQIKKS-N-Q-A
A0A2E7CT70      Y----L----LKKSRFTIILILLSAF-SLGFLY-LRY-TPKTYQTSATLQINIK-D-K-A
A0A2D5V560      Y----L----LNKIKWYAITLIILCI-TSAFIY-IRY-TPKTYQTSSIIQVAVK-E-Q-P
A0A2D7K5A8      Y----L----LNKIKWYSIIIIIISI-SLAFLY-LRY-TPKTYQTGALIQVAVK-E-Q-P
A0A2E1XQ82      Y----L----LNKIKWYAIIILIISI-SLAFLY-LRY-TPKTYETGALIQVAVK-E-Q-P
A0A5C8A5B4      G----K----IRSRWWWFLITVPLAL-AVAIAY-VKT-TPKKFDVGAVMLLGNK-KRTGF
A0A7C1LGX3      K----K----YIKYWPWFAASFLLTL-AFAVFY-LLS-TAKIYESVAKIKIVDN-STDIG
A0A4Y9ITE2      R----F----YSTKWKAILISVIIFM-ILGGIY-AYT-KSPVYEVQANVLITDN-DTKSD
A0A5M8NYX7      F----H----YLNYWKWFVASLFVCL-LISFIY-LRY-TTREYSVSSRALIKDE-QKGRT
A0A0E3V905      -----K----YSKLWPWFILSTVLML-AIGHIY-ISN-KQPIYKIQASLLVQDQ---QKG
A0A553ETH6      A----V----LKKNWIWIVIIFVISI-TSAYLV-IRW-TKPLYESTSELKLDVE------
A0A640Q161      L----G----IIKRYAFRIVSLAIAFTILVALL-VMR-MTPMFTSTTTILVEAD------
A0A640QU49      L----G----IIKRYAFRIVSLAIAFTILVTLL-VMR-MTPLYTSTATILVEAE------
A0A1Q3PII2      K----T----VRYHWYWFAISPLLSL-LLAWAF-LRY-QTPHYTIKASLLVRDD-SRGSD
A0A351BXT2      N----I----LRMNLIPMTIITLLCI-LLTIVY-VMY-AKDIYKSSATIKINRP---QGS
A0A2K8Z965      -----R----YIKRWPWFVVSIGLML-AGAYIY-LLD-KQPVYKIQASLLVQDQ---QKG
A0A418M8U8      -----K----FTRNWPWILFSVCVFL-VAAYTY-LAY-KQPVYKIQASLLIQDE---KKG
I2GTA4          -----K----FTRNWPWILFSVCVFL-VAAYTY-LAY-KQPIYKTQASLLIQDE---KKG
A0A2K8ZAJ2      I----R----YVRNWPWFMLSILLAQ-AAAYIY-LLY-QPLVYNVQASVLIKDE---RKG
A0A368JPA3      -----D----YLKHWKWFLISLITLI-VAGFVY-IWF-TEPIYRVQASLLVKDE-PPKSG
A0A5N1JI29      -----D----YLKHWKWFLISLIALI-VAGFVY-IWF-TEPIYRVQASLLVKDE-PPKSG
A0A7K0EGC9      -----D----YLKHWKWFLTSLITMI-VAGFVY-IWF-TEPIYRIQASLLVKDE---QKG
A0A3P1BT12      -----D----YLKHWKWFLISLITMI-VAGFVY-IWF-TEPIYRIQASLLVKDD---QKS
A0A3P1CI15      -----D----YLKHWKWILISLIAML-VAGFVY-IWF-TEPIYRIQASLLVKEG---KDN
A0A4R8CUK1      Q----D----YLKQWEWFLLSLITML-VAGFVY-IGF-TEPVYRIQASVLVQEE-PRIGA
A0A3D0MYJ7      F----S----ILKYKYIILITTIVGF-LVAFFF-ARS-LPNIYQSKVQINVEK-------
A0A662AH13      N----L----IKLNLIPILLITITGL-IVSIIF-ALM-AKDIYTATVAMKIQK--PSSGG
A0A5C7QA01      F----S----LIAQWKLIALCVFLSL-VCALLY-LRV-TPNTYSVDALIQVEDS-KGASS
A0A3D3LS70      N----L----VKSNWILILIVFIISA-VFTGLY-VFR-AKDIYKSSTSLLIQK---PQGS
A0A1G1TM36      ------------------MVGVALAL-LAAYAY-NQL-AQPTYEVQASILVEEG-NKQPG
A0A1G7ZF38      K----A----VRYRWYWFLISPLLSV-LLGFTF-LRY-KTPHYTITASLLVRDD-SRGSD
C6VS52          K----A----IQFRWYWLVVSPIVSL-LLGTAF-LRY-KTPRYQVTASLMVRDD-SRGSD
A0A2A4G4B1      G----F----VLSQWKKMVLGGLIGA-LLAFGY-LKT-VNPKFRVETSVLLKSV-TNSIP
A0A0P7X1V8      G----L-----LWHNKWIIITLTLLG-GVSAYI-YAQSQIPIFESNGSLQITEA-GNRYS
A0A6P1P355      H----K----YVPYWPLFLLLFIFAM-AGAWAY-LQYLAVPTYKTSATIIIKDE-KKGVD
A0A5C8KAD6      Y----K----FTPYWPLFLTLLVISC-MAGWAY-LNYYATPVYEASASLLIKDE-KKGVN
A0A5N1J695      F----R----FLPYWPLFAGLLVVSL-FGAWGY-LRYLSVPTYEVSASLLIKDE-KKGIN
A0A3N2M1H3      Q----A----CKSRWQWILLSLIICV-GAGVLY-ILC-QQPEYQRTEEVLIKDQ-EGGSG
A0A4S2G8T2      Q----A----CKSRWQWILLSLIICV-GAGVLY-ILC-QQPEYQRTEEVLIKDQ-EGGSG
A0A212K7W5      K----M----SVEKWHWFAISLTICL-IFAFLY-IAI-TSPVYTRMAAVLIKDN-SAKGG
F5IU11          K----M----SVEKWHWFVISLGICL-ISASLY-IAI-TPPVYTRMAAVLIKDN-SAKGG
A0A7C1QWC7      A----K----AFSYKFFYILCILLLV-AGAYLY-NRF-APTIYQVNSTIGPVEE-SRSSF
A0A352Z1R7      S----V----ILRRRKLFTLAFCAVF-FSVVLY-TYL-MKPIYEASSTLHIKKE-RGQGV
A0A0A2F501      A----M----CWARKFWFVLSLGLFL-GGAILY-ILI-TPPVYKRTATLLIKDD-SKGKG
R5B7P0          R----R----CLSRWYWFALSLAVCL-ALGALY-ILR-STPTYNTSADIQIKSN-TKGAS
R5B0L5          F----I----TLKRWPWILLSLAICV-GCAVLY-VLR-TPSMYTRSASIVIKSS-SQGAS
A0A6I1TEC0      Y----L----CLARWKWFVLSLFVTM-GAAGYY-LLS-TPNVYQRTASLLIKDE-SKGSS
A0A3R5XWG1      Y----L----CLARWKWFVLSLFVTM-GAAGYY-LLS-TPNVYQRTASLLIKDE-SKGSS
A0A5P0Y910      Y----L----CLARWKWFVLSLFVTM-GAAGYY-LLS-TPNVYQRTASLLIKDE-SKGSS
A0A414YFM3      Y----L----CLARWKWFVLSLFVTM-GAAGYY-LLS-TPNVYQRTASLLIKDE-SKGSS
A0A6A7UIA7      Y----L----CLARWKWFVLSLFVTM-GAAGYY-LLS-TPNVYQRTASLLIKDE-SKGSS
A0A6A7VPS3      Y----L----CLARWKWFVLSLFVTM-GAAGYY-LLS-TPNVYQRTASLLIKDE-SKGSS
A0A374THP7      Y----L----CLAKWRWFILSLAVTL-GIATYY-ILT-TPNVYQRTASLMIKDD-SKSQG
A0A6G1VND1      Y----L----CLAKWRWFILSLAVTL-GIATYY-ILT-TPNVYQRTASLMIKDD-SKSQG
A0A0A2EVS5      R----L----CLIRWKWILLSLLITV-GAATAY-LMI-TPVEYKRSASILIKES-DKPGA
A0A1T4NAJ7      R----L----CLIRWKWILLSLLITV-GAATAY-LMI-TPVEYKRSASILIKES-DKPGA
A0A255T941      G----L----CLPRWRWFVLSVLICA-SAAVLY-LLR-TPNIYTRTASILIKED-AKGKS
A0A4P7VSV0      Y----R----TLHHWPWVLLSLVVCV-GAAVVY-LLC-TPKVYTTTASIMIKDE-AAGKS
A0A7J0AX49      Y----R----TLHHWPWVLLSLVVCV-GAAVVY-LLC-TPKVYTTTASIMIKDE-AAGKS
A0A3N2KCL3      Y----R----TLHHWPWVLLSLVVCV-GAAVVY-LLC-TPKVYTTTASIMIKDE-AAGKS
A0A2V1IJY1      Y----R----TLHHWPWVLLSLVVCV-GAAVVY-LLC-TPKVYTTTASIMIKDE-AAGKS
A0A4P7VXK7      Y----R----TLHHWPWVLLSLVVCV-GAAVVY-LLC-TPKVYTTTASIMIKDE-AAGKS
A0A1Y4CHN5      Y----M----CLSKWYWFAISLVVLI-ALALIY-IMR-TPPEYTRSASMLIKEE-GKGQS
A0A1M6I2S6      G----M----FVPRWHWFALSLFAAL-AIAAFY-LLS-TPNIYTRTAAILVKDD-TKSGS
A0A1Y3V692      G----M----FVPRWHWFALSLFAAL-AVAAFY-LLS-TPNIYTRTAAILVKDD-TKSGS
F3PXM2          S----M----FVPRWRWFALSLAVAL-SAAALY-LLR-TPAIYTRHAAILVKDD-SKGGA
A0A174AHH7      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A174JCE8      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A3E4JMC4      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A412SND6      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A414IEQ9      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A7K0HNT3      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A0M1W8D8      G----M----FIPKWYWFALSLFVAL-ATASLY-LLS-TPNIYTRTAVILIKDD-SKNNS
A0A3R6GKX5      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A7V4S1          G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
B0NU19          G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
D4V601          G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A4Q0U3M9      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A7J5G2G2      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A7J5HH13      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A397WLT5      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A6A2J529      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A6N8DDD8      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A015XH67      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A078RZN2      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A0A6M4L7F4      G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A6L0K5          G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A7ACT5          G----M----FIPKWYWFATSLFVAL-ATASLY-LLS-TPNVYTRTAAILIKDD-SKNNS
A6KY94          G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
A0A173UQR8      G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
A0A3R6HK75      G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
A0A412B7D1      G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
A0A412VNY9      G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
A0A414LTU9      G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
I9Q4U4          G----M----FFQKWYWFALSLFVAL-ATASLY-LLS-TPNVYTRTAAILVKDD-SKNNS
A0A373ISF0      G----L----FVPKWHWFVLSLFVTM-SVAVLR-LMS-TPSIYTRSAAILVKDD-SNSGS
U6RF62          G----L----FVPKWRWFVLSLFVTM-SVAVLR-LMS-TPSIYTRSAAILVKDD-SKSGS
A0A662ZZD5      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A3A5TI83      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A415NEB6      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A7AJ60          G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A7J5MKN5      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A6A2JF01      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A7J4Y8G3      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A015UXN7      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A6I2NTL0      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A6I2Q447      G----I----FMPRWHWFALSLFVTL-ATAALY-LLG-TPNIYTRTAAILVKDD-SKGGT
A0A016E4F9      G----M----FVPRWHWFVLSLFAAL-AVATFY-LLS-TPNIYTRTAAILVKDD-SKSGS
A0A6N3HG44      G----M----FVPRWHWFALSLFAAL-AVATFY-LLS-TPNIYTRTAAILVKDD-SKSGS
A0A7K0HSP7      G----M----FVPRWHWFALSLFAAL-AVATFY-LLS-TPNIYTRTAAILVKDD-SKSGS
A0A7K1HEJ5      G----M----FVPRWHWFALSLFAAL-AVATFY-LLS-TPNIYTRTAAILVKDD-SKSGS
A0A6H9P0U9      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A108TH71      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
I8VXH0          S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A412S0N6      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A412IIJ0      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A0P0FM97      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
R6KTP3          S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A139LU87      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A1C6B3Y5      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A6L3KCD1      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
E2NMQ4          S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A412YDB9      S----M----FVPKWYWFAVCLFITL-AIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
R7DY01          S----M----FVPKWYWFAVCLFITL-AIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A414LGK8      S----M----FVPKWYWFAVCLFITL-AIAVLY-LLS-TPPIYTRTAAILVKDN-SKSNS
A0A415IPQ4      S----M----FVPKWYWFAISLFITL-TIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A3E5BRW7      G----M----FVPKWHWFAGSLLITL-AIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
K9DXS6          G----M----FVPKWHWFAGSLLITL-AIAVLY-LLS-TPPIYTRTAAILVKDN-SKSSS
A0A1M6KFV3      G----M----FVPKWYWFAGSLFVTL-TIAALY-LLS-TPPIYTRTAAILVKDN-SKSNS
A0A1Q6G7L3      G----M----FVPKWYWFAGSLFVTL-TIAALY-LLS-TPPIYTRTAAILVKDN-SKSNS
A0A413H235      G----M----FVPKWYWFAGSLFVTL-TIAALY-LLS-TPPIYTRTAAILVKDN-SKSNS
A0A1M5B2J8      Y----L----CLAKWHWFVLSLAVCL-GVAIAY-LLR-TPPVYTRSASILIKDD-SKGKS
A0A255RCT5      Y----M----CLAKWYWFVLSLAVCL-GVAIAY-LLR-TPPVYTRSASILIKDD-SKGKS
A0A1Y4GLF5      Y----L----CLAKWKWFVISLVVTC-GIAVLY-LLR-TPSVYTRTASVLIKED-SKGNS
A0A1H3XSC0      Y----L----CLSKWKWFVLSLAVTV-GIAVFY-LLR-TPPVYTQTASVLIKDD-SKGKS
A6LE40          F----L----CLAKWQWFVLSLVVTV-GAATVH-LLR-TPAVYTRTASVLIKED-SKGKS
A0A4Y1VPX5      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6N2XMM4      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
B3JI46          Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A358R8U0      Y----L----CLAKWKWFILSLLVTL-SLAFLY-LLK-TPSVYTRSATLLIKEN-TKGQS
R6WSB6          Y----L----CLAKWKWFILSLLVTL-SLAFLY-LLK-TPSVYTRSATLLIKEN-TKGQS
A0A401LPX7      Y----L----CLNKWHWFVISLVLCL-GGATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A6G0GNY9      Y----L----CLNKWHWFVISLVLCL-GVGTFY-LLK-TPSVYVRTASILIKDD-SKGKS
A0A6I1BFM0      Y----L----CLNKWHWFVISLVLCL-GGATFY-LLK-TPSVYVRTASILIKDD-SKGKS
A0A3A5Z900      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A7K0GW19      Y----L----CLDKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A285TGL6      Y----L----CLDKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A3A5RFX4      Y----L----CLDKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A1Q6IUW9      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A413XDP6      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A6N8CVT6      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
K6AP24          Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A6I2NHV3      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A078RYI7      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A7I0QD01      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
C7XEQ8          Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
D7INX6          Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
K5ZG55          Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A662ZYI7      Y----L----CLNKWHWFAISLALCL-GVATFY-LLR-TPSVYVRTASILIKDD-SKGKS
A0A3N2N9B8      F----L----TLRKWPWIILSLTICV-GAALTY-ILR-TPTVYTRAAQIMIKDT-SKGKS
A0A3N2NMI0      F----L----TLRKWPWILLSLIVCV-GAAMIY-ILR-TPDVYTRATEIMIKEP-SKGKS
A0A359I8H7      A----R----CLSKWRWFAVSIVLFC-CLGVLY-VLR-QQPVYSRSMELLIKDQ-DGGGG
A0A3N2KA63      A----R----CLSKWRWFAVSIVLFC-CLGVLY-VLR-QQPVYSRSMELLIKDQ-DGGGG
A0A4Q0IMT7      A----R----CLSKWRWFAVSIVLFC-CLGVLY-VLR-QQPVYSRSMELLIKDQ-DGGGG
A0A7J0B660      A----R----CLSKWRWFAVSIVLFC-CLGVLY-VLR-QQPVYSRSMELLIKDQ-DGGGG
A0A3B9FAU3      D----I----VLGNWFWILQSVILFG-AAGWYY-LKI-TPNTYQRTALVVIKED-SPQRG
A0A3C1E5L7      D----I----VLGNWFWILLSVILFG-AAGWYY-LKI-TPNTYQRTALVVIKED-SPQRG
A0A4Q0UAV1      Y----Y----FLSKWYWFVISVAVCV-AFASYK-LMS-TRPTYVRTITVMFKTE-ESGNG
A0A354SN68      F----A----CLAQWKLFALSVAVCV-GATMLY-LSS-KSPVYMRRASVLMKED-NRRSA
A0A6L5XFL0      Y----L----CAAKWYWFLISFIVML-GLACLY-ILC-SQPVYTRQASILIKDE-DNNSS
A0A3N2N595      Y----R----TLHYWPLVLLSLFICV-GAAVMY-LLC-TPKIYTTSASILIKDN-AKSNT
A0A7J0ACS3      F----M----TLRRWPWILLSVLVCV-GAAYVY-LLR-TPNVYSRSAEILIKDD-AKGN-
A0A0A2DUD9      R----L----VCIRWYVIAISILLAL-GVAVLY-ILR-TPPVYKRTASVMIKAD-DKGKS
A0A3P1ZBJ5      Y----L----CLSKWYWFLLSLILSL-ALGVLI-ILR-TTPVYNRYTTIMIKEN-TKGGG
R5FHS9          Y----L----CLRKWWWFAIALIIAF-GVAIAY-ILR-TPPVYTRTESVVISNS-DDSRS
A0A413TW79      Y----L----CLVRWRWFVISLVVTL-GIATYY-LLS-TPGVYQRTASILIKED-GKSQS
A0A7K0AAG2      Y----L----CLARWRWFAISLAVTL-GIATYY-LLS-TPSVYQRTASILIKED-GKSQS
A0A7K0ASF1      Y----L----CLVRWRWFVISLVVTL-GIATYY-LLS-TPCVYQRTASILIKED-GKSQS
A0A3E5E9M7      Y----L----CLVRWRWFVISLVVTL-GIATYY-LLS-TPSVYQRTASILIKED-GKSQS
A0A3E4SK73      Y----L----CLVRWRWFVISLVVTL-GIATYY-LLS-TPSVYQRTAFILIKED-GKSQS
A0A415GGC6      Y----L----CLVRWRWFVISLVVTL-GIATYY-LLS-TPSVYQRTASILIKED-GKSQS
A0A413DBH9      Y----L----CLVRWRWFVISLVVTL-GIATYY-LLS-TPSVYQRTASILIKED-GKSQS
A0A495WI87      Y----L----CASNWYWFALSLMITL-GAAFLY-IKV-TPPVYTRSASILIKED-SKGKS
A0A354M4S6      Y----L----CASNWYWFALSLMITL-GAAFLY-IKV-TPPVYTRSASILIKED-SKGKS
R7DH52          Y----L----CASNWYWFALSLMITL-GAAFLY-IKV-TPPVYTRSASILIKED-SKGKS
A0A7J5IAE7      Y----L----CLARWKWFVLSLAVTL-GIATFY-ILR-TPQVYTRTASVLIKED-AKGKS
A0A016CWA4      Y----L----CLAKWKWFVLSLVVTT-GVAAVY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A4P8LP09      Y----L----CLAKWKWFVLSLVVTT-GVAAVY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A0M1W0V2      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A139KA16      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A174VQ92      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A1Q6HCG0      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A1Y4JYM9      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A3A5QW67      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A3A5RQE6      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A3A6BP07      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A3E5E153      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A3Q9IP20      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A412WV15      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A413ICP6      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A414KYB9      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A5B3FWR2      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A7J5QHB9      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
E5WX00          Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
K0X3P3          Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A1C6H117      Y----L----CLARWKWFVLSLAITT-GVAAVY-LLC-TPAVYTRTASVLIKED-SKGKS
A0A6I1AQV4      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A5C6L2P1      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A412MJT7      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKDKS
A0A3E4WKT5      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3A5YY33      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A1E9CFZ7      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A373FYU5      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3A5TZ72      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3A5XBP2      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3A6MEG9      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3E4JP35      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3E4KP40      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3E4NX82      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3E4XFU8      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A412RG70      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A412TD37      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A413GAA4      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A414M7I4      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A496BTA0      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A496D2V6      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A5C6KCA6      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A5M5AHM5      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6I0Y5K7      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6I1BFB8      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6I2P5W5      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6N8DC51      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A7J5HGP0      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A7J5HVL8      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A7J5JHD3      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
E5UZA2          Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A069SMG6      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-PPAVYTRTASVLIKED-SKGKS
C3RFN5          Y----L----CLARWKWFVLSLVVTI-GVATVY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A3A5Z014      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLIKED-SKGKS
A0A7J5GD93      Y----L----CLARWKWFVLSLVVTV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A7K0HGR5      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A078S3Q8      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A069SJV7      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A3E5DXI5      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A3E5EM98      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A6N2YYD4      Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
I9T3G6          Y----L----CLARWKWFVLSLAITV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A3E4SYU0      Y----L----CLARWKWFVLSLVVTI-GVATVY-LLR-TPAVYTRTASVLIKED-SKGKS
A6LGY1          Y----L----CLARWKWFVLSLVVTI-GVATVY-LLR-TPAVYTRTASVLIKED-SKGKS
K5ZSH4          Y----L----CLARWKWFVLSLVATI-GVATVY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A6A2RTB3      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A7J5PEN4      Y----L----CLARWKWFVLSLAVTI-GAATAY-LLR-TPAVYTRTASVLIKED-SKGKS
A0A1M4YZ07      Y----L----CLARWQWFVLSLVVTV-GAATVH-LLR-TPAVYTRTASVLVKED-SKGKS
A0A7J5I238      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A0P0FQW1      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A7K0I229      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A5M5C0W6      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A642NJ89      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6L3JTQ2      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A7J5FQU6      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A7J4YLH7      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6N3AEV2      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6G0G4T5      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A6L3KG29      Y----L----CLARWQWFVLSLAVTI-GAATAY-LLR-TPTIYTRTASVLIKED-SKGKS
A0A1Y4PQK7      Y----L----CAAKWKWFVLSLLVAF-GIGYYY-LLK-TPPVYTRTAELLVKRE-YRGRS
A0A1Y4IH41      Y----L----CAAKWQWFVLSLLVAF-GIGYYY-LLK-TPPVYTRTAELLVKRE-YRGRS
A0A3A6AAP4      Y----L----CAAKWQWFVLSLLVAF-GIGYYY-LLK-TPPVYTRTAELLVKRE-YRGRS
A0A6I0ZRD2      Y----L----CAAKWQWFVLSLLVAF-GIGYYY-LLK-TPPVYTRTAELLVKRE-YRGRS
A0A7L4SP06      Y----L----CAAKWQWFVLSLLVAF-GIGYYY-LLK-TPPVYTRTAELLVKRE-YRGRS
A0A1Y4DYA7      F----S----LLKKWYWFVISILISI-TIAIFY-IMC-TPPIYTRSASLLIKED-NKSNS
A0A1Y3X4I9      Y----L----CLAKWYWFVISLVVLL-GFTALH-LLT-TPPVYTRSASLLIKED-SKGNS
A0A1Y4FNK8      Y----L----CLNKWYWFVISLAVTI-GVAVVY-LLT-TPPVYTRSASLLIKED-SKGNS
A0A355FD59      Y----L----CLAKWRWFVLSLFVTL-GIAVLY-LLT-TPAVYTRSASLLIKED-SKGKS
A0A359CEZ9      Y----L----CLAKWRWFVLSLFVTL-GIAVLY-LLT-TPAVYTRSASLLIKED-SKGKS
A0A353Q7B4      Y----L----CLAKWRWFVLSLFVTL-GIAVLY-LLT-TPAVYTRSASLLIKED-SKGKS
F8X3A5          Y----L----CLFRWRWFVISLFITL-SIATFY-ILT-TPPIYIRSASILIKED-SKSQS
A0A1M3KVR9      Y----L----CLFRWRWFVISLFITI-SIATFY-ILT-TPPIYIRSASILIKED-SKSQS
A0A4Y9IJS3      Y----L----CLFRWRWFVISLFITI-SIATFY-ILT-TPPIYIRSASILIKED-SKSQS
A0A1H4ADG3      H----R----IRANWYYCVICAIVMV-GLAGIY-LYV-ANPTYKAMATVLIKDNTGQNNS
A0A5B8VUR8      Q----R----IRANWLYAVLSAILMV-VLAVIY-LYV-TSPTYKAMATVLIKDNDGKSPA
A0A0D3L8Q3      L----K----YLRYWYLFLLGTIICF-GLAYLY-LRY-TTPQYLITTSILIKSD-QQSGG
A0A7G7G5F9      S----K----YLKYWPLFAASIVLCL-CLAYAY-LLY-ATPEYSIVSTIQIKDD-KKDPG
A0A2N3U785      T----K----YLRYWYLFAATLLLSL-AGAYTY-LRY-ATPQYLISSTLLIQDN-NKGAS
A0A5B6TJH8      I----Q----YSRYWYLFLLGALLSV-GAAFMY-LRYHTSVQYKVASRLLIKEN-QRGQG
A0A519U664      S----Q----YSRYWYLFVLGASIGL-GIAYLY-LRFYAIPQYVVSSTMLIKDD-KGGQG
A0A519MA34      H----Q----YTRYWYLFVLGAALGL-GAAYFY-LRYYAIPQYVVSSTMLIKDE-KGGQG
A0A519UCX0      Q----Q----YSRFWYLFVLGAILGS-GAAYLY-LRFYAIPQYVVSSTLMIKDD-KSTQG
A0A0E3ZG78      L----N----YLRYWYLFLIGAALGL-CGAFLY-LRYYTIPKYSVYSTVLIKDD-KSDSH
A0A1I6BRK6      L----Q----YTRYWYLFLLGAVLSI-SVAFFY-LRYYAVPQYIVSGTMLIKDD-KSGQS
A0A243WAB1      G----Q----YIRYWYLFLLGGMIGL-GITYFY-LRYYAVPQYHVYSTLLVKDD-KSGQS
A0A6G8C8X6      Q----Q----YVRYWPLLLLGTTLGL-ATAFLY-LRYYAVPQYWTESTLLIKDD-KSGQG
A0A416GA42      H----V----ALKKWYYYVGAVVCCL-LFAYIY-LHR-TAPMYQRMATVLIKDK-ESGTR
A0A1T3IYP5      K----Y----LLHHWKWFTLSILIFG-GFFYYQ-YSK-TPFIYNQSEVVMIKTPSNTPTT
A0A1T5K9D4      F----Y----LLNHWYWFVLCIGLAV-AFTSYR-YAK-TPFSYRSNATIIIKNP------
A0A077ENE7      K----Y----LLHHWKWFVLSILIFG-GYYYYQ-YSK-TPFVYNSSEIVMVKTP------
A0A7H1Z2Z7      K----Y----LLHHWKWFVLSILIFG-GYYYYQ-YSK-TPFVYNSSEIVMVKTP------
A0A6I5UW06      K----Y----LLHHWKWFVLSILIFG-GYYYYQ-YSK-TPFVYNSSEIVMVKTP------
T0NN57          K----Y----LLHHWKWFALSILIFG-GYFYYQ-YSK-SPFVYSRSEVVMIKTA------
X5K347          K----Y----LLHHWKWFALSILIFG-GYFYYQ-YSK-SPFVYSRSEVVMIKTA------
A0A060RD97      E----L----VLANWYWFAVSLLVAL-LLGGYL-YVK-SPLVFKRQASIMLKDK-SGSGQ
A0A3C1ITV0      S----W----TLCHKKFFAISIVICV-ALGLIY-AQR-AQRIYQRSASVMLRSD-NKGQA
R7HN19          S----W----TLCHKKFFAISIVICV-ALGLIY-AQR-AQRIYQRSASVMLRSD-NKGQA
A0A350IHV0      A----M----IWNNKWWYVLSLVVCI-FMAGFV-IYR-TAPKYTRTAKVIVDDS-NENSA
R5RVP0          S----M----IWDNKWWYVLSVAICL-CFSVFY-LYR-TASSYTRTAKVMIDDT-NENSA
R6A0L2          K----LCYHQFINHWAWFALSAVVCG-CIGWYY-QQC-QPRVYQRQAVMLIEDSNGSSTG
R7LG80          K----LCINQLLRNWYWFLLSIVICL-GLGWIY-RQS-QPSVFKQQSVILIEEADSDPRS
A0A2L2WX98      R----LCLGQLKAHWVWFLFSVIACA-ALGFLY-LQC-QPRIYQRQAVILLEDTDGRSAM
G5GD56          K----MCWALFLANLKWFVLSVILCL-VLGYLY-QAR-QSRVYQRQAVILFEDNESGSGG
R5KD55          I----S----CASHWRWYVATVVVAL-AVAVLY-IKK-TQPVYKRDASIMVLERNDKPTV
A0A174QNT3      E----L----FLNNWYWFIASILFCV-GGAWLY-LSA-VSPVYQRTAVMLVKSD-NQNSQ
A0A4S2FGS1      E----L----FLNNWYWFAASAVACV-AMAWIY-LSA-TPPLYQRTAVMLVKGD-SQNSQ
A0A7K3KG59      E----L----FLNNWYWFVVSAVACV-AMAWVY-LSA-TPPLYQRTAVMLVKGD-SQNSQ
R9I0H0          E----L----FLNNWYWFAASAVACV-AMAWIY-LSA-TPPLYQRTAVMLVKGD-SQNSQ
K5BUT9          E----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKDK-EKSA-
A0A174FPA3      E----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKDK-EKSA-
R6S9Y6          E----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKDK-EKSA-
A0A7J4YSB2      E----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKDK-EKSA-
C9KX15          E----L----IIANWYWFVLSVLVCV-GSAYFY-VLT-IQPVYQRQAVMLVKDK-EKSA-
A0A6H0KRK1      E----L----IIANWYWFALSVFICL-SVAYLY-TRT-LVPVYQRQAVMLVKTG-GKNAN
R6DAG6          E----L----IIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKTG-GKNAN
A0A3L8AAP1      E----L----LIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKTG-GKTAN
A0A4S2AYX2      E----L----LIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKTG-GKNAN
A0A7J0A2L4      E----L----LIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKTG-GKTAN
A0A7K3MN31      E----L----LIAKWYWFALSVFICV-SAAYLY-TRT-LVPVYQRQAVMLVKTG-GKTAN
A0A0E2M2Y7      L----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKSA-EKSGA
A0A0K2J6Z0      L----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKSA-EKSGA
B2RKZ8          L----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKSA-EKSGA
A0A212GC82      L----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKSA-EKSGA
A0A254MU12      L----G----LLSSWKWIVGSIIVCL-LVAYIY-TQR-QSPAYIAQAAVLIKSA-EKSGA
R6CQ93          V----Y----LLSKWKWFVLSILFFG-GLAWYY-YAQ-SPLVFFRSVTVIIKDQ-SNKTS
A0A3D1NQW3      Q----T----VIANWYWFVISVFVCV-GCGYIY-ILR-TPKIYSRTANILVKDS-RKGGD
B0MT10          Q----T----VIANWYWFVISVFVCV-GCGYIY-ILR-TPKIYSRTANILVKDS-RKGGD
R7JGW9          Q----T----VIANWYWFVISVFVCV-GCGYIY-ILR-TPKIYSRTANILVKDS-RKGGD
A0A3D2BF46      Q----M----VIGNWFWFLLSTVVCL-SCALFY-IYT-APKVYNRTATILIKDG-KKGSE
A0A358R538      R----M----VAANWYWFVISAAVCL-GAAYYY-LAS-TPRIYSRTATILVKDS-RKGGD
A0A1Y4AAB8      Q----M----ILANWYWFAISVIVCL-GAGYLY-LAR-TPKVYSRKATILVKDD-RKGAN
A0A1Y3WWY9      R----M----ILMNWYWFVLSVLVCL-GVAYYY-LAK-TPKIYSRTATILVKDS-RKGGA
A0A1Y4U5L4      R----M----ILMNWYWFVLSVLVCL-GVAYYY-LAK-TPKIYSRTATILVKDS-RKGGA
A0A1Y3VCJ1      R----M----VIANWYWFILSILVCV-GAAYYY-LAK-TPKIYTRSATILIKDS-RKGGD
A0A1Y3QTW7      Q----M----VLANWYWFALSVLICL-GMAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
R6XWY7          Q----M----VLANWYWFALSVLICL-GMAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A4Y1X9Y9      Q----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A4Y1WM66      Q----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A6N4GYT3      Q----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A174AVF1      Q----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A656Q4F4      Q----M----VLANWYWFALSVLICL-GVAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A1Q6EIY0      Q----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A5B5VN71      Q----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
E4M8L3          Q----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
I3YQ50          Q----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
R5UEY8          Q----M----VLANWYWFALSAIICL-GTAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A1H4D866      R----M----VIANWYWFVLSALVCL-SLAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A5B3G4Y7      R----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A374A9J5      R----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A5B3GQN5      R----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A1Q6E9S3      R----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
D4IJ36          R----M----VIANWYWFVLSTVCCL-CAAYYY-LAS-TPKIYSRTATILVKDS-RKGGD
A0A414Q925      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A415PUS9      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A108TCU0      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A413BA42      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
S3Y344          S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A7J5LEW3      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A412TGL3      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A413VJ33      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A414L0W6      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A412DP39      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A413ZSE8      S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
B0NP84          S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
R6AK43          S----A----VYRNRKWFILSVAVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A412N2D9      S----A----VYRNRKWFILSVVVCV-LIGFLY-LKS-SPEIFLRTATVLVKDE-QKGGG
A0A1Y4JYS9      S----A----VYRNRKWFILSVVVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
R6LHA4          S----A----VYRNRKWFILSVVVCV-LIGFLY-LKS-SPKIFLRTATVLVKDE-QKGGG
A0A3E5HPT8      I----Y----LIAHWKWFVLSILLFG-GYFWYS-YCE-TPFVYSRTAIVMIKTP------
C6IJ48          I----Y----LIAHWKWFVLSILLFG-GYFWYS-YCE-TPFVYSRTAIVMIKTP------
Q8A3U2          I----Y----LIAHWKWFVLSILLFG-GYFWYS-YCE-TPFVYSRTAIVMIKTP------
A0A3R6S1H6      Y----M----FKRYWYWFVLSVMVFL-GGAVYY-VKS-TAKIYTCVASVLIKND-SKGTS
A0A3R6SD81      Y----M----FKRYWYWFVLSVMVFL-GGAVYY-VKS-TAKIYTCVASVLIKND-SKGTS
A0A354WXN6      K----I----AWANWYWFVISIVLCL-SIAFVY-LKW-APKVYTRTASVLIKDD-KKGGG
A0A7G1HW11      E----I----GLANWKWFALSVIVCL-SIAYVY-VQT-LPYIYTRSASVIIKDN-KSGG-
R5IP14          E----I----GLANWKWFALSVIVCL-SIAYVY-VQT-LPYIYTRSASVIIKDN-KSGG-
A0A316SZX7      D----L----LISQWKWFALSICICL-GIAFLY-LKQ-ATPIYTRTASVMIKDD-RRGGA
A0A1Y4AIY1      Q----I----VKAKWYWFALSIGICL-GIAYIY-LLQ-APKVYTRSASVLIKED-RRSSR
A0A0J6CIR2      H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKG-G
A0A3D8HG59      Q----I----VRANWYWFALSVVVCM-SAAFVY-LQW-APKQYTRTASVLIKDD-TKGSG
A0A3R6S408      Q----I----VRANWYWFALSVVVCM-SAAFVY-LQW-APKQYTRTASVLIKDD-TKGSG
F3ZRU7          T----M----LMRHWLWYIVAVALAL-VLGFLY-IKS-TPKTYERHASVLIKDDKASGGA
A0A1C5Q1F3      H----I----ALANWKWFVLSLVVCM-GASFWY-IKR-SPDIYSRSASVLIKDE-TRGAQ
R7A239          H----I----ALANWKWFVLSLVVCM-GASFWY-IKR-SPDIYSRSASVLIKDE-TRGAQ
A0A3R6HIK7      Q----I----FKANWYWFVLSVILCV-GAGYLY-LLQ-APRVYTRTASVLVKEE-QRKSR
K5ZVW7          Q----I----FKANWYWFVLSVILCV-GAGYLY-LLQ-APRVYTRTASVLVKEE-QRKSR
A0A1Y4D5Z0      Q----I----LKANWYWFVLSVVACL-GLAYLY-LKQ-APLVYTRSASVLIKEE-NRWGR
A0A413VXJ7      Q----L----IWSNRYWFALSIILCI-GIAFFY-IQS-TSKVYSRKATVLIRDD-SKGGG
I9RSN9          Q----L----IWSNRYWFILSIFLCV-GIAFFY-LQS-SSKIYSRKASVLIRDD-SKGGG
U6RJK5          Q----L----IWSNRYWFILSIFLCV-GIAFFY-LQS-SSKIYSRKASVLIRDD-SKGGG
A0A1Q6GA32      Q----L----IWSNRYWFILSIFLCV-GIAFFY-LQS-SSKIYSRKASVLIRDD-SKGGG
I9RPU6          H----L----IWVNWYWFVLSVLVCG-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGG
I8YFS5          H----L----VIANWYWFVLSILICA-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGS
A0A7J4XCM0      H----L----VIANWYWFVLSILICA-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGS
I8Y597          H----L----VIANWYWFVLSILICA-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGS
A0A1Q6GBF5      R----F----VLANWYWFVLSVLVCT-GIAYFY-VKS-SSKIYSRKASVLIRDD-SKGGA
I8YFZ3          H----L----ILVNWYWFVLSVLVCG-GVAFFY-LKS-SSKVYSRKASVLIRDD-SKGGG
A0A7J4XFW0      H----L----VLANWYWFVLSVLVCG-GVAFFY-LKS-SSKVYSRMASVLIRDD-SKGGA
A0A1Q6GDH2      H----L----IWVNWYWFVLSVLVCG-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGG
U6RSB0          H----L----IWVNWYWFVLSVLVCG-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGG
I9GXM2          Y----L----VLANWYWFILSVLVCG-GVAFFY-LKS-SSKVYSRKASVLIRDD-SKGGG
I9SIK1          H----L----ILANWYWFVLSVLVCG-GVAFFY-LKS-SSKIYSRKASVLIRDD-SKGGG
A0A7J4XIJ5      H----L----ILANWYWFVLSVLVCG-GVACFY-LKS-SSKIYSRKASVLIRDD-SKGGG
I9TP59          H----L----VLANWYWFVLSVLVCG-GVAFFY-LKS-SSKVYSRMASVLIRDD-SKGGG
R5S343          G----I----VWMHKWWFTASLVVCI-ILASGY-LMW-MPNVYTRTASVLIKDS-NKGGA
A0A1M6K7I9      L----I----LRNNWKWFAASIFVCM-ALAFVY-LKS-TPKTYSRKATVLIRDD-KKGGG
A0A5M6A8C8      L----I----LRNNWKWFAASIFVCM-ALAFVY-LKS-TPKTYSRKATVLIRDD-KKGGG
A0A7J4XCJ1      R----L----IFVNWYWFVLSVLICI-GFAFFY-LKS-SSKVYSRKASVLIRDD-SKGGN
A0A7J4XNQ7      H----L----VLANWHWFTLSILVCV-GIAFFY-LKS-SSKVYSRKASVLIRDD-SKGGS
A0A3R5ZMK1      Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A7K1HMX0      Q----V----VLANWHWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A1Y3ZIA4      Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
K5Y1A4          Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A7K1HDC0      Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A3R6K8X4      Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A6N8D6C8      Q----T----VLANWYWFVLSVVVCA-GTTFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A3R6BKI7      Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A412M2W1      Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
K5ZX55          Q----T----VLANWYWFVLSVVVCA-GAAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A415BDM7      Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A1Q6I3T6      Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A414XX40      Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A7AEU7          Q----T----VLANWYWFVLSVVVCA-GTAFLY-LKW-APKVYTRTASVLIKDD-AKGGA
A0A5F0U645      R----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
K5ZBN2          R----V----VRANWYWFLLSVAVCC-AVAALY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A0J6CKW3      R----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A0F5IQM7      R----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A496CDT3      R----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A6G1ZKM3      R----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
S0GLB0          R----V----VRANWYWFLLSVAVCC-AVAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A3R6NLC1      R----V----VRANWYWYLLSVVVCC-AIAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A416WYC9      R----V----VRANWYWYLLSVVVCC-AIAVLY-LGW-APKIYQRTATVLIKDD-TKGGG
A0A0F5IT40      H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKGGG
A0A496CX20      H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKGGG
A0A5F0UBI0      H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKGGG
A0A6G1ZHG0      H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKGGG
S0GSI7          H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKGGG
K5YB65          H----I----VLANWYWFVLSVLVCA-GVAVLY-LKW-APKVYTRTASVLIKDN-SKGGG
A0A0F5IWP9      H----I----VLANWYWFLLSVLICC-GAAFLY-LKW-APKVYTRTASVLIKDN-TKGGG
A0A0F5IZT8      H----I----VLANWYWFLLSVLICC-GAAFLY-LKW-APKVYTRTASVLIKDN-TKGGG
A0A417LKQ2      N----I----VRANWYWFLLSVLLCS-GAAFLY-LKW-APKVYTRTASVLIKDN-AKGGG
A0A416TME1      H----I----VLANWYWFLLSTLFCC-GVAFLY-LKW-APKVYTRTASVLIKDN-TKGGG
A0A416XPE8      H----I----VLANWYWFLLSTLFCC-GVAFLY-LKW-APKVYTRTASVLIKDN-TKGGG
A0A3B0C2S4      E----V-AQKYLRYWPWFVLGILICL-GGAYAY-MRYAP-IVYESSAKIKIIDE-AKEMD
L8JI02          G----IVLY-LLSKWHYFVFAAIFLL-PGAYLY-TKYAT-KVYLVKASILLKSE-RKN-D
A0A4Q5WS95      E----AFVYRYLPYWPLFAILAIFFT-ALSVGY-LRYAT-PVYEANATILIKDE-KKGAE
A0A501VZX6      S----SLLYKYLPYWPLFALLLLISC-LGTWGY-LRYFAIPSYETSASLIIKDE-NKGVN
A0A399SH26      T----VLLRKFLPYWPVFIGLAILSM-ALAWVY-LRY-ATPVYEIAATLIIKDE-KKGVD
A0A501W1A9      G----AIVFRFLPFWPLFVVLIGVCL-AGAWAY-LHYVATPTYSTSASLIVKDE-KKGVN
A0A0E3ZGV6      A----SLVYKFLPFWPLFVVLFILSV-AGAWAY-LKFYATPTYAITASLIIRDE-EKGVN
A0A1I2N4S1      V----ALLYKFLPFWPLFLVLLLLGM-AGAWAY-IKYYTIPSYAVTASLLIKDE-EKGVN
A0A2T5YE44      V----ALLYKFLPFWPLFLVLLVLGM-AGAWAY-IKYYTIPSYAVSASLLIKDE-EKGMN
A0A1M5BA90      E----AFMYRYLPYWPLFALLLILAG-TAAYMY-LHYIAKPVYQISANILIKDE-KKGAD
A0A512B879      E----RFIYSYLPYWPLFALLLVVFL-VAGSFY-L-YLTKPIYEISADILIKDE-KKGAD
A0A559PPI3      S----SMMDLFFPFWPLLAVILVVVL-FLAWGY-KNYAT-PIYEVSATLIIKDE-NKGVD
A0A1T5CS78      R----YIIKTFFPFWPLFLVLVVVCV-LGAWGY-LKYVT-PIYEASASIMIKDE-EKGVD
A0A0Q9Z8F1      R----YIIKTFFPFWPLFLVLVVVCI-LAAWGY-LKYAT-PIYEASASIMIKDE-EKGVD
A0A2N0U0M7      R----YIIKTFFPFWPLFLVLIVVCI-LAAWGY-LKYAT-PIYEASASIMIKDE-EKGVD
A0A1V9FHD0      S----LALNWYLPYWPLFLILIVLGS-AGALVY-LNFFATPVYETYATVMVKDE-KKGVD
A0A4V4H170      S----VAINWYLPYWPLFLILIVLGL-AGAWAY-LKYFSTPVYETYATIMVKDE-KKGVD
A0A1V9F098      S----VVTNWYLPYWPMFLVLLILGL-AGAWAY-LKFYSIPVYETYATIMVKDE-KKGVD
A0A4R2VU64      S----VVTNWYLPYWPMFLILLVLGL-AIAWAY-LRYFSIPVYETYATIMVKDE-KKGVD
A0A4S8HY23      S----VAINWYLPYWPLFLMLIVFAL-AGAWAY-LTYYATPVYETYATIMVKDE-KKGVD
A0A1V9F383      S----LIVNWYLPYWPLFLILIIVGV-GSAWAY-LHFIAVPVYETNATVMVKDE-KKGVD
G8TRZ6          S----LIINWYLPYWPLFLILTVVGL-AAAWAY-INFVAVKQYESYATVMVKDN-KKGVD
A0A4R5DL69      S----LWP------WLILSQIFSLLA-SF--IY-LRYST-PRYEITSTILVKDD-TKGTD
A0A1M4YED3      S----ILQFRFAPYWPLFIILAIISG-VASYLY-LKYTP-PVYSAYSTMMIKDE-KRGVN
A0A2H3NSN0      T----IWHTIKRGKWIILGTCLAMIA-AFA-GY-TFMVA-PEYEAAATVQVE-K------
A0A2P6C324      A----LWEAVKRSKWVILGTCVFVTA-LTA-AV-TMMMP-QVYEAGAVVSVE-R-----E
A0A7C2DZI7      E----IWHTIRRGKWLILLTTLIVAG-VVT-IY-TYSLP-PVYESSAIVFID-T-RSSSN
A0A1M6XHU0      E----IWHTIRRGKWIILLTTLVVAG-VIG-AY-TYTLP-PVYESSAIVFVD-T-RGSGN
G2SF81          E----IWHTIRRGKWIILLTTLVVAG-IIG-AY-TYTLP-PVYESSAIVFVD-T-RGSGN
A0A5S9EYW1      E----IWHTIRRGKWIILLTTLVVAG-AIG-AY-TYTLP-PVYESSAIVFVD-T-RGGEN
D0MHQ9          E----IWHTIRRGKWIILLTMLVVAG-AIG-AY-TYTLP-PVYESSAIVFVD-T-RGGGN
A0A126PFG0      A----VLARYRYHWSLFVAGVALALL-GAY-LY-TQLVQ-PAYEVRASLLVEGE-KKTPA
A0A3M1N7Z3      R----VLIVLSREWWWPTLSVLFAAF-TAW-AY-LRYTE-ATYQTTAVVQVNLA-QAVGG
                                                          :                 

A0A1T5MMH4      --------LGISIL---------AGKDQQNTDLISGEIEMIRSRLFLDQVLDSL--NIDV
A0A2W4R1L8      --------LGINRL---------V--EDQNLNIMSGEIEIIQSKLFLARVLDSL--KIDV
A0A2E5CV79      ----------------------IMQYGSRDRSDMSNEIEVLRSRRLAKDVVKLF---WDS
A0A2D4ZVH1      --------NRYSYAGAGIENLLTSTYGIGVGSTIANELQIMKSRKLSYDLAERI------
A0A0K8QSK7      FSQTESAISS---------QAFEGFGIMGQNNNIYNQIEVLKSWPIIEEAVQEL--GFEV
A0A1V6CN82      FWRQAGGFSG---------EALRGFG--TSYQGIQNQMIIMKSQPVVAKAIREL--GFEV
A0A1M4XZ45      LSGAMGGAQQ---------SIFQGLGGMNSMQNIYNQMVVLSSTPIISRTLNEL--DFEV
A0A399D319      LASGAGGSSE---------GIFQGLGMMNSMRNIYNQMVILNSTPIVSRTLNEL--DFEV
A0A1V5IPN7      --------------------ILLLTNQGGGKNSINNQIELMRSKPILNAAYEIMKKNPDW
A0A1M6GR99      --------SSSSGE-----SRYINSELLSRSQNIQNELEIIKSFPNISQTVRNL--NLEV
A6EBM4          --------TALSDI--------ADALNTNTATNMQSESFAIESRHLLLNAIKRL--QYHI
A0A7C5M4P4      --------LNLPGT-----------ESQNAYNLMSSEIELITSRLFFNKIIESV--QLSP
A0A1M6TTV4      --------LGIQNPMDQDIKG------------LSGEIEILKSRLFASQVVNAV--GMDV
A0A4Q8RX32      DPTSFLPGSELFSG----------------RNTFHNSLLTLQARPLLEKVLNKL--NFSV
K0X1U5          --------GGLSSLMGGISGGGFSLDGMIGGGSVNDEILVISSHSLIREMVQRL--DLNI
R5EXK3          --------GGLSSLMGDIAGGGFSLDGMIGGGSVNDEILVISSHSLIREMVQRL--DLNI
A0A401UAP7      --------FGITKI-----ME------DQNLNLISGEIELIQSNLFLSRVIDSL--KLDV
A0A1W2GF52      --------ANLLGL-----QNPLEQDIKG----IAGEIEILRSRLFFSKVVDAI--GMGI
A0A2G5L7B8      --------AGILGI-----QNPMEQDIKG----LSGEIEILKSRLFASQVVDAV--GMNV
A0A523GAC0      --------LGFLEI-----NE------EQNLNNISGEIELIKSKLFFDKVIKTL--DLDI
L8JW09          --------LGLLGL-----SE------NKNLNIISGEIELIKSKLFFSKVIETV--DLDL
A0A364XUP5      --------LGIATI-----TS----DEPQNADLISGEIEIIRSKLFLNIVLDSI--NLSV
A0A1M5RLA9      --------FGIKPT-----VE----D--PNFNLLSGEIELIESRLFLGRVLDSS--DLNV
A0A385SFR9      --------FGIKPT-----VE----D--PNLNLLSGEIELIESRLFLGRVLDSS--DLNV
A0A5M4A9J4      PLEGSGGSGSLNAS-----DVFQGFGLFQGKQNLENQIQILQSWTLVSKAVNEM--NAEV
A0A5M4B1C7      PLDGSSSGTSFNAS-----DVFQGFDLFQGKQNLENQRQILKSWTIISDAVDKL--HDEV
A0A0D3LFR6      --------FGFVDS-----D-------KATMEGMSSEIELIKSKLFLNKVLSAL--DLDV
M7N6D4          --------LGYRSL-----DS----DPNQNMNGMSEEIELIKSKLFLTRVLKAV--DLDV
A0A4D7K1D4      -------------------LTFGVDPQKNNMNALSGEMELLRSKVFFSRLIDSL--DLDV
A0A5C7MX19      --------AQILGV-----EKIAVEQDNAA---INREIQLFKSRLLVERIVDSL--PLEM
A0A1Q3ZMZ7      --------KEVLEL-----ENINSKKS------LSSNIELLKSPVLFENAIKKL--DLAV
A0A2D8JJW3      --------AKMPGF-----EA--FSDDKK----LEDKIRNIGLRPIAQATIDKLSEPVNS
A0A2W2AFF7      --------GNMDGK-----QLLEDLGFLSGKGNVDNEVEIFKSRSLMESVVRDM--QLNV
R7PCR1          MGRAGRGANMLLEL-----NGVSVGNS------LQDETFILQSYRLMERVVSRL--GLDV
A0A2N5YXE2      --------NQILGI-----NAGVMETD------LAPVIELVRSNEFLKTVVASL--PLDV
A0A1G9E2A9      --------L-----------FGRNSDLGSQVENITGEIEFIKSRLVYNRVIDSM--DLAV
A0A098LL25      --------LGLNK-------FNDENMPGNKLSTISGEIEFLKSRYLYEKIVDRM--KMNV
A0A6J4H627      --------LGISD--------------NDGMANMSGEIELIRSKLIYDEVIRRM--DLAV
A0A6C0GJI1      --------LGLNGV----------NAVEDMSANLSGEIELIRSKLIYDEVIKRM--DMSV
A0A2T2YJE8      --------LGLGG----------TIENQQTLSNLSGEIEIIKSNFTFERLQQKL--PLDI
A0A7L7LEW0      --------LGLGG----------TIENQQTLSNLSGEIEIIKSNFTYERLQEKL--PLDI
A0A127B287      --------LELPGA-----------GMESDLGKLQGEVDLIKSDLVYDRLKKSM--PLQV
A0A6P1P2P6      --------LELPGA-----------GMESDLGKLQGEVDLIKSDLVYDRLKKNM--PLQT
A0A3M9N829      --------LGL---------ESNGLPIEAGAGKLQGEVDLIKSDIVYERLKKTM--PLQV
A0A0P0CSF9      --------LGL---------QNSGLKVESGIGQLQGEVDLIKSNIVFERLKKTM--PLQV
A0A5M8QQB8      --------LGL---------ENNGLKVESGIGKLQGEVDLIKSNIVFERLKETM--PLQV
A0A3M9MNC3      --------LGL---------ENNGLKVESGIGKLQGEVDLIKSNIVYERLKKTM--PLQV
A0A5B6TAX2      --------LGL---------ENNGLTVESGVGKLQGEVDLIKSNIVYERLKKTM--PLQV
A0A7L5A132      --------LGLESA-------GKAVDARQSSKNLAGEVELIKSSVIYQRLRDSL--DLDV
A0A512AYT3      --------LGLGGP------MGDAASSQQSMASLSGEVELIKSDLIYENLKRRL--NLNV
A0A5M6CYN7      --------LGLGGP------LSD----QQAISSLSGEIELIKSDLIYENLKRRL--NLNV
A0A369QP10      --------LGLDG----------TIENQQNLSNLSGEIEIIKSNLTYERLQQKL--PLDI
A0A7G7G7M4      --------LGLDG----------TIENQQTIANLSGEIEIIKSNLTYERLQQKL--PLDI
A0A126PDF2      --------VGLGGQ------LAAA-DPR-ASSKLAGEVQLIKSEIIYKELRDSL--DLYV
A0A2Z3GKA1      --------VGLGGQ------LAAA-DPR-ASSKLAGEVQLIKSEIIYKELRDSL--DLYV
A0A502GZP7      --------VGLGGQ------IAAA-GPSVGASKLAGEVQLIKSEIIYKQLRDSL--NLNV
A0A519SBU8      --------VGLGGL------ADA---DARNGAQLAGEVELIKSNLTYKNLKERL--ALDV
A0A4Q3JNZ3      --------FGIGGI------KG-----EP-GNQLAGEVELIKSNLTYQHLKERL--ALDV
A0A519Q9V3      --------LGLGAA------KGG---DSP-SNQLAGEIELIKSNLTYQHLKERL--ALDV
A0A0M3RW20      --------LGLGGG------LAGP-EGPLSMNNLSGEVELIKSNLIYRQLRDSL--ELDV
A0A495VFX4      --------LGLTGK------LAVA-EGPLSMNNLSGEVEFIKSNLIYRQLRDSL--ELDV
A0A418R9X5      --------L-LGG-------IGQAAEQKQTLNKLSGEVELIKSDIIYRRLKDSL--TLDV
A0A428JSJ3      --------L-LGD-------VGQAAEQKQNLNKLSGEVELIKSDIIYRRLKDSL--ELDV
A0A428KI59      --------L-LGD-------IGQAAEQKQTLNKLSGEIELIKSDIIYRRLKDSL--ALDV
W8F1I6          --------L-LGD-------IGQAAEQKQTLNKLSGEIELIKSDIIYRRLKDSL--ALDV
A0A246FQC0      --------LGLGA-------LGGAIDQKKNLNSLSGEIEVIKSDIIYQRLKDSL--DLDV
A0A372E5P8      --------LGLGG-------LGGAVEQKQSLTKLSGEVELIKSDIIYSRLNDSL--ALDV
A0A1H3EMW1      --------LGLGG-------LGAAVEQKQSLNKLSGEIELIKSDIIYRRLNDSL--ALDV
A0A1H9ZSN3      --------LGLGS-------LGGAVEQKQSLTKLSGEIELIKSDIIYSRLNDSL--ALDV
A0A1S9B3W0      --------LGLLPP--------GAADPRQSMSQLAGEVELIKSDLIYTRLRDSL--PLDV
A0A1W1VRL3      --------LGLGA--------GGSVEKRRPGANLEGEVELIKSNLIYRRLKDSL--ALDV
A0A7G6YQJ9      --------LGLGG-------VGEGMEKKQSLNNLSGEVELIKSDLIYRRLKDSL--MLDV
A0A1M6R305      --------LGLGGA------LGEGVAGRQSISKLSGEVELIKSNIIYRRLKDSL--DLDV
A0A7G7W8X3      --------LGLGGA------LGETAGGRQNISKLSGEVELIKSNIIYRRLKDSL--DLDV
A0A4Z0PHK3      --------LGLDGP------LGQAV-GASSLNKLSGEVELIKSNIIYERLKDSL--ELDV
A0A2M9B9H9      --------LGLDGP------VGQAV-GSSNVNKLSGEVELIKSNIIYQRLKDSL--ELNV
A0A4Z0QCY9      --------LGLDGA------LGQAV-GASSLNKLSGEVELIKSNIIYQRLKDSL--ELNV
A0A5N1J2M4      --------LGLK--------LGESDKQRVGTNQLSGEIELLKSNLIYEKVRQSM--NLEV
A0A519S476      --------LGL-A-------SVKALDNTQPANQLAGEVELIKSKLTYQALKERL--ALDI
A0A4Q3JRW8      --------LGFGA-------AVKGEEGANTTNQLAGEIELIKSNLTYKNLKDRL--ALDV
A0A519M923      --------LGLGG-------AAKGADDGRPGAQLAGEVELIKSNLTYQHLKERL--ALDV
A0A4Z0ENW1      --------LGLG--------MAMGGGDNNQASQLAGEVELIKSGLTYKRLKQTV--ALDI
A0A519UDB4      --------LGLG--------ELTGRGNDNNSSQLSGEVELIKSNLTYKRLKQVV--PLDI
A0A3S0QKV1      --------LNLPGL--------VANP-QQNVNKLAGEVELIKSDLIYSRLRDSL--PLDV
A0A328BL48      --------LGLLAA--------GAQAGQQGMSKLSGEVELIQSDLIYTRLRDSL--ELDV
A0A5R8WLY4      --------LGLLSA--------GAQPGQQGISKLSAEVALIQSDLIYTRLRDSL--ELDV
A0A1I5WSL8      --------LGLAGQ------MAPAAADKGRGGKLAGEVEVIKSNIIYRRLKDSL--ALDV
A0A0U3JVM7      --------LGLAGQ-----AAAPAVMDKGR-TKLAGEVELIKSNIIYRRLKDSL--ALDI
A0A1G1SSV2      --------LGLGGQ------GAPAVVPNGR-TKLAGEVELIKSNIIYQRLKDSL--ALDV
A0A1G1SXV7      --------LGLGGQ------GASAALPNGR-AKLAGEVELIKSNIIYQRLKDSL--ALDV
A0A6G8CBJ6      --------LGMGP-------VGGAVEKRQELANLSGEVELIKSNLIYRRLKDSL--ALDV
A0A0W8EDI5      --------LGLGG-------VGGSAEAQQNAKNLAGEVELIKSNLIYRKLQDSL--NLNV
A0A3B7RBP8      --------LGLGA-------VGGAAEAQQNSKNLAGEVELIKSNIIYRKLQDSL--NLNV
A0A3R9P8H7      --------LGLGG-------LGGAVEQKQNLNKLSGEIELIKSDIIYRRLKDSL--TLDV
A0A238WIA7      --------LGLEG-------LGKMVEQKQTVTQLSGEMELINSDLIYRRLRDSL--ELEV
A0A212UCJ7      --------LGLEG-------LGKMVEQKQTMTQLSGEIELIKSDLIYRRLRDSL--DLEV
A0A4Z0MQE1      --------LGLEG-------LGK----APSTSQLSGEIELIKSNLIYRRLRDSL--DLEV
A0A4Z0PCF4      --------LGLEG-------LGKMVEQKQTIAQLSGEIELIKSDLIYRRLRDSL--DLEV
A0A6M6BED0      --------LGLEG-------LGKMVEQKQTIAQLSGEIELIKSDLIYRRLRDSL--DLEV
A0A5D6VDG1      --------LGLG--------LGAGAEARQNMNNLSGEIELIKSNLIYRQLKDSL--DLDV
A0A243WHR7      --------LGLGGA------LTGDI--RQSGNKLSGEIELIKSNIIYEHLKDSL--ALDV
A0A5B8A0P6      --------LGL-GA------LGQG-DGRQNINKLSGEVELIKSNIIYRRLKESL--ALDV
A0A076HRT9      --------LGLGGA------M-KEAEGRQSLNKLSGEVELIKSNIIYRRLRDSL--DLDV
A0A4Z0PVM7      --------LGLDGP------LAQAVGS-SSLNKLSGEVELIKSNIIYQRLKDSL--ELNV
A0A1M6DHW8      --------LGLSGT------MGKGIEERQSINKLSGEVELIKSNIIYRRLKDSL--DLDV
A0A4Q5LC61      --------LGLAGP------LGKGIEEQQTLNKLSGEVELIKSNIIYRRLKDSL--DLDV
K0XJ09          DMSAVLELNGGISG-----SG------------VENEIYILQSHQLMREVVGRL--HLDV
R5EUZ0          DMSAVLELNGGISG-----SG------------VENEIYILQSHQLMREVVGRL--HLDV
W0EQS0          DMSAILEMNGGVSV-----GS------------VDNEIYILQSHQLMREVVERL--HLDV
A0A1Y3WE15      DMSAIMELNGGISG-----SG------------VDNEIYILQSRQLMREVVERL--HLDV
A0A1Y4GUK3      DMSALLELNGGISG-----SG------------VENEIYILQSRQLMREVVERL--NLDV
A0A2U1FKU2      SGG-----LSQFQD-----LG-LLMGNSE----VENELLVFKAKRLTAIVVDKL--NLDL
A0A0A2F954      TSG-----LQQFQE-----LG-LMTGNSE----VENEILLLKSKRLTAVVVDKL--DLDV
A0A0A2FW91      TSG-----LQQFQE-----LG-LMTGNSE----VENEILLLKSKRLTAVVVDKL--DLDV
A0A2D2N2N1      TSG-----LQQFQE-----LG-LMIGNSE----VENEILMLKSKRLTAIVVDKL--DLDV
Q7MWZ2          TSG-----LQQFQE-----LG-LMIGNSE----VENEILMLKSKRLTAIVVDKL--DLDV
T2NDT6          TSG-----LQQFQE-----LG-LMIGNSE----VENEILMLKSKRLTAIVVDKL--DLDV
W1R7P9          TSG-----LQQFQE-----LG-LMIGNSE----VENEILMLKSKRLTAIVVDKL--DLDV
A0A1R4AFZ0      TSG-----LQQFQE-----LG-LMIGNSE----VENEILMLKSKRLTAIVVDKL--DLDV
A0A1R4DVZ7      TSG-----LQQFQE-----LG-LMIGNSE----VENEILMLKSKRLTAIVVDKL--DLDV
A0A7C0WKI7      --------NTLFGV-----TP-FGKQMTE----INNQVEILKSRSLAGKVVDDL------
A0A2A8CVM9      --------QSGPGG-----MG-AFGQQRD----LASEVGVLQYSAELASRVVAELRATES
A0A5M4B212      LTTPTDSEANVFQG-----FG-LFQGTQN----TENQIQILKSWTQIRKTLEHF--NFEV
A0A3D1KEX9      KYANNSALNALKQL-----NGVQVTDN------LKNEIFILQSRRLMEMVVERM--NLDV
A0A358Y7S2      --------RDILGK-----DALNVEKALN----LNQEVELLRSELLINKVIEKL--GIHT
A0A1X7J248      --------ASVFGF-----NP--LSEESSNLNTLSGEVELIRSKLFLKQVINKL--PLDV
E4TQD2          --------ASVFGF-----NP--LKEENSNLNTLSGEVELIRSKLFLKQVIDKL--PLDV
A0A2J6HHN3      --------QMLFET-----KN-LYDED------IYRKIEVMRSPVFIRRVVSRL--PLDV
A0A1Y3WMT8      GGGALSSLVGDVTG-----GG-FSLDGMIGGGSVNDEILVISSHTIIREMVQRL--ELNK
A0A1Y4GQU1      SSGSLSSLMSGVSG-----GG-FSLDGMIGGGSVNDEILVISSHTIIREMVQRL--ELNK
A0A6A0R272      --------TDFLAI-----DM--FSESFNQYNKILTEARIISSRTMIEKALEKL--PLDV
A0A1V5W8T5      --------EDLLKI-----DN--IYGQTS----ITNLIELIRSREFLKRTLHKL--NLYT
A0A2T8HKA9      NVTARFTRSSMMNT-----VS------------VASEILQLKSKELMRHTIATI--QGDI
A0A2I0QZ80      --------ADLLDL-----SD--VRTEGS----IAKEIELLRSQLLFKKAIKQL--PLQI
A0A3E1F1A3      --------ADVLGF-----AE--ARSDGS----IAKEIELLRSQMLFEKAVQNL--PLTV
A0A2U2XBJ3      --------ADVLDF-----KD--IRKEGT----IAKEIELLRSQLLFEKAVADL--PLTV
A0A4Q4KU94      --------ADLLDF-----KD--ARKDGS----IAKEIELLRSQLLFEKAIDDL--PLNV
A0A3B8INU3      --------ATLFGF-----SN---FNENPNLNYLSGEIELLKSRLFFSQVISAL--PLQV
A0A2W1NDY9      --------QRILEF-----KD--FNTENN----LSADVELLRSPFLMEKVLMNL--NLKI
A0A5C8AQR5      --------KDVLNM-----EN--INSKSN----VSSEIELLKSQFLFEKAIDKL--NMNV
A0A1G0CI31      --------KEIVEI-----EN--INTKDN----IASEIELLRSELLFGMAVERL--HMNV
A0A556N0M0      --------KELLEL-----DN--INKIDD----ISSEIELLRSQLLFEMAISKM--NMNV
F2IKD6          --------KQLLEI-----DN--INKRID----ISTEIELLRSQLLFDMTIARM--NMNV
A0A1I7BM74      --------ANVLDL-----KN--VNNDGN----ISKEIELLRSQFLFEEALKRL--NLEV
A0A2G2FJ17      --------ADVLDF-----KN--IKEDAS----ISREIELLRSEYLFEKALDRL--DLQV
A0A2E3R1D0      ADVLPEAMP----------SG-FWRQERN----LSNELLVLDQSMPLAEAVAAR------
A0A2T2USC0      SSILGEQGSSF--------SP-FGSQ-NN----LANEVLVANQSEAITRNVATR------
A0A2T2V0F3      SSILSESG-SM--------NP-FGSR-RN----LANEVLVANQSEAITRNVAVR------
A0A2T2S682      SAVPSLTGGRSSGA-----SA-LGGQRRS----LSNQILVINQSEALAQEVAVR------
D5H561          GTESAIGAQAQAQG-----SG-LLPSSSS----LRNELMFLRNSQALRERVAER------
A0A2H3NWA9      TLVS--TRGRM--------VP-GLAGNRS----LSNQLFVLRQSRELAQRVADR------
A0A2A8CVB6      GVVAQLSSRGL--------SP-YSAESRT----LQNELFVLQQSMTIPNRVADS------
A0A2P6C1S6      SVLSGLGRGRT--------SP-FLQQDQT----LQNELLILRQSRTIANRVARQ------
A0A2T2UTM4      SVLSGLGRGRR--------SP-FGQRDQT----LQNELLILRQSRTIARRVAKR------
A0A414ZBF2      NMGESAAFRDVFSL-----GN----------SKVDNEMGFFKSKRLMMEVTRQL--RLDV
A0A1Q3Q573      --------TQILGI-----DNLVFEKDPTE---INREMQVLKSTMLLGKIADKL--PLDI
A0A662BAY3      LTNKNANEDNVFQG-----FG-ITDSDRN----IFNQLIVLTSTPILNRTLEEL--DFDI
A0A4U3L369      GSSSLSASSGIFQD-----LGGAFSMAST----VNNEEEILLTRSLMYRVVKDL--QLNV
A0A357YNR3      --------GGASEV-----TTFREMGIVSRRNNADNEVEILKKTMIVEKVVRDL--GLYA
A0A5E8AX52      --------AVILGV-----QNPLENSGVNS---LSGEIELLKSNLFFSRVVEAI--NYNV
F4KK08          --------SAIERL-----AQ-FTGDKHSYSDDVSNQIIILGTERVVSETVRRL--GLDV
A0A6B5PK86      --------KNVIDV-----EN-INSKKDV----FFSEVELLRSELLFKQAMNSL--AMNV
A0A2G2F510      --------KEVLDF-----QN-LGSRDNQ----LSGVVELLRSELLFKRAVKSL--SLNV
A0A316JZ08      --------ADVIDF-----EN-INTLDDD----ISAVVELLRSELLFERAVDKL--NMSV
A0A496LCF9      --------SYMQNM-----TQNFGVVDKTN---IENQILLLRSQDLIARTIDSL-PQFSI
A0A5P2G2A9      MSGMLGSSSSGSNS-----SFGDLSSLLNVKSSVDNELLILQTRDLMHKVVVDM--HLNV
A0A3C0ZQC7      Q-------MPLFDV-----TGIGAVKN------IKNELEILKSRSLAEAVAVRL------
A0A3N2N6F7      SSQSI---TSALSD-----MG-LFTTSTN----VANELLAFQSPALIGDVIERL--GLRA
A0A419VXB7      -----------VDL-----QNIFSSSPLKSDVKLSNHIEILKSFSLNYEVLENL--GWNV
A0A0B0BTJ4      SNSDL---TGFMPG-----RM-MYRTNSG----VEDELLIMGSRSIMERVVAEL--DANI
A0A3B9CNN6      SNSDL---TGFMPG-----RM-MYRTNSG----VEDELLIMGSRSIMERVVAEL--DANI
R5X290          SNSDL---TGFMPG-----RM-MYRTNSG----VEDELLIMGSRSIMERVVAEL--DANI
A0A1Q6E6I7      SNSDL---TGFMPG-----RM-MYRTNSG----VEDELLIMGSRSIMERVVAEL--DANI
C3J7R8          --------NVLSEL-----FESSALTSLGGRSAVENELFILKTDFLIDQVIERL--NLDV
A0A1G8BVM8      GGI-----SEAAAF-----QDMFSMGSNS----VYNEMGILKSRQLMLQVVEQL--GLET
A0A1I1FXP9      GLL-----SRVYSA-----TG-EEMQSSN----LSGEIELITSFMLYNKVIDKMGENIHI
A0A4P7VVU7      SQGV----ASALSD-----IG-LFQSSAN----VNNEMLAFQSPAIIADVIQRL--GLQT
A0A2V1ILM4      SQGV----ASALSD-----IG-LFQSSAN----VNNEMLAFQSPAIIADVIQRL--GLQT
A0A3N2L0E8      SQGV----ASALSD-----IG-LFQSSAN----VNNEMLAFQSPAIIADVIQRL--GLQT
A0A3N2LFC5      SQGV----ASALSD-----IG-LFQSSAN----VNNEMLAFQSPAIIADVIQRL--GLQT
A0A7K3KWJ8      SQGV----ASALSD-----IG-LFQSSAN----VNNEMLAFQSPAIIADVIQRL--GLQT
A0A3N4H5N3      --------TTVAES-----SVLNELDNLKTSIKLENEIEKLKSKSLMNEAVISN--KAFI
A0A2P8EAX2      --------GNLTES-----PILSDLENIKTTVKLDNEIEKLRSKSLLNEAVISK--SAFV
A0A4V2F6N9      --------GNLTES-----PILSDLENIKTTVKLDNEIEKLRSKSLLNEAVISK--NAFV
A0A3B9FXJ0      --------SSSLDF-----ADILRPGNVDR---LNEEMTVITSKSYKYNALQEL--PIEI
R5GSU5          GSRRMPSNMNALLE-----LN-GITAGDQ----LQNEIFILQSHRLIERVVTRL--KLDV
A0A2A3UE91      --------DDILKL-----NS-LSNNGNV----LAEAIEQIRSKVFLKRVVEKL--DISV
A0A0A2G557      GPL-----ADIMKI-----SG-TDIGGIKGNDKIENEIIIFRTERLLSRVIDEL--NLRV
A0A2N2WFW8      --------QKLFES-----KN-FYDED------IYRKIEIMRSPVFMERVIEKL--PLDV
A0A1F3IU95      --------EKLFDN-----KT-YYEDD------IYRKIEIMRSPVFMQRVVSNL--PLGV
A0A3D0VUF6      --------EKLFDN-----KT-YYEDD------IYRKIEIMRSPVFMQRVVSNL--PLGV
A0A1T4PT95      GPLADI--MKISGA-----EL-GFKGTDK----IENEIIIFRTHNMLSQVVNRL--NLRV
A0A6I6JYY3      PLEESGVSANVFQG-----FG-VMNSMRN----IFNQMVIMHSTPLITRTINEL--DFEI
A0A2A4PYG9      --------QKVLNV-----EN--IYEQ-D----VAGEIELIRSRAFLSNALSRI--DLGI
A0A1F3K695      --------DKLLNL-----ES--VYENTN----LAHVVELIRSKEFLKRAFEKL--PLSI
A0A353KZR1      --------DKLLNL-----ES--VYENTN----LAHVVELIRSKEFLKRAFEKL--PLSI
A0A2N2WYB5      --------TRLLNI-----ED--VYQNDD----ISKVIELLRSKEFLKRAFSNL--PLQV
A0A1F3K4G0      --------TKVLKI-----ED--VYQDND----ILKVIELLRSKEFLKRTFLKL--PIQI
A0A356H8Y3      --------TKVLKI-----ED--VYQDND----ILKVIELLRSKEFLKRTFLKL--PIQI
A0A351HSA6      --------TKVLKI-----ED--VYQDND----ILKVIELLRSKEFLKRTFLKL--PIQI
A0A1F3Q014      --------SKLLNV-----GN-ITEPDNG----LAEGIELLKSKVFLKRVLSQL--PLQA
A0A2D5KD44      --------NRLLDV-----ED--YYESND----ISSEIELLKSPLLMEATLEKL--PLQV
A0A6N9NIX1      --------NQLLEV-----QG--FNETGD----ISGEIELLKSKYLILKTIENL--PMEV
A0A2A4YXP3      --------SSVLNV-----GG-GFKESNS----LAKDVEILRSKLLFKRALRKI--PIDV
A0A1F3R158      --------DQVLKV-----DN--FEEKED----VEKDVELLKSKFLLKRALSKL--PLNV
A0A2M8ADX2      --------DQVLKV-----DN--FQEQED----VAKDVELLKSKFLLKRSLLKL--PLEV
A0A1J5B2H0      --------QKIFQT-----NNINVEEDNN----LAKQIELMRSSLFLNRVISKL--PLDI
A0A1V5N756      --------RQVFGK-----KT-----QVD----LAKKVELLNSSMFLSRVFSKL--PLDI
A0A651GU15      --------TKILQV-----NK-IYEEKT-----LSAELELLRSKLLLQETVKRL--PLKV
A0A3Q9FR88      DF------AEKFGI-----MN-NSLNDGK----LESEMALITSGVTYNRVIDSL-IDLTV
A0A553GEX3      DF------AEKFGI-----MN-NSLNDGK----LESEMALITSGVTYNRVIDSL-IDLTV
A0A150ADJ9      EF------AEKLGL-----MS-NSLNDGK----LESEMALITSGVTYNRILDSL-IDLRL
A0A1B1FWQ4      EF------AEKFGI-----TN-SSLEEGK----LESEMALITSGVMYERIVDSL-IDLSV
A0A1S1Z228      EF------AEKFGI-----AN-SSLEEGK----LESEMALITSGVMYERITDSL-IDLSV
A1ZKR2          --------VGMLGI-----KG-LIPGGSYSGGNLVGEIEFIRSQIIFNDVINAM--DLWI
A0A1Q3GX01      --------VQMLGI-----KQ-LITNNN-SNGNLIGEIEFIRSQIIFNAVINTM--DLWV
A0A349DQI4      --------VQMLGI-----KQ-LITSNS-INGNLIGEVEFIRSQIIFNSVIDAM--DLWV
A0A4P5TMD1      SLGIGVTSGGVNSA-----DQ-MDHNE------LQKNIQIMKSNVILDRVIDQL--PLSI
A0A2N3IIZ0      --------SAGLDL------R-IGLNQENPIDNIAGELEVIRSPLIYEEVLKNI--DLSV
A0A7K3WUF2      --------KQILNV------N-QFYEDNT----ILAEIELMKSKLLVTRVVKQL--PLEI
A0A1F3SJM1      --------KDVLNI-----DN-LNVRGDQ----LSSVVELLRSELLFERAIAHL--NLNV
A0A2G2EB96      --------KDVLDI-----EN-INSRDNE----ISSVVELLRSELLFERALNKL--NLNV
A0A2G6PRA9      --------KDVLNI-----EN-INSREND----MSGVVELLRSELLFEKALNKL--NLSV
A0A497D5Z2      PLSGNMNNGDVFQG-----FS-LMGSDYN----LFNQMAVLKSKPLIRRVVDEL--DFEL
A0A662B170      PLSGNMNNGDVFQG-----FS-LMGSDYN----LFNQMAVLKSKPLIRRVVDEL--DFEL
A0A2A5FYT6      --------SQILEA-----TP-AYLRQD-----ISGDIEFLRSKEFFKNILNTL--DLEV
A0A2E6SYP1      --------NQMMNF-----EN-IYETN------LVAEMSRLKSKKMLSEALADL--KLDV
A0A2E5RLE8      --------NQMMNF-----EN-IYETN------LVAELSRLKSKKMLSEALNTL--NIDV
A0A2E7TQF6      --------NQMMNF-----EN-IYETN------LVAELSRLKSKKMLSEALNTL--NIDV
A0A2E6GVY9      --------NQMMNF-----EN-IYETN------LVAELSRLKSKKMLSEALKTL--NIDV
A0A350JJ90      --------NRILNV------G-DIYEDAD----ISKDIELLRSPEFFKRVIANL--PVDV
A0A3M1CDV2      --------HQILQL-----NP-ANTEGNNK---VAEAIEQIRSKTFLERIINNL--NLQI
A0A6C1QGZ7      --------TRILPT-----AG-IYEED------IARQLELMRSDVFLQRALSRL--PLDV
A0A4P5U6G4      --------SKAIGL-----DN-IGLEASRGNADLQRDIQVMKSNLIMDRVLDKL--PLLV
A0A2E2TFD1      --------SQLLEI-----DF-GKNQNED----MMSDLEVIRSKEFLKTIFKKL--PLDI
A0A2E4ELE6      --------TQVLDL-----E--RMNEKAD----ISADIEIIRSKEFLKTIFAKL--PLTI
A0A522EYA6      --------SRILNV-----DN-FNEAQND----IAKSIELLRAKVFFKRVLATL--PLKV
A0A2E3XZI5      --------LEFMQM-----NP-LSSNSTN----LKSELAIIKSQKSILRLIKKL--KLNI
A0A6I7QXV0      --------AQILGT-----DE-LLRGDDD----VSREIQIIRSRLLVARALEHL--PLDV
A0A2M7NLQ9      --------SELLGR------G-IFSSDENVTNFLVGEIELILSRSVYEEAVKRL--DLNI
I4AFR0          --------SELLGK------G-IFASDENAINFLSGEIELILSRSVYEEAVKKL--DLSV
A0A2N2Y3E5      --------NKILNI------Q-NIYDEFN----PNQTIELIRSKEFIKRVIKSL--PLDV
A0A2D9D7T6      --------KEVLGK------D-AFTDRESADGGLSKYIELLKSEFIFEKAVERL--SLYT
A0A1F3PPL5      --------DKVLEI------E-NLREENT----IAQTIELLRSQEFLKRVFSKL--PIDI
A0A357QK06      --------DKVLEI------E-NLREENT----IAQTIELLRSQEFLKRVFSKL--PIDI
A0A662AEA4      --------QKILNI------E-DIYEKKD----ISNVIELLRSKEFLKRVFKKL--PLEI
A0A0S2HYK8      --------SQVFQL-----DD-LYEDNKK----LNKTIALIRSKEFLKRTFAKL--PLDI
A0A2N5ZWN6      --------TQVFQL-----DN-LYEDNKK----LSKTIALIRSKEFLKRTFSKL--PLET
A0A2E0FJ09      --------RRILNV-----KN-PLQEDET----LTGDVELLRSPLLMEKTVASL--PLQI
A0A1F3FZ62      --------NKVLQT-----AN-IYDGEND----ISKTVELLKSKVFLKRVFSKL--NFEV
A0A1F3K211      --------NKVLQT-----AN-IYDGEND----ISKTVELLKSKVFLKRVFSKL--NFEV
A0A1V6I2U9      --------NQILGI------S-SNLMEKD----LAPVIELIRSNEFLKTVVEVL--PLDI
A0A2H0B957      --------NKILNL------T-NAVEEIN----SIQTIELIRSKEFLKKTFNKL--PLGV
A0A1F3CFW6      --------NKVLNL------T-TAVEEIN----SMQVIELIRSKEFLKRTFNKL--PLKI
A0A2M7E2T8      --------NKVLNL------T-TAVEEIN----SMQIIELIRSKEFLKRTFNKL--PLKI
A0A2M7NC69      --------NKVLNL------T-TAVEEIN----SMQIIELIRSKEFLKRTFNKL--PLKI
A0A1F3KLL5      --------AEILGF-----KN-NFIKPSE----LPAVMELIRSNEFLKRVFVKL--PFEI
A0A359D1M1      --------AEILGF-----KN-NFIKPSE----LPAVMELIRSNEFLKRVFVKL--PFEI
A0A0F2NS19      --------NKVLQV------D-NFSKTED----VAKDVELLRSKLLLKRALSKL--PLEV
A0A2A5H8X6      --------NKVLQV------D-NFSKTED----VAKDVELLRSKLLLKRALSKL--PLEV
A0A2H0GAU8      --------NKVLQV------D-NFSQKED----IAKDVELLKSKLLFKRALSKL--QLKV
A0A2M8FTK1      --------NKVLQV------D-NFSQKED----IAKDVELLKSKLLFKRALSKL--QLKV
A0A2A5B3B0      --------SKVLEV------R-EFQETNS----LSKDVEILKSKLLFKRALKRI--PIDV
A0A5C6RXM7      --------NQVLNV------D-NFHENNT----IDKDIEILRSKLLFRRAISRL--PLAI
A0A1F3C1M2      --------NQLLNI------E-NVSDNNE----LAQIIELIRSTEFLKRTFNKL--PFQI
A0A1F3DS87      --------NQLLNI------E-NVSDNNE----LAQIIELIRSTEFLKRTFNKL--PFQV
A0A6A0R6K9      --------NRLLDV------E-DYYETND----ISAELEILQSNIIVERAIKSL--PLEV
A0A2E7CT70      --------DELLEI------Y-SFQQKTN----INSEVELLKSQIIIDKAIKKL--NENV
A0A2D5V560      --------NGFSDL------Y-SYNINTN----LNSEIALMNSEKAIEKVIRDI--ELKV
A0A2D7K5A8      --------NGFSDL------Y-TYNINTN----LNSEIALMKSQKAIDRVIEDL--NLKV
A0A2E1XQ82      --------NGFSDL------Y-TYNINTN----LKSEIALMKSQKAIDRLVEDL--NLKV
A0A5C8A5B4      SE-------------NSEFIKGTSYLSNS--VDLEDNLAVLTSNKIMTSTLQRL--DFGI
A0A7C1LGX3      LQSNAMS-----------------LFTNGSTINLDNQIEILTSYRILSEVVKEL--QLDV
A0A4Y9ITE2      FL-RSFS--------MADM------FGGK--SSVDDEIAIMYSHSLFSEIVKKF--QLNK
A0A5M8NYX7      AM-DMNT--------FSDL-G---FMPKI--GSFDNEIEVLQSKTLMKEVVDSL--NLRV
A0A0E3V905      SE-QSSS--------LKEL-G---VFAHK--QVVENEIEILRSFTLMNRVADKL--HLDV
A0A553ETH6      -A-NASE--------LGLV-N---FGENNNINVISGEIELIQSRLFFNKVIDNI--DLNI
A0A640Q161      KA-NVVS--------IEEV-Y---GLDTKRKDYMQTQYEILQSRQIAERTVESL--SLYN
A0A640QU49      KA-NVVS--------IEEV-Y---GLDTKRKDYMQTQFEILRSRQIAQRTVESM--SLYN
A0A1Q3PII2      FN-ESAL--------LEEL-G---LPNAT--SSVENEIEILRSRTLLSQVVADL--HLTT
A0A351BXT2      VL-SSSL--------IPEF-Q---DFITD--RYISNEIEVLKSYKIREMVAENL--IDTF
A0A2K8Z965      SE-QNNT--------LKEL-G---VFTPK--QVVENEIEVLRSFTLMNRVVEKL--HLNV
A0A418M8U8      NE-RDQP--------LKEL-D---AYVPK--KVVENETEILRSYTLMNRVVDKL--HLDV
I2GTA4          NE-RDQP--------LKEL-D---AYVPK--KVVENETEILRSYTLMNRVVDKL--HLDV
A0A2K8ZAJ2      IS-EQSA--------MKET-N---IFTQT--KLVENEIEILRSYSLMDRVVTNL--GLDV
A0A368JPA3      VS-SDGI--------LKDL-T---TYSPG--KVIENEIEILKSSSLMKKVVDSL--GLNI
A0A5N1JI29      VS-GDGI--------LKDL-T---AYSPG--KVIENEIEILKSNSLMKKVVDSL--GLNI
A0A7K0EGC9      LG-NDGV--------LKEL-N---IYSPS--KVVENEIEILKSNSLMKKVVDSL--GLNV
A0A3P1BT12      PS-DNGV--------LKEL-N---IYSPS--KVVENEIEILKSNSLMKKVVDSL--GLNI
A0A3P1CI15      VA-DEGL--------LKQL-H---IYSPN--KVVENEIEILKSNSLMKKVVDSL--GLNV
A0A4R8CUK1      ---DESI--------PADP-D---NRNQQ--TVVDNELEILTSNSLMKKVIDTL--GLNV
A0A3D0MYJ7      -K-QQSI--------LTGL-S---VPEGSAGSDIQSQIAIMKGYYVREIVAKSI------
A0A662AH13      IL-DAPL--------LPEF-S---SFGDD--RFIANEIEILKSYRLRTMVANAL------
A0A5C7QA01      -----AL--------LGDLSS---MIEQK--SPAQAEIEILRSRLVLGEVIGQL--HLDV
A0A3D3LS70      LL-TSNM--------IPGF-S---DYASD--RSISNEIEILKSQTIRSLTATAL------
A0A1G1TM36      ---ERSA--------LQEL-D---FANGN--NVLESEMEILRSRRLMQQVVQTL--GLST
A0A1G7ZF38      FH-ETAL--------LEEL-G---LPDAT--SSVENEIEILKSRTLLSQIISDL--HLTT
C6VS52          LH-ETAL--------LEEL-G---LPDAA--GSVENEIEILKSRTLLGQVVDDL--HLTI
A0A2A4G4B1      ---DELS------V-FDDLGM---VSGSA--STLEDEIQLFRSRPLIKQMVEKH--NLHI
A0A0P7X1V8      MAGSDLS------NLMVSNFG----IGMG--SSIENEIHVLQSRTFTGELAQRI---YDE
A0A6P1P355      ES-----------R-MTQSID---AFTSN--NIVENEIKVIQSRALARKVIDEL--GLYA
A0A5C8KAD6      DS-----------K-MTESID---AFITS--KIVENEINVIHSRTLMKQVVNKL--SLYA
A0A5N1J695      DP-----------R-MMEAID---AFASS--KLVDNEIKVIQSRGLMNKVVDTL--MLYA
A0A3N2M1H3      V--PDMA------GVFSSF-G---LVSSN--TSVYNELISLKSPAVMYEVARRL--HLDM
A0A4S2G8T2      V--PDMA------GVFSSF-G---LVSSN--TSVYNELISLKSPAVMYEVARRL--HLDM
A0A212K7W5      MLSDNIN------T-FSDM-G---LFKSN--TNINNEILTFKSPLLMQEVVQRM--KLDE
F5IU11          MLSDNIN------T-FSDM-G---LFKSN--TNINNEILTFKSPLLMREVVQRM--KLDE
A0A7C1QWC7      LESAER---------FSGL-A---ELDQS--RNLENDINSLRSFSLVSETIKKL--GLEI
A0A352Z1R7      ---------------LVDM-----TFDQS--NSIDAELEIIKSRTNIEQVAKRL--HLDW
A0A0A2F501      LS-LNDQ------FSFGDM-G---LLQSN--TNVNNELISIQSPTLTLEVVRRL--GLNV
R5B7P0          MP-GDIG------E-FGNM-G---LFAVK--SNVNNELHAFESPDIMSEVVARL--RLYM
R5B0L5          IS-DT----------FAEM-G---LVQTN--SNVNDEISKLQSPDIMLEVAKRL--SLDE
A0A6I1TEC0      IN-NDVE------SMFSDM-G---LGGTK--SNVNNELIAIKSPSVLLEVGKQL--KLNV
A0A3R5XWG1      IN-NDVE------SMFSDM-G---LGGTK--SNVNNELIAIKSPSVLLEVGKQL--KLNV
A0A5P0Y910      IN-NDVE------SMFSDM-G---LGGTK--SNVNNELIAIKSPSVLLEVGKQL--KLNV
A0A414YFM3      IN-NDVE------SMFSDM-G---LGGTK--SNVNNELIAIKSPSVLLEVGKQL--KLNV
A0A6A7UIA7      IN-NDVE------SMFSDM-G---LGGTK--SNVNNELIAIKSPSVLLEVGKQL--KLNV
A0A6A7VPS3      IN-NDVE------SMFSDM-G---LGGTK--SNVNNELIAIKSPSVLLEVGKQL--KLNV
A0A374THP7      IS-SDVS------SMFADM-G---LGNAK--SNVNNELIAIQSPAVLLETGKRL--KLDV
A0A6G1VND1      IS-SDVS------SMFADM-G---LGNAK--SNVNNELIAIQSPAVLLETGKRL--KLDV
A0A0A2EVS5      SL-AQDI------GGFADM-G---LFSKS--TNVHNELVSLRSPATLLEVIKRL--NLDI
A0A1T4NAJ7      SL-AQDI------GGFADM-G---LFSKS--TNVHNELVSLRSPATLLEVIKRL--NLDI
A0A255T941      S--NLIS------D-FADMGG---LFKSN--TNIKNELSTIKSPNLMTEVVKRL--RLNE
A0A4P7VSV0      AG-AED---------FGDF-G---LFQNK--TNIQNEITTLKSADLMEEVVRRL--NLDM
A0A7J0AX49      AG-AED---------FGDF-G---LFQNK--TNIQNEITTLKSADLMEEVVRRL--NLDM
A0A3N2KCL3      AG-AED---------FGDF-G---LFQNK--TNIQNEITTLKSADLMEEVVRRL--NLDM
A0A2V1IJY1      AG-AED---------FGDF-G---LFQNK--TNIQNEITTLKSADLMEEVVRRL--NLDM
A0A4P7VXK7      AG-AED---------FGDF-G---LFQNK--TNIQNEITTLKSADLMEEVVRRL--DLDM
A0A1Y4CHN5      IS-SDVS------SAFASM-G---LVQSN--TNVNNEVIALQSPAIMTDVVKRL--HLDV
A0A1M6I2S6      ST-T-MS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVRRL--GLNE
A0A1Y3V692      ST-T-MS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVRRL--GLNE
F3PXM2          TS-GSMG------E-FADF-G---LFKSN--TNINNELLTLASPTLMTEVVKRL--GLDE
A0A174AHH7      SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A174JCE8      SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A3E4JMC4      SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A412SND6      SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A414IEQ9      SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A7K0HNT3      SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A0M1W8D8      SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A3R6GKX5      PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A7V4S1          PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
B0NU19          PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
D4V601          PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A4Q0U3M9      PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A7J5G2G2      PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A7J5HH13      PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A397WLT5      PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A6A2J529      PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A6N8DDD8      PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A015XH67      PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A078RZN2      PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A6M4L7F4      PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A6L0K5          PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A7ACT5          PA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A6KY94          SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A173UQR8      SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A3R6HK75      SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A412B7D1      SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A412VNY9      SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A414LTU9      SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
I9Q4U4          SA-SAMN------E-FADM-G---IFKSN--TNINNELLTLKSPTLMTEVVKRL--GLNE
A0A373ISF0      SG-GAMS------E-FSDM-G---IFRSN--TNINNELFTLKSPALMTEVVRRL--RLNE
U6RF62          SG-GAMS------E-FSDM-G---IFRSN--TNINNELFTLKSPALMTEVVRRL--RLNE
A0A662ZZD5      ST-NVVS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A3A5TI83      ST-NVVS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A415NEB6      ST-NAVS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A7AJ60          ST-NVVS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A7J5MKN5      ST-NAVS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A6A2JF01      ST-NVVS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A7J4Y8G3      ST-NVVS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A015UXN7      ST-NVVS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A6I2NTL0      ST-NVVS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A6I2Q447      ST-NVVS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A016E4F9      ST-NAMS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A6N3HG44      ST-NAMS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A7K0HSP7      ST-NAMS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A7K1HEJ5      ST-NAMS------E-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVQRL--GLNE
A0A6H9P0U9      ST-SAMN------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLNE
A0A108TH71      ST-SAMN------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLNE
I8VXH0          ST-SAMN------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLNE
A0A412S0N6      ST-SAMN------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLNE
A0A412IIJ0      ST-SAMN------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLNE
A0A0P0FM97      ST-SAMN------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLNE
R6KTP3          ST-SAMN------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLNE
A0A139LU87      ST-SAMN------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLNE
A0A1C6B3Y5      ST-SAMN------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLNE
A0A6L3KCD1      ST-SAMN------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLNE
E2NMQ4          ST-SAMN------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLNE
A0A412YDB9      ST-SSMS------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVSRL--GLNE
R7DY01          ST-SSMS------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVSRL--GLNE
A0A414LGK8      ST-SSMS------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVSRL--GLNE
A0A415IPQ4      ST-SAMS------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLNE
A0A3E5BRW7      ST-SAMS------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLND
K9DXS6          ST-SAMS------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVNRL--GLND
A0A1M6KFV3      ST-NAMS------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVSRL--GLNE
A0A1Q6G7L3      ST-NAMS------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVSRL--GLNE
A0A413H235      ST-NAMS------D-FSDL-G---IFKSN--TNINNELLTLKSPTLMTEVVSRL--GLNE
A0A1M5B2J8      AS-TDME------S-FADF-G---IFTTN--TNVNNEMGTLQSPDLMREVVTRL--HLEM
A0A255RCT5      AS-TDME------S-FVDF-G---IFTTN--TNVNNEMGTLQSPDLMREVVRRL--HLDM
A0A1Y4GLF5      IS-SGME------T-FSEF-G---LFQSS--TNVNNELLAFQSPAVMTEVVKRL--QLGT
A0A1H3XSC0      VS-SDLE------S-FSEF-G---LFQSS--TNVNNELVALQSPAVMTEVVRRL--HLDM
A6LE40          VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A4Y1VPX5      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A6N2XMM4      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
B3JI46          VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A358R8U0      LA-SDVE------S-FGDL-G---LFQTT--TNVNNELLVLQSPSIMLEVVKRL--HLDM
R6WSB6          LA-SDVE------S-FGDL-G---LFQTT--TNVNNELLVLQSPSIMLEVVKRL--HLDM
A0A401LPX7      SS-ADME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
A0A6G0GNY9      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLQSPDIMREVVSRL--HLEM
A0A6I1BFM0      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLQSPDIMREVVSRL--HLEM
A0A3A5Z900      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
A0A7K0GW19      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
A0A285TGL6      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
A0A3A5RFX4      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
A0A1Q6IUW9      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
A0A413XDP6      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
A0A6N8CVT6      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
K6AP24          SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
A0A6I2NHV3      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
A0A078RYI7      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
A0A7I0QD01      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
C7XEQ8          SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
D7INX6          SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
K5ZG55          SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
A0A662ZYI7      SS-TDME------S-FSDL-G---LFTTN--TNVYNEMGTLKSPDIMREVVSRL--HLEM
A0A3N2N9B8      ---AGME------E-FSDF-G---LISTK--TDVENEIINLRSGELMEEVVSRL--KLDM
A0A3N2NMI0      ---AGME------E-FADL-G---LISSS--TSVANEITNLRSGDLMEEVVRRL--NLDV
A0A359I8H7      VA--DIS------NAFSSL-G---LVSSN--TNVNNELISLSSPAVMYEVVKNL--GLDV
A0A3N2KA63      VA--DIS------NAFSSL-G---LVSSN--TNVNNELISLSSPAVMYEVVKNL--GLDV
A0A4Q0IMT7      VA--DIS------NAFSSL-G---LVSSN--TNVNNELISLSSPAVMYEVVKNL--GLDV
A0A7J0B660      VA--DIS------NAFSSL-G---LVSSN--TNVNNELISLSSPAVMYEVVKNL--GLDV
A0A3B9FAU3      ---KDLN------AMFANL-G---QNPDQ--SNVNNEMAAIQAPSNVLETVKRL--NLDM
A0A3C1E5L7      ---KDLN------AMFANL-G---QNPDQ--SNVNNEMAAIQAPSNVLETVKRL--NLDM
A0A4Q0UAV1      TL--AMP------D-LSAL-G---ISNNS--GDLANEMIVIRSVDLLTDVVATL--DLNN
A0A354SN68      SI-GNTS------GIFNNL-G---IGKSY--MNTNDEVAIINSQTIALEVVQSL--HLEV
A0A6L5XFL0      IS-SQFG------Q-FSSM-G---IGKSN--TNLYNEMITLKSPTYMEEVVREL--HLDM
A0A3N2N595      PSMSVGG------DEFANM-G---LFQNK--TNIQNEMTTFMSSDLMTEVVKRL--KLDM
A0A7J0ACS3      ---SAGA------EEFANL-G---LFQSN--TNIQNEMSNLKAKDLMEEVVRRL--GLDI
A0A0A2DUD9      LS-NDMS------SAFSEL-G---LFQSN--TNVNNELLSMKSPMLMEEVVRRL--ELWT
A0A3P1ZBJ5      RS---VE------QQLSQL-G---LFE-N--TSVSNEILSFQSPALMEDVVKRL--HLDI
R5FHS9          VSIDDIF------SSASSG-G---ISTNS--NYVNNELIALQSPSIMLEVVKRL--GLNV
A0A413TW79      IN-SDVA------SMFSDM-G---LSGGK--SNVNNELIAIQSPAVLLEAGKQL--KLDV
A0A7K0AAG2      IN-SDVA------SMFSDM-G---LSGGK--SNVNNELIAIQSPAVLLEAGKQL--KLDV
A0A7K0ASF1      IN-SDVA------SMFSDM-G---LSGGK--SNVNNELIAIQSPAVLLEAGKQL--KLDV
A0A3E5E9M7      IN-SDVT------SMFSDM-G---LSGGK--SNVNNELIAIQSPAVLLEAGKQL--KLDV
A0A3E4SK73      IN-SDVA------SMFSDM-G---LSGGK--SNVNNELIAIQSPAVLLEAGKQL--KLDV
A0A415GGC6      IN-SDVA------SMFSDM-G---LSGGK--SNVNNELIAIQSPAVLLEAGKQL--KLDV
A0A413DBH9      IN-SDVT------SMFSDM-G---LSGGK--SNVNNELIAIQSPAVLLEAGKQL--KLDV
A0A495WI87      LS-ADAG------S-FADL-G---LIQAN--TNVNNEIISLQSPAIMTDVVKRL--HLNM
A0A354M4S6      LS-ADAG------S-FADL-G---LIQAN--TNVNNEIISLQSPAIMTDVVKRL--HLNM
R7DH52          LS-ADAG------S-FADL-G---LIQAN--TNVNNEIISLQSPAIMTDVVKRL--HLNM
A0A7J5IAE7      VS-SDMD------A-FSDL-G---LFQSG--TNVNNELIAFQSPALITEIVKRL--RLDM
A0A016CWA4      VS-SDLE------S-FSEF-G---LFQSN--TNVNNELIAFQSPALMTEVVKRL--RLDM
A0A4P8LP09      VS-SDLE------S-FSEF-G---LFQSN--TNVNNELIAFQSPALMTEVVKRL--RLDM
A0A0M1W0V2      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A139KA16      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A174VQ92      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A1Q6HCG0      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A1Y4JYM9      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A3A5QW67      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A3A5RQE6      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A3A6BP07      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A3E5E153      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A3Q9IP20      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A412WV15      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A413ICP6      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A414KYB9      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A5B3FWR2      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A7J5QHB9      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
E5WX00          VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
K0X3P3          VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A1C6H117      VS-PDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRF--RLDM
A0A6I1AQV4      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A5C6L2P1      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A412MJT7      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A3E4WKT5      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A3A5YY33      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A1E9CFZ7      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A373FYU5      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A3A5TZ72      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A3A5XBP2      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A3A6MEG9      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A3E4JP35      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A3E4KP40      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A3E4NX82      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A3E4XFU8      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A412RG70      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A412TD37      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A413GAA4      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A414M7I4      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A496BTA0      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A496D2V6      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A5C6KCA6      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A5M5AHM5      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A6I0Y5K7      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A6I1BFB8      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A6I2P5W5      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A6N8DC51      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A7J5HGP0      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A7J5HVL8      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A7J5JHD3      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
E5UZA2          VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A069SMG6      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
C3RFN5          VS-SDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A3A5Z014      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--HLDM
A0A7J5GD93      FS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--RLDM
A0A7K0HGR5      FS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--RLDM
A0A078S3Q8      FS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--RLDM
A0A069SJV7      FS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--RLDM
A0A3E5DXI5      FS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--RLDM
A0A3E5EM98      FS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--RLDM
A0A6N2YYD4      FS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--RLDM
I9T3G6          FS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--RLDM
A0A3E4SYU0      VS-SDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRL--RLDM
A6LGY1          VS-SDLE------S-FSEF-G---LFQSS--TNVNNELITFQSPALMTEVVKRL--RLDM
K5ZSH4          VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A6A2RTB3      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A7J5PEN4      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFRSPSLMTEVVKRL--RLDM
A0A1M4YZ07      VS-SDLK------S-FSEF-G---LFQSG--TNVNNELITFQSPSLMTEVVKRL--RLDM
A0A7J5I238      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A0P0FQW1      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A7K0I229      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A5M5C0W6      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A642NJ89      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A6L3JTQ2      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A7J5FQU6      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A7J4YLH7      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A6N3AEV2      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A6G0G4T5      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A6L3KG29      VS-SDLE------S-FSEF-G---LFQSG--TNVNNELITFQSPALMTEVVKRL--RLDM
A0A1Y4PQK7      IA-SDIE------G-FDNF-G---LFRSA--TNVNNELIALQSPSVMTEVVKRL--HLDM
A0A1Y4IH41      IS-SDIE------G-FDNF-G---LFRSA--TNVNNELVALQSPAVMTEVVKRL--HLDM
A0A3A6AAP4      IS-SDIE------G-FDNF-G---LFRSA--TNVNNELVALQSPSVMTEVVKRL--HLDM
A0A6I0ZRD2      IS-SDIE------G-FDNF-G---LFRSA--TNVNNELVALQSPSVMTEVVKRL--HLDM
A0A7L4SP06      IS-SDIE------G-FDNF-G---LFRSA--TNVNNELVALQSPSVMTEVVKRL--HLDM
A0A1Y4DYA7      PS-GN-A------GVLYDL-D---LFQTG--TNVNNEIQSLQSPAVMYDVVKRL--HLNI
A0A1Y3X4I9      LS-NS-A------GVLGDL-D---LFQTN--TNVNNEMQSLQSPAVMYDVVKRL--HLNI
A0A1Y4FNK8      MS-DA-A------GVLGDM-N---LFQTS--TNVNNEIQSLQSPSVMLDVVKRL--HLDI
A0A355FD59      MA-GDVS------SLFSDL-G---LSQAN--VNVNNELIAIQSPAVILETIKRL--HIDV
A0A359CEZ9      MA-GDVS------SLFSDL-G---LSQAN--VNVNNELIAIQSPAVILETIKRL--HIDV
A0A353Q7B4      MA-GDVS------SLFSDL-G---LSQAN--VNVNNELIAIQSPAVILETIKRL--HIDV
F8X3A5          IS-SDVA------SMFADF-G---LSQPN--TNVNNELIAIQSPAIILETVKRL--HLDV
A0A1M3KVR9      IS-SDVA------SMFADF-G---LSQPN--TNVNNELIAIQSPSIILETVKRL--HLDV
A0A4Y9IJS3      IS-SDVA------SMFADF-G---LSQPN--TNVNNELIAIQSPSIILETVKRL--HLDV
A0A1H4ADG3      PQ-SNGI------S-SLQSLG---LFPGA--SNVDNERDILVSYPLIHQVVSDL--QLYL
A0A5B8VUR8      PQ-NNGI------G-SLESLG---LYPRS--STVDNEREILVSYPLIHQVVTDL--QLNL
A0A0D3L8Q3      -L-TESA------V-FNDIPG----FKSH--TNIDNEIRLLKSQSLMHRVFNEL--DLDV
A0A7G7G5F9      -A-AKSD------A-FNDLDI----FAST--KNIHNEIEVLKAKSLMQRVLTEL--SMDA
A0A2N3U785      -V-YENS------F-FSELGI----FQTN--QSINDEIELLKSISLMQRVVKDL--SLYV
A0A5B6TJH8      -I-SGAG------T-FSDLDM----FNST--KVVDNEILILDSKTLMERVVQDL--DLFT
A0A519U664      -L-SNAD------A-LSDLTT----FKST--RSIDNEIEVLRSASIMERVAKEL--DLFT
A0A519MA34      -L-SNAD------A-LSDLTT----FKTT--RSVDNEIEVLKSASIMERVAKEL--DLFT
A0A519UCX0      -L-SSAD------A-LSDLTT----FKST--RSIDNEMEVLKSVSIMERVAKEL--DLYT
A0A0E3ZG78      -L-SNES------A-FSDLEI----FQAT--KNINNEIEVLQSESLMKRVASEL--SLFI
A0A1I6BRK6      -L-SNAD------A-LSDLNT----FKAT--RNVDNEIEVLKSKGLMERVIREL--DLVT
A0A243WAB1      -V-SNAE------A-LSDLTM----LKSA--RNIDNEIEVLRSESLMEKVVSEL--NLVA
A0A6G8C8X6      -L-ANAD------A-FSDLPA----FKST--RNIDNEIEVLRSKTLMERVVNEL--GLFT
A0A416GA42      TP-SEAE------I-FKEV-G---FMNLS--GNVENEILIFKSLHLAEQVVRRL--DLDV
A0A1T3IYP5      AR-ITRS------S-VANVVS------------VKDEIIQLKSKELMRLVVDKV--GADK
A0A1T5K9D4      ---SNTR------A-TTKL-DNYSNLINS--VSMSNEMLQLKSKTLMAEVVKDL--NIDV
A0A077ENE7      ---SNTP------T-TARI-TR-SFGANT--ISVKDEILQLKSKELMRLVVDKV--HADK
A0A7H1Z2Z7      ---SNTP------T-TARI-TR-SFGANT--ISVKDEILQLKSKELMRLVVDKV--HADK
A0A6I5UW06      ---SNTP------T-TARI-TR-SFGANT--ISVKDEILQLKSKELMRLVVDKV--HADK
T0NN57          ---SNTP------T-TARI-TR-SSVASS--VSVKDEILQLKSKELLRQAIDRT--GSDI
X5K347          ---SNTP------T-TARI-TR-SSVASS--VSVKDEILQLKSKELLRQAIDRT--GSDI
A0A060RD97      ---GEAA------I-FADLGL---LSSTS--SLVDNEIFILRSASLMRTVVQKL--DLNV
A0A3C1ITV0      QI-SELA------A-FADL-G---IGSTG--IDVYNELQAFQSPLLMQDVVNQL--RLNV
R7HN19          QI-SELA------A-FADL-G---IGSTG--IDVYNELQAFQSPLLMQDVVNQL--RLNV
A0A350IHV0      -M-KELA------S-FTNAMS--LRRNSG--ANVYNEMESFTSPDIMSVVVDRL--GLEA
R5RVP0          -L-RDLASFTGGVR-YRSMNG----------SNVYNEIEAISSPDIMQTVVKRL--GLET
R6A0L2          GL-RRTSKNSGMNT-LLELNG----VSVG--DNLKNEIFIISSKRLMSRVVDKL--NLDV
R7LG80          RM-VK----GNMSG-LLELNG----ISVG--DNLKNEIFILSSKRLMTRVVDKL--DLDV
A0A2L2WX98      GR-KASS---SMNT-LLELNG----ISVG--DNLKNEVFILSSQRIMERVVDSL--HLDV
G5GD56          GM-SRSARNNGLNT-LMQLNG----ISVG--DNLKNEMFILTSERLMTRVVDSL--GLDV
R5KD55          LN-QLLN------D-YVDF-G---FFADN--TNVNNVIAAIKSPDVMSEVVDRL--GLDV
A0A174QNT3      ---NDLS------A-MLELSG----IPGG--SSVENEVYILRSYQLLNDVVQRL--HLDI
A0A4S2FGS1      ---NDIS------A-MLDLNG----IPGG--SSVENEVYILRSYQLLNDVVQRL--HLDV
A0A7K3KG59      ---NDIS------A-MWEVSG----GLGG--SGVENEVYILRSYQILNDVVQRL--HLDV
R9I0H0          ---NDIS------A-MWEVSG----GLGG--SGVENEVYILRSYQILNDVVQRL--HLDV
K5BUT9          ---SDMS------A-MLEVSG----GITG--TSVDNEIYILRSHQLLREVVNRL--HLDV
A0A174FPA3      ---SDMS------A-MLEVSG----GITG--TSVDNEIYILRSHQLLREVVNRL--HLDV
R6S9Y6          ---SDMS------A-MLEVSG----GITG--TSVDNEIYILRSHQLLREVVNRL--HLDV
A0A7J4YSB2      ---SDMS------A-MLEVSG----GITG--TSVDNEIYILRSHQLLREVVNRL--HLDV
C9KX15          ---SDMS------A-MLEVSG----GITG--TSVDNEIYILRSHQLLREVVNRL--HLDV
A0A6H0KRK1      ---SDIS------A-MLELQG----GITG--SGVENEMFILRSHQLVREVVNRL--HLDV
R6DAG6          ---SDIS------A-MLELQG----GITG--SGVENEMFILRSHQLVREVVNRL--HLDV
A0A3L8AAP1      ---SDIS------A-MLELQG----GITG--SGVENEMFILRSHQLVREVVNRL--HLDV
A0A4S2AYX2      ---SDIS------A-MLELQG----GITG--SGVENEMFILRSHQLVREVVNRL--HLDV
A0A7J0A2L4      ---SDIS------A-MLELQG----GITG--SGVENEMFILRSHQLVREVVNRL--HLDV
A0A7K3MN31      ---SDIS------A-MLELQG----GITG--SGVENEMFILRSHQLVREVVNRL--HLDV
A0A0E2M2Y7      -P-RSMK------Q-FEEI-G---LFMDN--SEVENEILVLKSKRLTAIVVDKL--DLDV
A0A0K2J6Z0      -P-RSMK------Q-FEEI-G---LFMDN--SEVENEILVLKSKRLTAIVVDKL--DLDV
B2RKZ8          -P-RSMK------Q-FEEI-G---LFMDN--SEVENEILVLKSKRLTAIVVDKL--DLDV
A0A212GC82      -P-RSMK------Q-FEEI-G---LFMDN--SEVENEILVLKSKRLTAIVVDKL--DLDV
A0A254MU12      -P-RSMK------Q-FEEI-G---LFMDN--SEVENEILVLKSKRLTAIVVDKL--DLDV
R6CQ93          -T-AGLD------R-YDNYIN-------K--VNVANEILQFRSKRLMREVVQRL--HADV
A0A3D1NQW3      ---TDLA------T-LSDLAG----LSQR--RNVDNEIYILQSRRLMTEVVKQL--GLTV
B0MT10          ---TDLA------T-LSDLAG----LSQR--RNVDNEIYILQSRRLMTEVVKQL--GLTV
R7JGW9          ---TDLA------T-LSDLAG----LSQR--RNVDNEIYILQSRRLMTEVVKQL--GLTV
A0A3D2BF46      ---TDIA------A-FGDLLG----ATAR--RNVDNEIIVLKSRNLMTEVVRRL--NLHV
A0A358R538      ---TDLA------A-FSDLAG----FQNR--RSVDNEVFILQSRRLMAEVVRRL--GLTT
A0A1Y4AAB8      ---MDIS------A-FSDISG----FQSR--NSVDNEIYILQSRRLMQEVVRTL--RLTT
A0A1Y3WWY9      ---PELS------A-FSDLAS----FQTQ--RSVDNEIYILQSRRLMSEVVRRL--NLTE
A0A1Y4U5L4      ---PELS------A-FSDLAS----FQTQ--RSVDNEIYILQSRRLMSEVVRRL--NLTE
A0A1Y3VCJ1      ---VELS------A-FSDLSG----YQSR--KSIDNELFILQSRKLMTEVVRRL--NLTV
A0A1Y3QTW7      ---MELG------A-FSDLVG----FQNR--RNVDNEVYILQSHRLMSEVVKRL--HLTV
R6XWY7          ---MELG------A-FSDLVG----FQNR--RNVDNEVYILQSHRLMSEVVKRL--HLTV
A0A4Y1X9Y9      ---MELG------V-FSDLVG----FQNR--RNVDNEVYILQSHRLMSEVVKRL--HLTV
A0A4Y1WM66      ---MELG------A-FSDLVG----FQNR--RNVDNEVYILQSHRLMSEVVKRL--HLTV
A0A6N4GYT3      ---MELG------A-FSDLVG----FQNR--RNVDNEVYILQSHRLMSEVVKRL--HLTV
A0A174AVF1      ---MELG------A-FSDLVG----FQNR--RNVDNEVYILQSHRLMSEVVKRL--HLTV
A0A656Q4F4      ---MELG------A-FSDLVG----FQNR--RNVDNEVYILQSHRLMSEVVKRL--HLTV
A0A1Q6EIY0      ---TDLG------A-FSDLVG----FQNR--RNVDNEVYILQSHRLMSEVVKRL--HLTV
A0A5B5VN71      ---TDLG------A-FSDLVG----FQNR--RNVDNEVYILQSHRLMSEVVKRL--HLTV
E4M8L3          ---TDLG------A-FSDLVG----FQNR--RNVDNEVYILQSHRLMSEVVKRL--HLTV
I3YQ50          ---TDLG------A-FSDLVG----FQNR--RNVDNEVYILQSHRLMSEVVKRL--HLTV
R5UEY8          ---TDLG------A-FSDLVG----FQNR--RNVDNEVYILQSHRLMSEVVKRL--HLTV
A0A1H4D866      ---LELT------A-FSDLAG----FQNR--RSVDNEVFILQSRRLMTEVVKRL--DLTV
A0A5B3G4Y7      ---VDLT------A-FSDLAG----FQNR--RNVDNEVFILQSRRLMTNVVKQL--NLTV
A0A374A9J5      ---VDLT------A-FSDLAG----FQNR--RNVDNEVFILQSRRLMTNVVKQL--NLTV
A0A5B3GQN5      ---VDLT------A-FSDLAG----FQNR--RNVDNEVFILQSRRLMTNVVKQL--NLTV
A0A1Q6E9S3      ---VDLT------A-FSDLAG----FQNR--RNVDNEVFILQSRRLMTNVVKQL--NLTV
D4IJ36          ---VDLT------A-FSDLAG----FQNR--RNVDNEVFILQSRRLMTNVVKQL--NLTV
A0A414Q925      -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVETL--HLDI
A0A415PUS9      -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVEIL--HLDI
A0A108TCU0      -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVETL--HLDI
A0A413BA42      -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVETL--HLDI
S3Y344          -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVEIL--HLDI
A0A7J5LEW3      -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVEIL--HLDI
A0A412TGL3      -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVETL--HLDI
A0A413VJ33      -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVEIL--HLDI
A0A414L0W6      -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVETL--HLDI
A0A412DP39      -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVETL--HLDI
A0A413ZSE8      -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVEIL--HLDI
B0NP84          -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVEIL--HLDI
R6AK43          -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVEIL--HLDI
A0A412N2D9      -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVETL--HLNV
A0A1Y4JYS9      -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVETL--HLNV
R6LHA4          -V-NGAA------A-FQDL-----FSLGG--STVDNEVGIFKSKRLMRTVVETL--HLNV
A0A3E5HPT8      -A-NSRS------A-MQLNNA---DFIGQ--VNVASEILQFKSKELMRKVIDRL--HADV
C6IJ48          -A-NSRS------A-MQLNNA---DFIGQ--VNVASEILQFKSKELMRKVIDRL--HADV
Q8A3U2          -A-NSRS------A-MQLNNA---DFIGQ--VNVASEILQFKSKELMRKVIDRL--HADV
A0A3R6S1H6      LA-SEAA------A-FEDL-N---VLNTK--SSVDNEVLVFQSRNLMIEVVRRL--NLNI
A0A3R6SD81      LA-SEAA------A-FEDL-N---VLNTK--SSVDNEVLVFQSRNLMIEVVRRL--NLNI
A0A354WXN6      -F-SEAN------A-FGDL-G---ITMGS--RNVDNEVLVFKANRLMEMVVKRL--HLDI
A0A7G1HW11      -F-SESA------M-FKDL-GSMDMINVR--SSAETEMLIFQSYRLMQDVVSQL--DLDV
R5IP14          -F-SESA------M-FKDL-GSMDMINVR--SSAETEMLIFQSYRLMQDVVSQL--DLDV
A0A316SZX7      -I-TESA------A-FQEL-G---AFNIK--SNVDNEILLFESKRLMEEVVRLL--KLDV
A0A1Y4AIY1      -S-MSAY------G-FSDLNN---MLGIQ--RNVDNEVIVFKTYRLMEKVARRL--HLDV
A0A0J6CIR2      GL-SESA------A-FEEL-N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--NLDI
A0A3D8HG59      AM-SEAS------A-FSDL-G---MFSMK--SSVDNEVLVFQSRQLMQNVVKRL--KLDI
A0A3R6S408      AM-SEAS------A-FSDL-G---MFSMK--SSVDNEVLVFQSRQLMQNVVKRL--KLDI
F3ZRU7          NM-QGVA------A-LTDL-A---DFGLK--SSVDNEILIFQSNSLLREVSTRL--SLNT
A0A1C5Q1F3      LP-NAAS------A-FSEM-D---LLNIQ--STVDNEVLIFKSKRLMIEVARKL--KLDI
R7A239          LP-NAAS------A-FSEM-D---LLNIQ--STVDNEVLIFKSKRLMIEVARKL--KLDI
A0A3R6HIK7      -A-ATTY------G-FTDL-D---MFGLQ--RNVDNEVIVFKAYRLMEMVARRL--HLDV
K5ZVW7          -A-ATTY------G-FTDL-D---MFGLQ--RNVDNEVIVFKAYRLMEMVARRL--HLDV
A0A1Y4D5Z0      -S-RSLY------G-FSDL-D---MLSLQ--RNVDNEVIVFKTYRLMETVARRL--HLDI
A0A413VXJ7      -I-SESS------A-FADL-G---LFGGK--RNVDNEVLIFQSRHLMEEVARRL--HLDI
I9RSN9          -I-SESS------A-FADL-G---LFGGK--RNVDNEVLIFQSRHLMEEVARRL--HLDI
U6RJK5          -I-SESS------A-FADL-G---LFGGK--RNVDNEVLIFQSRHLMEEVARRL--HLDI
A0A1Q6GA32      -I-SESS------A-FADL-G---LFGGK--RNVDNEVLIFQSRHLMEEVARRL--HLDI
I9RPU6          -M-SESA------A-FSDL-S---LFGGK--RNVDNEVLVFQSRHLMEEVARRL--HLDM
I8YFS5          -I-SEST------A-FADI-S---FLGGK--RNVDNEVLVFQSRHLMEKVARRL--HLDM
A0A7J4XCM0      -I-SEST------A-FADI-S---FLGGK--RNVDNEVLVFQSRHLMEKVARRL--HLDM
I8Y597          -I-SEST------A-FADI-S---FLGGK--RNVDNEVLVFQSRHLMEKVARRL--HLDM
A0A1Q6GBF5      -V-SESS------A-FADL-S---LFGGK--RNVDNEVLVFQSRHLIEEVARRL--HLDM
I8YFZ3          -M-SESA------A-FSDL-S---LFGGK--RNVDNEVLVFQSRHLMEEVAHRL--HLDM
A0A7J4XFW0      -M-SESA------A-FADL-S---LFGGK--RNVDNEVLVFQSRHLMEEVARRL--HLDM
A0A1Q6GDH2      -M-SESA------A-FSDL-S---LFGGK--RNVDNEVLVFQSRHLMEEVARRL--HLDM
U6RSB0          -M-SESA------A-FSDL-S---LFGGK--RNVDNEVLVFQSRHLMEEVARRL--HLDM
I9GXM2          -M-SESA------A-FSDL-S---LFGGK--RNVDNEVLVFQSRHLMEEVARRL--HLDM
I9SIK1          -M-SESA------A-FSDL-S---LLGGK--RNVDNEVLVFQSRHLMEEVARRL--HLDM
A0A7J4XIJ5      -M-SESA------A-FSDL-S---LLGGK--RNVDNEVLVFQSRHLMEEVARRL--HLDM
I9TP59          -M-SESA------A-FSDL-S---LLGGK--RNVDNEVLVFQSRHLMEEVARRL--HLDM
R5S343          -A-GEGR------V-FEEL-N---LFNVK--SNVDNEVQVFKSTRLMSSVVRKL--SLEQ
A0A1M6K7I9      -M-GESA------L-FADL-N---LFGGA--RSVDNELLVFQSRSIMENVVRRL--SLNM
A0A5M6A8C8      -M-GESA------L-FADL-N---LFGGA--RSVDNELLVFQSRSIMENVVRRL--SLNM
A0A7J4XCJ1      -M-SESS------A-FADI-S---FFGGK--RNVDNEVLVFQSRNLMEKVARRL--HLDM
A0A7J4XNQ7      -I-SESS------A-FADI-S---LFGGK--RNVDNEVLVFQSRYLMEKVARRL--CLDM
A0A3R5ZMK1      -M-SESA------A-FEDL-G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
A0A7K1HMX0      -L-SESA------A-FEDL-G---IFGTK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
A0A1Y3ZIA4      -M-SESA------A-FEDL-G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
K5Y1A4          -M-SESA------A-FEDL-G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
A0A7K1HDC0      -M-SESA------A-FEDL-G---LFGSK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
A0A3R6K8X4      -M-SESA------A-FEDL-G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
A0A6N8D6C8      -M-SESA------A-FEDL-G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
A0A3R6BKI7      -M-SESA------A-FEDL-G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
A0A412M2W1      -M-SESA------A-FEDL-G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
K5ZX55          -M-SESA------A-FEDL-G---LFGTK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
A0A415BDM7      -M-SESA------A-FEDL-G---LFGSK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
A0A1Q6I3T6      -M-SESA------A-FEDL-G---LFGSK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
A0A414XX40      -M-SESA------A-FEDL-G---LFGSK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
A7AEU7          -M-SESA------A-FEDL-G---LFGSK--RNVDNEVLVFKSRRLMTEVARNL--HLDV
A0A5F0U645      AA-SEAA------V-FEDL-N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--DLDI
K5ZBN2          AA-SEAA------V-FEDL-N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--DLDI
A0A0J6CKW3      AA-SEAA------V-FEDL-N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--DLDI
A0A0F5IQM7      AA-SEAA------V-FEDL-N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--DLDI
A0A496CDT3      AA-SEAA------V-FEDL-N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--DLDI
A0A6G1ZKM3      AA-SEAA------V-FEDL-N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--DLDI
S0GLB0          AA-SEAA------V-FEDL-N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--DLDI
A0A3R6NLC1      AA-SEAA------V-FEDL-N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--DLDI
A0A416WYC9      AA-SEAA------V-FEDL-N---MFNMK--RSVDNELLVFKSKQLMKSVVKRL--DLDI
A0A0F5IT40      -L-SESA------A-FEEL-N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--NLDI
A0A496CX20      -L-SESA------A-FEEL-N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--NLDI
A0A5F0UBI0      -L-SESA------A-FEEL-N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--NLDI
A0A6G1ZHG0      -L-SESA------A-FEEL-N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--NLDI
S0GSI7          -L-SESA------A-FEEL-N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--NLDI
K5YB65          -L-SESA------A-FEEL-N---MFNVK--SNVDNEVLVFKSKRLMSVVAERL--NLDI
A0A0F5IWP9      -L-SESA------A-FEEL-N---MFNVK--SNVDNEVLVFKSKRLMSIVAERL--NLDI
A0A0F5IZT8      -L-SESA------A-FEEL-N---MFNVK--SNVDNEVLVFKSKRLMSIVAERL--NLDI
A0A417LKQ2      -L-SESA------A-FEEL-N---MFNVK--SNVDNEVLVFKSKRLMNIVAERL--NLDV
A0A416TME1      -L-SESA------A-FEEL-N---MFNVK--SNVDNEVLVFKSKRLMNIVSERL--NLDV
A0A416XPE8      -L-SESA------A-FEEL-N---MFNVK--SNVDNEVLVFKSKRLMNIVSERL--NLDV
A0A3B0C2S4      --ITVDP-------------MALLSGNPG--INLDNEIQVLKSYRILGQVVEAL--NLDV
L8JI02          LGGKEFL-------------RGMGLFTSD--TELEDEIGILKSYGMVSNAIRSL--DFGI
A0A4Q5WS95      --ESSLS-------------ESMNVLSSK--KIVENEVVVLQSRNLADKIVAGL--RLYA
A0A501VZX6      --DAKMT-------------ESIDAFTSN--KIVENEIKVLYSRTLLKEVVEDL--KLYA
A0A399SH26      --DARMT-------------ESINAFASK--KIVENEIEVIQSRALMKKVALGL--HLYA
A0A501W1A9      --ASKIE-------------ESIDAFNAN--KTVENELNVLRSYALMSQVVREL--HLYA
A0A0E3ZGV6      --ASKIT-------------ESIDAFSSN--KIVENELNVLRSNALMNQVVNEL--KLYA
A0A1I2N4S1      --ASKIM-------------ESIDAFSTN--KTVENELNVLRSSALMSQVVHKL--KLYA
A0A2T5YE44      --ASKIM-------------ESIDAFNTN--KTVENELNVLRSSALMSQVVHKL--KLYA
A0A1M5BA90      --ESKIL-------------EALNI-TSN--KTVDNEVEVIQSGELLNEVIDSL--HLYA
A0A512B879      --ESKIL-------------DALNIYSSN--KIVENEIEVIQSKELLKKVVNSL--SLYA
A0A559PPI3      --NSKMV-------------ESMSPFDSK--KIVENEIKVIQSPDIMKKVVDTL--NLYA
A0A1T5CS78      --NSRIM-------------ESINPFDSK--KIVENEIEVLKSRDLMKSVVRDL--DLYA
A0A0Q9Z8F1      --DSKIM-------------ESINPFDSK--KIVENEIEVLKSRDLMKAVVRDL--NLYA
A0A2N0U0M7      --DSKIM-------------ESINPFDSK--KIVENEIEVLKSRDLMKSVVRDL--NLYA
A0A1V9FHD0      --ESGMG-------------EALQIFPTK--NIVENEMEVIHSRKLITDVINQL--HLYA
A0A4V4H170      --ESGVL-------------EALQIYPTK--NIVENEMEVIHSRKLMEKVVEQL--QLYA
A0A1V9F098      --ESGVL-------------EALQIYPTK--NIVENEMEVIHSRKLMEKVVEQL--QLYA
A0A4R2VU64      --ESGVL-------------EALQIYPTK--NIVENEIEVIHSRKLMEKVIEGL--YLYA
A0A4S8HY23      --ESGVQ-------------EALQIYPIK--NIVENEMEVIHSRKLMEKVVEQL--HLYA
A0A1V9F383      --ESGSM-------------EALQIYPTK--NIAENEIEVIHSRKLMEQVIVQL--LLYA
G8TRZ6          --ESGAM-------------EALQVYPMQ--NIAENEIEVLQSKTLMTDVVNQL--HLYA
A0A4R5DL69      LGEAAIL-------------ENLGLAPGK--SNVDNEVEILKSRTLIESVVSDL--QLYI
A0A1M4YED3      --ESKME-------------ESLDFYQSN--KVVENEIVVLSSKGLMEKVISNL--NLYT
A0A2H3NSN0      ---PNQA-------------QTVRFDIQP--ELSSEIGILTNSGSLAMRVITEL--RTAA
A0A2P6C324      --AAPAR-------------MMVGLNEQR--DLSSEIGLLKNSGELARRVVSTI--EDVA
A0A7C2DZI7      --TPTTL-------------TAFTLGEQR--ALSNELGILRNSAELATRVATAL--LETA
A0A1M6XHU0      --APVSV-------------AAFTPIERR--ALSNELGILKNSAELATRVAKAI--VATA
G2SF81          --APVSV-------------AAFTPIERR--ALSNELGILRNSAELATRVAEAI--VATA
A0A5S9EYW1      --APVSV-------------AAFTPIERR--ALSNELGILRNSAELATRVAEAI--VATA
D0MHQ9          --APVSV-------------AAFTPIERR--ALSNELGILRNSAELATRVAEAI--VATA
A0A126PFG0      --EKSAL-------------QELDLVTTP--KVVESEMEILKSRKLMLSVVRDL--QLST
A0A3M1N7Z3      --FQTQN-------------TAGSFFPPE--VLTEAYLELWSRYDLIAQVVQQL--RLNY
                                                                            

A0A1T5MMH4      T---------------------YY-------------SK------G--EV----------
A0A2W4R1L8      S---------------------YY-------------NK------G--EI----------
A0A2E5CV79      N---------------------RR-------------NSL-----A--------------
A0A2D4ZVH1      ---------------------------------------------NEVEF----------
A0A0K8QSK7      S---------------------VY-------------SV------G--QI----------
A0A1V6CN82      S---------------------YH-------------NE------G--KL----------
A0A1M4XZ45      S---------------------YY-------------AL------G--RV----------
A0A399D319      S---------------------YY-------------AV------G--RV----------
A0A1V5IPN7      E---------------------SY-------------PIS-----G--------------
A0A1M6GR99      S---------------------YY-------------EYK-----NYQYY----------
A6EBM4          S---------------------FY-------------SY------E--RL----------
A0A7C5M4P4      Q---------------------YF-------------TY------G--QF----------
A0A1M6TTV4      S---------------------YF-------------RPG-----R--SH----------
A0A4Q8RX32      M---------------------YY-------------EE------K--LL----------
K0X1U5          S---------------------YT-------------SKK-----N--FF----------
R5EXK3          S---------------------YT-------------SKK-----N--FF----------
A0A401UAP7      S---------------------YY-------------SV------G--EF----------
A0A1W2GF52      S---------------------YY-------------HP------GRSHL----------
A0A2G5L7B8      S---------------------YF-------------HP------GRSHL----------
A0A523GAC0      S---------------------YY-------------AV------G--NI----------
L8JW09          S---------------------YY-------------TA------G--QV----------
A0A364XUP5      S---------------------YF-------------NK------G--EL----------
A0A1M5RLA9      S---------------------YF-------------SV------G--RV----------
A0A385SFR9      S---------------------YF-------------SV------G--RV----------
A0A5M4A9J4      S---------------------YY-------------EV------D--------------
A0A5M4B1C7      S---------------------YY-------------VV------N--------------
A0A0D3LFR6      S---------------------YF-------------TQ------G--KI----------
M7N6D4          S---------------------YF-------------EK------G--KI----------
A0A4D7K1D4      T---------------------IR-------------TTF-----G--SL----------
A0A5C7MX19      S---------------------YF-------------KE------GKTKF----------
A0A1Q3ZMZ7      G---------------------FF-------------NK------G--SI----------
A0A2D8JJW3      L---------------------FL-------------TP------DYKLI----------
A0A2W2AFF7      N---------------------YF-------------SS------G--RV----------
R7PCR1          S---------------------YD-------------TK------D--GL----------
A0A2N5YXE2      S---------------------YY-------------RQ------G--TF----------
A0A1G9E2A9      S---------------------YY-------------VV------G--DV----------
A0A098LL25      S---------------------YF-------------AY------G--NI----------
A0A6J4H627      S---------------------YF-------------AY------GRSRI----------
A0A6C0GJI1      S---------------------YY-------------AY------G--QI----------
A0A2T2YJE8      N---------------------YY-------------SI------G--NV----------
A0A7L7LEW0      S---------------------YY-------------SI------G--NV----------
A0A127B287      S---------------------YH-------------VE------A--RI----------
A0A6P1P2P6      S---------------------YH-------------VE------A--RV----------
A0A3M9N829      S---------------------YH-------------VD------A--RV----------
A0A0P0CSF9      S---------------------YF-------------VE------A--RV----------
A0A5M8QQB8      S---------------------YF-------------VE------A--RV----------
A0A3M9MNC3      S---------------------YH-------------IE------A--RV----------
A0A5B6TAX2      S---------------------YH-------------VE------A--RV----------
A0A7L5A132      N---------------------YF-------------AE------G--TV----------
A0A512AYT3      S---------------------YY-------------AL------G--NV----------
A0A5M6CYN7      S---------------------YY-------------AL------G--NV----------
A0A369QP10      S---------------------YY-------------AI------G--NI----------
A0A7G7G7M4      S---------------------YY-------------AI------G--NI----------
A0A126PDF2      N---------------------YY-------------VQ------G--TV----------
A0A2Z3GKA1      N---------------------YY-------------VQ------G--TV----------
A0A502GZP7      N---------------------YY-------------VQ------G--TV----------
A0A519SBU8      N---------------------YY-------------VQ------G--TV----------
A0A4Q3JNZ3      N---------------------YY-------------VQ------G--TV----------
A0A519Q9V3      N---------------------YY-------------VQ------G--TV----------
A0A0M3RW20      N---------------------YY-------------AQ------G--TV----------
A0A495VFX4      N---------------------YY-------------AQ------G--TV----------
A0A418R9X5      N---------------------YY-------------VQ------G--TV----------
A0A428JSJ3      N---------------------YY-------------VQ------G--TV----------
A0A428KI59      N---------------------YY-------------VQ------G--TV----------
W8F1I6          N---------------------YY-------------VQ------G--TV----------
A0A246FQC0      N---------------------YY-------------VQ------G--TV----------
A0A372E5P8      N---------------------YY-------------VQ------G--TV----------
A0A1H3EMW1      N---------------------YY-------------VQ------G--TV----------
A0A1H9ZSN3      N---------------------YY-------------VQ------G--TV----------
A0A1S9B3W0      N---------------------YY-------------AE------G--TV----------
A0A1W1VRL3      N---------------------YY-------------VE------G--TV----------
A0A7G6YQJ9      N---------------------YY-------------AE------G--TV----------
A0A1M6R305      N---------------------YY-------------AE------G--TV----------
A0A7G7W8X3      N---------------------YY-------------AE------G--TV----------
A0A4Z0PHK3      N---------------------YY-------------VE------G--TV----------
A0A2M9B9H9      N---------------------YY-------------VE------G--TV----------
A0A4Z0QCY9      N---------------------YY-------------VE------G--TV----------
A0A5N1J2M4      S---------------------YF-------------VR------G--NV----------
A0A519S476      N---------------------YY-------------VQ------G--TV----------
A0A4Q3JRW8      N---------------------YY-------------VQ------G--TV----------
A0A519M923      N---------------------YY-------------VQ------G--TV----------
A0A4Z0ENW1      N---------------------YY-------------TQ------G--TV----------
A0A519UDB4      N---------------------YY-------------TQ------G--TV----------
A0A3S0QKV1      N---------------------YY-------------AE------G--TV----------
A0A328BL48      N---------------------YY-------------TE------G--TV----------
A0A5R8WLY4      N---------------------YY-------------TE------G--TV----------
A0A1I5WSL8      N---------------------YY-------------VQ------G--TV----------
A0A0U3JVM7      N---------------------YY-------------VQ------G--TV----------
A0A1G1SSV2      N---------------------YY-------------VQ------G--TV----------
A0A1G1SXV7      N---------------------YY-------------VQ------G--TV----------
A0A6G8CBJ6      N---------------------YY-------------VE------G--TV----------
A0A0W8EDI5      S---------------------YF-------------VE------G--TV----------
A0A3B7RBP8      G---------------------YF-------------VE------G--TV----------
A0A3R9P8H7      N---------------------YY-------------VQ------G--TV----------
A0A238WIA7      A---------------------YY-------------AE------G--TV----------
A0A212UCJ7      N---------------------YY-------------AE------G--TV----------
A0A4Z0MQE1      N---------------------YY-------------AE------G--TV----------
A0A4Z0PCF4      N---------------------YY-------------AE------G--TV----------
A0A6M6BED0      N---------------------YF-------------AE------G--TV----------
A0A5D6VDG1      N---------------------YY-------------SQ------G--TV----------
A0A243WHR7      N---------------------YY-------------VE------G--TV----------
A0A5B8A0P6      N---------------------YY-------------AE------G--AV----------
A0A076HRT9      N---------------------YY-------------AE------G--TV----------
A0A4Z0PVM7      N---------------------YY-------------VE------G--TV----------
A0A1M6DHW8      N---------------------YY-------------VE------G--TV----------
A0A4Q5LC61      N---------------------YY-------------VE------G--TV----------
K0XJ09          T---------------------YQ-------------VK------N--WL----------
R5EUZ0          T---------------------YQ-------------VK------N--WL----------
W0EQS0          A---------------------YR-------------VK------D--WL----------
A0A1Y3WE15      T---------------------YQ-------------VK------D--FL----------
A0A1Y4GUK3      T---------------------YQ-------------VK------D--FL----------
A0A2U1FKU2      T---------------------LS-------------KD------G--FW----------
A0A0A2F954      S---------------------IS-------------KQ------G--FW----------
A0A0A2FW91      S---------------------IS-------------KQ------G--FW----------
A0A2D2N2N1      S---------------------IY-------------KQ------G--FW----------
Q7MWZ2          S---------------------IY-------------KQ------G--FW----------
T2NDT6          S---------------------IY-------------KQ------G--FW----------
W1R7P9          S---------------------IY-------------KQ------G--FW----------
A0A1R4AFZ0      S---------------------IY-------------KQ------G--FW----------
A0A1R4DVZ7      S---------------------IY-------------KQ------G--FW----------
A0A7C0WKI7      ------------------------------------------------------------
A0A2A8CVM9      A---------------------LE-------------EK------G--KF----------
A0A5M4B212      S---------------------YL-------------QL------G--RF----------
A0A3D1KEX9      D---------------------YV-------------MM------K--GL----------
A0A358Y7S2      N---------------------LY-------------SK------G--TI----------
A0A1X7J248      T---------------------YH-------------VI------G--RF----------
E4TQD2          S---------------------YH-------------VI------G--RF----------
A0A2J6HHN3      S---------------------IF-------------AK------G--NI----------
A0A1Y3WMT8      I---------------------YT-------------SK------K--NF----------
A0A1Y4GQU1      V---------------------YT-------------SK------K--NF----------
A0A6A0R272      R---------------------YY-------------KK------G--RF----------
A0A1V5W8T5      S---------------------YY-------------LE------G--KF----------
A0A2T8HKA9      S---------------------YS-------------KT------E--GL----------
A0A2I0QZ80      S---------------------LY-------------AK------G--EF----------
A0A3E1F1A3      S---------------------HY-------------AK------G--EF----------
A0A2U2XBJ3      S---------------------LY-------------AK------G--EF----------
A0A4Q4KU94      S---------------------LY-------------AR------G--EF----------
A0A3B8INU3      S---------------------YF-------------TQ------G--KI----------
A0A2W1NDY9      S---------------------YF-------------SE------G--EV----------
A0A5C8AQR5      S---------------------LF-------------SK------G--KI----------
A0A1G0CI31      S---------------------LF-------------SK------G--RI----------
A0A556N0M0      S---------------------IF-------------AE------G--KI----------
F2IKD6          S---------------------VF-------------SK------G--KI----------
A0A1I7BM74      S---------------------HF-------------AK------G--EF----------
A0A2G2FJ17      S---------------------LF-------------AE------G--DV----------
A0A2E3R1D0      ------------------------------------------------------------
A0A2T2USC0      ------------------------------------------------------------
A0A2T2V0F3      ------------------------------------------------------------
A0A2T2S682      ------------------------------------------------------------
D5H561          ------------------------------------------------------------
A0A2H3NWA9      ------------------------------------------------------------
A0A2A8CVB6      ------------------------------------------------------------
A0A2P6C1S6      ------------------------------------------------------------
A0A2T2UTM4      ------------------------------------------------------------
A0A414ZBF2      S---------------------YK-------------ER------N--GL----------
A0A1Q3Q573      S---------------------YL-------------KE------G--KS----------
A0A662BAY3      N---------------------YY-------------SV------G--RV----------
A0A4U3L369      S---------------------YY-------------KK------E--DI----------
A0A357YNR3      T---------------------YT-------------EM------R--PLSLLARFGLKD
A0A5E8AX52      S---------------------YH-------------YY------G--NI----------
F4KK08          Q---------------------YH-------------YD------A--GL----------
A0A6B5PK86      S---------------------IF-------------YK------G--KI----------
A0A2G2F510      S---------------------LY-------------SR------G--NV----------
A0A316JZ08      S---------------------MF-------------SR------G--KL----------
A0A496LCF9      D---------------------FY-------------KK------K--QF----------
A0A5P2G2A9      N---------------------YY-------------KR------V--PL----------
A0A3C0ZQC7      ------------------------------------------------------------
A0A3N2N6F7      N---------------------YV-------------YK------K--RL----------
A0A419VXB7      S---------------------WY-------------RH------M--PL----------
A0A0B0BTJ4      V---------------------YA-------------TK------S--KL----------
A0A3B9CNN6      V---------------------YA-------------TK------S--KL----------
R5X290          V---------------------YA-------------TK------S--KL----------
A0A1Q6E6I7      V---------------------YA-------------TK------S--KL----------
C3J7R8          S---------------------YS-------------QS------R--GI----------
A0A1G8BVM8      N---------------------YQ-------------VK------D--GL----------
A0A1I1FXP9      T---------------------YM-------------QK------G--NF----------
A0A4P7VVU7      D---------------------YI-------------YR------H--NL----------
A0A2V1ILM4      D---------------------YI-------------YR------H--NL----------
A0A3N2L0E8      D---------------------YI-------------YR------H--NL----------
A0A3N2LFC5      D---------------------YI-------------YR------H--NL----------
A0A7K3KWJ8      D---------------------YI-------------YR------H--NL----------
A0A3N4H5N3      F---------------------LY-------------DK------I--GF----------
A0A2P8EAX2      T---------------------FY-------------DK------I--GI----------
A0A4V2F6N9      T---------------------FY-------------DH------N--GM----------
A0A3B9FXJ0      S---------------------LI-------------AS------G--RI----------
R5GSU5          D---------------------YS-------------VK------N--GL----------
A0A2A3UE91      N---------------------YY-------------SE------G--VF----------
A0A0A2G557      T---------------------YR-------------KK------E--GL----------
A0A2N2WFW8      S---------------------IF-------------VK------G--NI----------
A0A1F3IU95      S---------------------VF-------------AK------G--NI----------
A0A3D0VUF6      S---------------------VF-------------AK------G--NI----------
A0A1T4PT95      N---------------------YQ-------------RK------E--GI----------
A0A6I6JYY3      S---------------------YY-------------AV------G--RV----------
A0A2A4PYG9      S---------------------YY-------------SK------G--KI----------
A0A1F3K695      A---------------------YY-------------SE------G--TF----------
A0A353KZR1      A---------------------YY-------------SE------G--TF----------
A0A2N2WYB5      S---------------------YF-------------SE------G--TF----------
A0A1F3K4G0      S---------------------YF-------------SE------G--TF----------
A0A356H8Y3      S---------------------YF-------------SE------G--TF----------
A0A351HSA6      S---------------------YF-------------SE------G--TF----------
A0A1F3Q014      S---------------------YY-------------AE------G--TF----------
A0A2D5KD44      S---------------------YF-------------SE------G--QF----------
A0A6N9NIX1      S---------------------YY-------------SQ------G--KF----------
A0A2A4YXP3      S---------------------YY-------------NQ------G--EI----------
A0A1F3R158      S---------------------YF-------------NQ------G--KF----------
A0A2M8ADX2      S---------------------YF-------------NK------G--KF----------
A0A1J5B2H0      S---------------------YY-------------TE------G--RL----------
A0A1V5N756      A---------------------YY-------------KK------G--RF----------
A0A651GU15      S---------------------YY-------------LK------G--DI----------
A0A3Q9FR88      T---------------------YQ-------------SV------G--DV----------
A0A553GEX3      T---------------------YQ-------------SV------G--DV----------
A0A150ADJ9      S---------------------YY-------------SV------G--EI----------
A0A1B1FWQ4      E---------------------YY-------------SV------G--DV----------
A0A1S1Z228      D---------------------YY-------------SV------G--DV----------
A1ZKR2          S---------------------YY-------------QQ------G--NI----------
A0A1Q3GX01      S---------------------YY-------------EQ------G--NI----------
A0A349DQI4      S---------------------YY-------------EQ------G--NI----------
A0A4P5TMD1      S---------------------YF-------------NI------G--QI----------
A0A2N3IIZ0      E---------------------YY-------------AE------G--RI----------
A0A7K3WUF2      S---------------------YF-------------EK------G--KV----------
A0A1F3SJM1      S---------------------LY-------------SR------G--KI----------
A0A2G2EB96      S---------------------LF-------------SR------G--QI----------
A0A2G6PRA9      S---------------------LF-------------SR------G--EI----------
A0A497D5Z2      S---------------------YY-------------RE------G--NI----------
A0A662B170      S---------------------YY-------------RE------G--NI----------
A0A2A5FYT6      S---------------------YF-------------SE------G--QV----------
A0A2E6SYP1      N---------------------YY-------------SK------G--KF----------
A0A2E5RLE8      N---------------------YY-------------TK------G--KF----------
A0A2E7TQF6      N---------------------YY-------------TK------G--KF----------
A0A2E6GVY9      N---------------------YY-------------TK------G--KF----------
A0A350JJ90      S---------------------YY-------------AE------G--EV----------
A0A3M1CDV2      S---------------------YY-------------NE------G--TF----------
A0A6C1QGZ7      S---------------------YF-------------SK------G--RV----------
A0A4P5U6G4      S---------------------YY-------------NT------G--QI----------
A0A2E2TFD1      S---------------------YF-------------NE------G--EL----------
A0A2E4ELE6      S---------------------YY-------------TE------G--EF----------
A0A522EYA6      T---------------------YF-------------AE------G--TF----------
A0A2E3XZI5      L---------------------YY-------------NE------G--EI----------
A0A6I7QXV0      R---------------------YF-------------KE------G--RT----------
A0A2M7NLQ9      S---------------------YF-------------VK------G--RW----------
I4AFR0          S---------------------YF-------------VK------G--RW----------
A0A2N2Y3E5      S---------------------YY-------------SK------G--TF----------
A0A2D9D7T6      S---------------------VY-------------SE------G--KL----------
A0A1F3PPL5      Q---------------------YF-------------NE------G--TF----------
A0A357QK06      Q---------------------YF-------------NE------G--TF----------
A0A662AEA4      E---------------------YY-------------TQ------G--TF----------
A0A0S2HYK8      R---------------------YF-------------VE------G--AF----------
A0A2N5ZWN6      R---------------------YY-------------IE------G--AF----------
A0A2E0FJ09      R---------------------YF-------------LE------G--KI----------
A0A1F3FZ62      S---------------------YY-------------IK------G--RI----------
A0A1F3K211      S---------------------YY-------------IK------G--RI----------
A0A1V6I2U9      S---------------------YY-------------RK------G--TF----------
A0A2H0B957      S---------------------YY-------------SQ------G--TF----------
A0A1F3CFW6      S---------------------YF-------------SQ------G--TF----------
A0A2M7E2T8      S---------------------YF-------------SQ------G--TF----------
A0A2M7NC69      S---------------------YF-------------SQ------G--TF----------
A0A1F3KLL5      S---------------------YF-------------SQ------G--TF----------
A0A359D1M1      S---------------------YF-------------SQ------G--TF----------
A0A0F2NS19      S---------------------YF-------------NQ------G--KI----------
A0A2A5H8X6      S---------------------YF-------------NQ------G--KI----------
A0A2H0GAU8      S---------------------YY-------------NQ------G--NF----------
A0A2M8FTK1      S---------------------YY-------------NQ------G--NF----------
A0A2A5B3B0      S---------------------YY-------------RK------G--EI----------
A0A5C6RXM7      S---------------------FY-------------NK------G--TL----------
A0A1F3C1M2      T---------------------YF-------------SE------G--TF----------
A0A1F3DS87      T---------------------YF-------------SE------G--TF----------
A0A6A0R6K9      S---------------------YY-------------TQ------G--QF----------
A0A2E7CT70      R---------------------YY-------------SE------G--EI----------
A0A2D5V560      F---------------------YY-------------FE------G--EX----------
A0A2D7K5A8      F---------------------YY-------------FK------G--EI----------
A0A2E1XQ82      F---------------------YY-------------FE------G--EI----------
A0A5C8A5B4      S---------------------YY-------------ATK-----Y--------------
A0A7C1LGX3      T---------------------YY-------------LKG-----K--------------
A0A4Y9ITE2      T---------------------YI-------------VKE-----N--------------
A0A5M8NYX7      A---------------------YY-------------TNG-----K--------------
A0A0E3V905      R---------------------YF-------------QNT-----T--------------
A0A553ETH6      S---------------------YF-------------TTG-----N--------------
A0A640Q161      N-----------------------------------------------------------
A0A640QU49      N-----------------------------------------------------------
A0A1Q3PII2      Q---------------------YF-------------ASG-----H--------------
A0A351BXT2      K-----------------------------------------------------------
A0A2K8Z965      R---------------------YY-------------EAT-----T--------------
A0A418M8U8      R---------------------YF-------------EKT-----A--------------
I2GTA4          R---------------------YF-------------EKT-----A--------------
A0A2K8ZAJ2      Q---------------------YY-------------RPT-----R--------------
A0A368JPA3      R---------------------YF-------------RST-----P--------------
A0A5N1JI29      R---------------------YF-------------RST-----P--------------
A0A7K0EGC9      R---------------------YF-------------RST-----P--------------
A0A3P1BT12      R---------------------YF-------------RST-----P--------------
A0A3P1CI15      R---------------------FF-------------RST-----P--------------
A0A4R8CUK1      R---------------------YF-------------HKT-----A--------------
A0A3D0MYJ7      ------------------------------------------------------------
A0A662AH13      ------------------------------------------------------------
A0A5C7QA01      QLSSQEDNFKNRFLGANHYDTVYS-------------NDA-----V--------------
A0A3D3LS70      ------------------------------------------------------------
A0A1G1TM36      V---------------------YQ-------------RPG-----R--------------
A0A1G7ZF38      Q---------------------YF-------------AAG-----T--------------
C6VS52          Q---------------------YF-------------ASG-----L--------------
A0A2A4G4B1      R---------------------YY-------------SKN-----S--------------
A0A0P7X1V8      R---------------------YQ-------------PDG-----R--------------
A0A6P1P355      P---------------------QF-------------EED-----K--------------
A0A5C8KAD6      P---------------------IY-------------EEG-----K--------------
A0A5N1J695      Q---------------------VF-------------EED-----Q--------------
A0A3N2M1H3      N---------------------YD-------------RLG-----G--------------
A0A4S2G8T2      N---------------------YD-------------RLG-----G--------------
A0A212K7W5      D---------------------YS-------------TKG-----F--------------
F5IU11          D---------------------YS-------------IKG-----F--------------
A0A7C1QWC7      A---------------------YYRESDNLLKQTSQIYNS-----N--------------
A0A352Z1R7      Q---------------------VT-------------KKS-----K--------------
A0A0A2F501      E---------------------YY-------------ADG-----R--------------
R5B7P0          S---------------------YT-------------VDG-----T--------------
R5B0L5          T---------------------YN-------------IDG-----R--------------
A0A6I1TEC0      D---------------------YA-------------VDG-----R--------------
A0A3R5XWG1      D---------------------YA-------------VDG-----R--------------
A0A5P0Y910      D---------------------YA-------------VDG-----R--------------
A0A414YFM3      D---------------------YA-------------VDG-----R--------------
A0A6A7UIA7      D---------------------YA-------------VDG-----R--------------
A0A6A7VPS3      D---------------------YA-------------VDG-----R--------------
A0A374THP7      D---------------------YA-------------IDG-----A--------------
A0A6G1VND1      D---------------------YA-------------IDG-----A--------------
A0A0A2EVS5      D---------------------YK-------------VDG-----R--------------
A0A1T4NAJ7      D---------------------YK-------------VDG-----R--------------
A0A255T941      V---------------------YS-------------VRE-----G--------------
A0A4P7VSV0      N---------------------YY-------------IPG-----R--------------
A0A7J0AX49      N---------------------YY-------------IPG-----R--------------
A0A3N2KCL3      N---------------------YY-------------IPG-----R--------------
A0A2V1IJY1      N---------------------YY-------------IPG-----R--------------
A0A4P7VXK7      N---------------------YY-------------IPG-----R--------------
A0A1Y4CHN5      N---------------------YK-------------VDG-----R--------------
A0A1M6I2S6      T---------------------YT-------------VRK-----G--------------
A0A1Y3V692      T---------------------YT-------------VRK-----G--------------
F3PXM2          T---------------------YT-------------VRR-----G--------------
A0A174AHH7      I---------------------YT-------------IRR-----G--------------
A0A174JCE8      I---------------------YT-------------IRR-----G--------------
A0A3E4JMC4      I---------------------YT-------------IRR-----G--------------
A0A412SND6      I---------------------YT-------------IRR-----G--------------
A0A414IEQ9      I---------------------YT-------------IRR-----G--------------
A0A7K0HNT3      I---------------------YT-------------IRR-----G--------------
A0A0M1W8D8      I---------------------YT-------------IRR-----G--------------
A0A3R6GKX5      I---------------------YT-------------IRR-----G--------------
A7V4S1          I---------------------YT-------------IRR-----G--------------
B0NU19          I---------------------YT-------------IRR-----G--------------
D4V601          I---------------------YT-------------IRR-----G--------------
A0A4Q0U3M9      I---------------------YT-------------IRR-----G--------------
A0A7J5G2G2      I---------------------YT-------------IRR-----G--------------
A0A7J5HH13      I---------------------YT-------------IRR-----G--------------
A0A397WLT5      I---------------------YT-------------IRR-----G--------------
A0A6A2J529      I---------------------YT-------------IRR-----G--------------
A0A6N8DDD8      I---------------------YT-------------IRR-----G--------------
A0A015XH67      I---------------------YT-------------IRR-----G--------------
A0A078RZN2      I---------------------YT-------------IRR-----G--------------
A0A6M4L7F4      I---------------------YT-------------IRR-----G--------------
A6L0K5          I---------------------YT-------------IRR-----G--------------
A7ACT5          I---------------------YT-------------IRR-----G--------------
A6KY94          I---------------------YT-------------VRR-----G--------------
A0A173UQR8      I---------------------YT-------------VRR-----G--------------
A0A3R6HK75      I---------------------YT-------------VRR-----G--------------
A0A412B7D1      I---------------------YT-------------VRR-----G--------------
A0A412VNY9      I---------------------YT-------------VRR-----G--------------
A0A414LTU9      I---------------------YT-------------VRR-----G--------------
I9Q4U4          I---------------------YT-------------VRR-----G--------------
A0A373ISF0      T---------------------YT-------------VRK-----G--------------
U6RF62          T---------------------YT-------------VRK-----G--------------
A0A662ZZD5      T---------------------YT-------------VRK-----G--------------
A0A3A5TI83      T---------------------YT-------------VRK-----G--------------
A0A415NEB6      T---------------------YT-------------VRK-----G--------------
A7AJ60          T---------------------YT-------------VRK-----G--------------
A0A7J5MKN5      T---------------------YT-------------VRK-----G--------------
A0A6A2JF01      T---------------------YT-------------VRK-----G--------------
A0A7J4Y8G3      T---------------------YT-------------VRK-----G--------------
A0A015UXN7      T---------------------YT-------------VRK-----G--------------
A0A6I2NTL0      T---------------------YT-------------VRK-----G--------------
A0A6I2Q447      T---------------------YT-------------VRK-----G--------------
A0A016E4F9      T---------------------YT-------------IRK-----G--------------
A0A6N3HG44      S---------------------YT-------------VRK-----G--------------
A0A7K0HSP7      S---------------------YT-------------VRK-----G--------------
A0A7K1HEJ5      S---------------------YT-------------VRK-----G--------------
A0A6H9P0U9      T---------------------FT-------------IRK-----G--------------
A0A108TH71      T---------------------FT-------------IRK-----G--------------
I8VXH0          T---------------------FT-------------IRK-----G--------------
A0A412S0N6      T---------------------YT-------------IRK-----G--------------
A0A412IIJ0      T---------------------FT-------------IRK-----G--------------
A0A0P0FM97      T---------------------FT-------------IRK-----G--------------
R6KTP3          T---------------------FT-------------IRK-----G--------------
A0A139LU87      T---------------------FT-------------IRK-----G--------------
A0A1C6B3Y5      T---------------------FT-------------IRK-----G--------------
A0A6L3KCD1      T---------------------FT-------------IRK-----G--------------
E2NMQ4          T---------------------FT-------------IRK-----G--------------
A0A412YDB9      T---------------------FT-------------VRR-----G--------------
R7DY01          T---------------------FT-------------VRR-----G--------------
A0A414LGK8      V---------------------FT-------------VRK-----G--------------
A0A415IPQ4      T---------------------FT-------------IRR-----G--------------
A0A3E5BRW7      I---------------------FT-------------VRR-----G--------------
K9DXS6          I---------------------FT-------------VRR-----G--------------
A0A1M6KFV3      S---------------------FT-------------VRR-----G--------------
A0A1Q6G7L3      S---------------------FT-------------VRR-----G--------------
A0A413H235      S---------------------FT-------------VRR-----G--------------
A0A1M5B2J8      N---------------------YL-------------VEG-----R--------------
A0A255RCT5      N---------------------YL-------------VDG-----R--------------
A0A1Y4GLF5      T---------------------YY-------------LPG-----K--------------
A0A1H3XSC0      N---------------------YT-------------VPG-----R--------------
A6LE40          N---------------------YF-------------VPG-----K--------------
A0A4Y1VPX5      N---------------------YF-------------VRG-----K--------------
A0A6N2XMM4      N---------------------YF-------------VRG-----K--------------
B3JI46          N---------------------YF-------------VRG-----K--------------
A0A358R8U0      N---------------------YH-------------IPG-----R--------------
R6WSB6          N---------------------YH-------------IPG-----R--------------
A0A401LPX7      N---------------------YQ-------------TDG-----R--------------
A0A6G0GNY9      N---------------------YQ-------------TDG-----R--------------
A0A6I1BFM0      N---------------------YQ-------------TDG-----R--------------
A0A3A5Z900      N---------------------YQ-------------TDG-----R--------------
A0A7K0GW19      N---------------------YQ-------------TDG-----R--------------
A0A285TGL6      N---------------------YQ-------------TDG-----R--------------
A0A3A5RFX4      N---------------------YQ-------------TDG-----R--------------
A0A1Q6IUW9      N---------------------YQ-------------TDG-----R--------------
A0A413XDP6      N---------------------YQ-------------TDG-----R--------------
A0A6N8CVT6      N---------------------YQ-------------TDG-----R--------------
K6AP24          N---------------------YQ-------------TDG-----R--------------
A0A6I2NHV3      N---------------------YQ-------------TDG-----R--------------
A0A078RYI7      N---------------------YQ-------------TDG-----R--------------
A0A7I0QD01      N---------------------YQ-------------TDG-----R--------------
C7XEQ8          N---------------------YQ-------------TDG-----R--------------
D7INX6          N---------------------YQ-------------TDG-----R--------------
K5ZG55          N---------------------YQ-------------TDG-----R--------------
A0A662ZYI7      N---------------------YQ-------------TDE-----R--------------
A0A3N2N9B8      D---------------------YY-------------SHG-----R--------------
A0A3N2NMI0      N---------------------YF-------------RKG-----R--------------
A0A359I8H7      N---------------------YS-------------TPG-----R--------------
A0A3N2KA63      N---------------------YS-------------TPG-----R--------------
A0A4Q0IMT7      N---------------------YS-------------TPG-----R--------------
A0A7J0B660      N---------------------YS-------------TPG-----R--------------
A0A3B9FAU3      N---------------------YT-------------MEG-----R--------------
A0A3C1E5L7      N---------------------YT-------------MEG-----R--------------
A0A4Q0UAV1      M---------------------YY-------------VDN-----G--------------
A0A354SN68      S---------------------YS-------------ISD-----R--------------
A0A6L5XFL0      Q---------------------YA-------------VKG-----T--------------
A0A3N2N595      N---------------------YF-------------KDG-----T--------------
A0A7J0ACS3      N---------------------YY-------------HSG-----R--------------
A0A0A2DUD9      S---------------------YE-------------APG-----A--------------
A0A3P1ZBJ5      D---------------------YS-------------VEG-----F--------------
R5FHS9          S---------------------YL-------------TDS-----T--------------
A0A413TW79      N---------------------YS-------------EGG-----T--------------
A0A7K0AAG2      N---------------------YS-------------VDG-----T--------------
A0A7K0ASF1      N---------------------YS-------------EDG-----T--------------
A0A3E5E9M7      N---------------------YS-------------EDG-----T--------------
A0A3E4SK73      N---------------------YS-------------EDG-----T--------------
A0A415GGC6      N---------------------YS-------------EDG-----T--------------
A0A413DBH9      N---------------------YS-------------EDG-----T--------------
A0A495WI87      D---------------------YH-------------VDG-----G--------------
A0A354M4S6      D---------------------YH-------------VDG-----G--------------
R7DH52          D---------------------YH-------------VDG-----G--------------
A0A7J5IAE7      N---------------------YF-------------FPG-----K--------------
A0A016CWA4      N---------------------YF-------------VPG-----K--------------
A0A4P8LP09      N---------------------YF-------------VPG-----K--------------
A0A0M1W0V2      N---------------------YF-------------VPG-----K--------------
A0A139KA16      N---------------------YF-------------VPG-----K--------------
A0A174VQ92      N---------------------YF-------------VPG-----K--------------
A0A1Q6HCG0      N---------------------YF-------------VPG-----K--------------
A0A1Y4JYM9      N---------------------YF-------------VPG-----K--------------
A0A3A5QW67      N---------------------YF-------------VPG-----K--------------
A0A3A5RQE6      N---------------------YF-------------VPG-----K--------------
A0A3A6BP07      N---------------------YF-------------VPG-----K--------------
A0A3E5E153      N---------------------YF-------------VPG-----K--------------
A0A3Q9IP20      N---------------------YF-------------VPG-----K--------------
A0A412WV15      N---------------------YF-------------VPG-----K--------------
A0A413ICP6      N---------------------YF-------------VPG-----K--------------
A0A414KYB9      N---------------------YF-------------VPG-----K--------------
A0A5B3FWR2      N---------------------YF-------------VPG-----K--------------
A0A7J5QHB9      N---------------------YF-------------VPG-----K--------------
E5WX00          N---------------------YF-------------VPG-----K--------------
K0X3P3          N---------------------YF-------------VPG-----K--------------
A0A1C6H117      N---------------------YF-------------VPG-----K--------------
A0A6I1AQV4      N---------------------YF-------------VRG-----K--------------
A0A5C6L2P1      N---------------------YF-------------VRG-----K--------------
A0A412MJT7      N---------------------YF-------------VRG-----K--------------
A0A3E4WKT5      N---------------------YF-------------VRG-----K--------------
A0A3A5YY33      N---------------------YF-------------VRG-----K--------------
A0A1E9CFZ7      N---------------------YF-------------VRG-----K--------------
A0A373FYU5      N---------------------YF-------------VRG-----K--------------
A0A3A5TZ72      N---------------------YF-------------VRG-----K--------------
A0A3A5XBP2      N---------------------YF-------------VRG-----K--------------
A0A3A6MEG9      N---------------------YF-------------VRG-----K--------------
A0A3E4JP35      N---------------------YF-------------VRG-----K--------------
A0A3E4KP40      N---------------------YF-------------VRG-----K--------------
A0A3E4NX82      N---------------------YF-------------VRG-----K--------------
A0A3E4XFU8      N---------------------YF-------------VRG-----K--------------
A0A412RG70      N---------------------YF-------------VRG-----K--------------
A0A412TD37      N---------------------YF-------------VRG-----K--------------
A0A413GAA4      N---------------------YF-------------VRG-----K--------------
A0A414M7I4      N---------------------YF-------------VRG-----K--------------
A0A496BTA0      N---------------------YF-------------VRG-----K--------------
A0A496D2V6      N---------------------YF-------------VRG-----K--------------
A0A5C6KCA6      N---------------------YF-------------VRG-----K--------------
A0A5M5AHM5      N---------------------YF-------------VRG-----K--------------
A0A6I0Y5K7      N---------------------YF-------------VRG-----K--------------
A0A6I1BFB8      N---------------------YF-------------VRG-----K--------------
A0A6I2P5W5      N---------------------YF-------------VRG-----K--------------
A0A6N8DC51      N---------------------YF-------------VRG-----K--------------
A0A7J5HGP0      N---------------------YF-------------VRG-----K--------------
A0A7J5HVL8      N---------------------YF-------------VRG-----K--------------
A0A7J5JHD3      N---------------------YF-------------VRG-----K--------------
E5UZA2          N---------------------YF-------------VRG-----K--------------
A0A069SMG6      N---------------------YF-------------VRG-----K--------------
C3RFN5          N---------------------YF-------------VPG-----K--------------
A0A3A5Z014      N---------------------YF-------------VPG-----K--------------
A0A7J5GD93      N---------------------YF-------------VPG-----K--------------
A0A7K0HGR5      N---------------------YF-------------VPG-----K--------------
A0A078S3Q8      N---------------------YF-------------VPG-----K--------------
A0A069SJV7      N---------------------YF-------------VPG-----K--------------
A0A3E5DXI5      N---------------------YF-------------VPG-----K--------------
A0A3E5EM98      N---------------------YF-------------VPG-----K--------------
A0A6N2YYD4      N---------------------YF-------------VPG-----K--------------
I9T3G6          N---------------------YF-------------VPG-----K--------------
A0A3E4SYU0      N---------------------YF-------------VPG-----K--------------
A6LGY1          N---------------------YF-------------VPG-----K--------------
K5ZSH4          N---------------------YF-------------VPG-----K--------------
A0A6A2RTB3      N---------------------YF-------------VRG-----K--------------
A0A7J5PEN4      N---------------------YF-------------VRG-----K--------------
A0A1M4YZ07      N---------------------YF-------------VPG-----K--------------
A0A7J5I238      N---------------------YF-------------VPG-----K--------------
A0A0P0FQW1      N---------------------YF-------------VPG-----K--------------
A0A7K0I229      N---------------------YF-------------VPG-----K--------------
A0A5M5C0W6      N---------------------YF-------------VPG-----K--------------
A0A642NJ89      N---------------------YF-------------VPG-----K--------------
A0A6L3JTQ2      N---------------------YF-------------VPG-----K--------------
A0A7J5FQU6      N---------------------YF-------------VPG-----K--------------
A0A7J4YLH7      N---------------------YF-------------VPG-----K--------------
A0A6N3AEV2      N---------------------YF-------------VPG-----K--------------
A0A6G0G4T5      N---------------------YF-------------VPG-----K--------------
A0A6L3KG29      N---------------------YF-------------VPG-----K--------------
A0A1Y4PQK7      S---------------------YY-------------APG-----R--------------
A0A1Y4IH41      S---------------------YY-------------APG-----R--------------
A0A3A6AAP4      S---------------------YY-------------APG-----R--------------
A0A6I0ZRD2      S---------------------YY-------------APG-----R--------------
A0A7L4SP06      S---------------------YY-------------APG-----R--------------
A0A1Y4DYA7      N---------------------YY-------------TKG-----V--------------
A0A1Y3X4I9      N---------------------YS-------------TDG-----T--------------
A0A1Y4FNK8      N---------------------YY-------------TDG-----G--------------
A0A355FD59      D---------------------YQ-------------ING-----P--------------
A0A359CEZ9      D---------------------YQ-------------ING-----P--------------
A0A353Q7B4      D---------------------YQ-------------ING-----P--------------
F8X3A5          N---------------------YQ-------------IKD-----A--------------
A0A1M3KVR9      N---------------------YQ-------------IKD-----S--------------
A0A4Y9IJS3      N---------------------YQ-------------IKD-----S--------------
A0A1H4ADG3      N---------------------FS-------------TYK-----D--------------
A0A5B8VUR8      S---------------------FS-------------TYK-----D--------------
A0A0D3L8Q3      T---------------------YY-------------GDG-----R--------------
A0A7G7G5F9      S---------------------YF-------------VEG-----P--------------
A0A2N3U785      N---------------------YY-------------VEG-----H--------------
A0A5B6TJH8      N---------------------YY-------------IEG-----Q--------------
A0A519U664      S---------------------YY-------------VEG-----K--------------
A0A519MA34      S---------------------YY-------------VEG-----K--------------
A0A519UCX0      S---------------------YY-------------VKG-----R--------------
A0A0E3ZG78      G---------------------YY-------------IEG-----R--------------
A0A1I6BRK6      R---------------------YY-------------VEE-----R--------------
A0A243WAB1      N---------------------YY-------------VEG-----K--------------
A0A6G8C8X6      S---------------------YY-------------VEG-----K--------------
A0A416GA42      C---------------------YQ-------------VKG-----F--------------
A0A1T3IYP5      S---------------------YK-------------IHS-----G--------------
A0A1T5K9D4      N---------------------YI-------------HHV-----G--------------
A0A077ENE7      S---------------------YK-------------VHK-----G--------------
A0A7H1Z2Z7      S---------------------YK-------------VHK-----G--------------
A0A6I5UW06      S---------------------YK-------------VHK-----G--------------
T0NN57          S---------------------YK-------------VRY-----G--------------
X5K347          S---------------------YK-------------VRY-----G--------------
A0A060RD97      S---------------------YS-------------YMG-----R--------------
A0A3C1ITV0      T---------------------YK-------------SKN-----W--------------
R7HN19          T---------------------YK-------------SKN-----W--------------
A0A350IHV0      S---------------------YV-------------EKQ-----F--------------
R5RVP0          T---------------------YV-------------EKQ-----F--------------
R6A0L2          D---------------------YT-------------TKE-----K--------------
R7LG80          D---------------------YL-------------MPV-----S--------------
A0A2L2WX98      D---------------------YT-------------IKE-----S--------------
G5GD56          D---------------------YT-------------TSA-----G--------------
R5KD55          S---------------------YT-------------TRG-----T--------------
A0A174QNT3      N---------------------YV-------------VRN-----G--------------
A0A4S2FGS1      E---------------------YT-------------LRN-----G--------------
A0A7K3KG59      D---------------------YT-------------IRD-----G--------------
R9I0H0          D---------------------YT-------------IRD-----G--------------
K5BUT9          D---------------------YA-------------KDG-----I--------------
A0A174FPA3      G---------------------YA-------------KDG-----I--------------
R6S9Y6          G---------------------YA-------------KDG-----I--------------
A0A7J4YSB2      G---------------------YA-------------KDG-----I--------------
C9KX15          G---------------------YA-------------KDG-----I--------------
A0A6H0KRK1      S---------------------YE-------------KDG-----F--------------
R6DAG6          S---------------------YE-------------KEG-----F--------------
A0A3L8AAP1      S---------------------YE-------------KEG-----F--------------
A0A4S2AYX2      S---------------------YE-------------KEG-----F--------------
A0A7J0A2L4      S---------------------YE-------------KEG-----F--------------
A0A7K3MN31      S---------------------YE-------------KEG-----F--------------
A0A0E2M2Y7      S---------------------IS-------------KDG-----F--------------
A0A0K2J6Z0      S---------------------IS-------------KDG-----F--------------
B2RKZ8          S---------------------IS-------------KDG-----F--------------
A0A212GC82      S---------------------IS-------------KDG-----F--------------
A0A254MU12      S---------------------IS-------------KDG-----F--------------
R6CQ93          D---------------------YR-------------VEK-----G--------------
A0A3D1NQW3      Q---------------------YE-------------TKD-----G--------------
B0MT10          Q---------------------YE-------------TKD-----G--------------
R7JGW9          Q---------------------YE-------------TKD-----G--------------
A0A3D2BF46      N---------------------YV-------------VKH-----G--------------
A0A358R538      D---------------------YS-------------VRD-----R--------------
A0A1Y4AAB8      G---------------------YS-------------KRS-----G--------------
A0A1Y3WWY9      A---------------------YS-------------IHE-----H--------------
A0A1Y4U5L4      A---------------------YS-------------IHE-----H--------------
A0A1Y3VCJ1      N---------------------YT-------------VDG-----R--------------
A0A1Y3QTW7      N---------------------YS-------------VRD-----G--------------
R6XWY7          N---------------------YS-------------VRD-----G--------------
A0A4Y1X9Y9      N---------------------YS-------------VRD-----G--------------
A0A4Y1WM66      N---------------------YS-------------VRD-----G--------------
A0A6N4GYT3      N---------------------YS-------------VRD-----G--------------
A0A174AVF1      N---------------------YS-------------VRD-----G--------------
A0A656Q4F4      N---------------------YS-------------VRD-----G--------------
A0A1Q6EIY0      N---------------------YS-------------VRE-----G--------------
A0A5B5VN71      N---------------------YS-------------VRE-----G--------------
E4M8L3          N---------------------YS-------------VRE-----G--------------
I3YQ50          N---------------------YS-------------VRE-----G--------------
R5UEY8          N---------------------YS-------------VRE-----G--------------
A0A1H4D866      S---------------------YS-------------VRE-----R--------------
A0A5B3G4Y7      N---------------------YS-------------VSE-----R--------------
A0A374A9J5      N---------------------YS-------------VSD-----G--------------
A0A5B3GQN5      N---------------------YS-------------VSD-----G--------------
A0A1Q6E9S3      N---------------------YS-------------VSD-----G--------------
D4IJ36          N---------------------YS-------------VSD-----G--------------
A0A414Q925      S---------------------YK-------------EWD-----G--------------
A0A415PUS9      S---------------------YK-------------EWD-----G--------------
A0A108TCU0      S---------------------YK-------------EWD-----G--------------
A0A413BA42      S---------------------YK-------------EWD-----G--------------
S3Y344          S---------------------YK-------------EWD-----G--------------
A0A7J5LEW3      S---------------------YK-------------EWD-----G--------------
A0A412TGL3      S---------------------YK-------------EWD-----G--------------
A0A413VJ33      S---------------------YK-------------EWD-----G--------------
A0A414L0W6      S---------------------YK-------------EWD-----G--------------
A0A412DP39      S---------------------YK-------------EWD-----G--------------
A0A413ZSE8      S---------------------YK-------------EWD-----G--------------
B0NP84          S---------------------YK-------------EWD-----G--------------
R6AK43          S---------------------YK-------------EWD-----G--------------
A0A412N2D9      S---------------------YK-------------EWD-----G--------------
A0A1Y4JYS9      S---------------------YK-------------EWD-----G--------------
R6LHA4          S---------------------YK-------------EWD-----G--------------
A0A3E5HPT8      S---------------------YM-------------VRD-----G--------------
C6IJ48          S---------------------YM-------------VRD-----G--------------
Q8A3U2          S---------------------YM-------------VRD-----G--------------
A0A3R6S1H6      S---------------------YR-------------VEA-----G--------------
A0A3R6SD81      S---------------------YR-------------VEA-----G--------------
A0A354WXN6      N---------------------YS-------------IKE-----G--------------
A0A7G1HW11      G---------------------YV-------------MQG-----G--------------
R5IP14          G---------------------YV-------------MQG-----G--------------
A0A316SZX7      N---------------------YT-------------EDM-----G--------------
A0A1Y4AIY1      S---------------------YT-------------EKR-----G--------------
A0A0J6CIR2      S---------------------YT-------------IKD-----G--------------
A0A3D8HG59      S---------------------YT-------------QKR-----G--------------
A0A3R6S408      S---------------------YT-------------QKR-----G--------------
F3ZRU7          T---------------------YS-------------VRQ-----G--------------
A0A1C5Q1F3      F---------------------YS-------------VKG-----K--------------
R7A239          F---------------------YS-------------VKG-----K--------------
A0A3R6HIK7      S---------------------YQ-------------VKR-----G--------------
K5ZVW7          S---------------------YQ-------------VKR-----G--------------
A0A1Y4D5Z0      S---------------------YT-------------VKQ-----G--------------
A0A413VXJ7      S---------------------YK-------------IKE-----G--------------
I9RSN9          S---------------------YK-------------IKE-----G--------------
U6RJK5          S---------------------YK-------------IKE-----G--------------
A0A1Q6GA32      S---------------------YK-------------IKE-----G--------------
I9RPU6          S---------------------YK-------------VKN-----G--------------
I8YFS5          S---------------------YK-------------VKN-----G--------------
A0A7J4XCM0      S---------------------YK-------------VKN-----G--------------
I8Y597          S---------------------YK-------------VKN-----G--------------
A0A1Q6GBF5      S---------------------YK-------------VKN-----G--------------
I8YFZ3          S---------------------YK-------------VKN-----G--------------
A0A7J4XFW0      S---------------------YK-------------VKN-----G--------------
A0A1Q6GDH2      S---------------------YK-------------VKN-----G--------------
U6RSB0          S---------------------YK-------------VKN-----G--------------
I9GXM2          S---------------------YK-------------VKN-----G--------------
I9SIK1          S---------------------YQ-------------VKN-----G--------------
A0A7J4XIJ5      S---------------------YQ-------------VKN-----G--------------
I9TP59          S---------------------YQ-------------VKN-----G--------------
R5S343          I---------------------YT-------------TKR-----G--------------
A0A1M6K7I9      S---------------------YK-------------VRI-----G--------------
A0A5M6A8C8      S---------------------YK-------------VRI-----G--------------
A0A7J4XCJ1      S---------------------YT-------------VKN-----G--------------
A0A7J4XNQ7      S---------------------YK-------------IRN-----G--------------
A0A3R5ZMK1      S---------------------YT-------------VKD-----G--------------
A0A7K1HMX0      S---------------------YT-------------VKE-----G--------------
A0A1Y3ZIA4      S---------------------YT-------------VKD-----G--------------
K5Y1A4          S---------------------YT-------------VKD-----G--------------
A0A7K1HDC0      S---------------------YT-------------VKD-----G--------------
A0A3R6K8X4      S---------------------YT-------------VKD-----G--------------
A0A6N8D6C8      S---------------------YT-------------VKD-----G--------------
A0A3R6BKI7      S---------------------YT-------------VKD-----G--------------
A0A412M2W1      S---------------------YT-------------VKD-----G--------------
K5ZX55          S---------------------YT-------------VKD-----G--------------
A0A415BDM7      S---------------------YT-------------VKD-----G--------------
A0A1Q6I3T6      S---------------------YT-------------VKD-----G--------------
A0A414XX40      S---------------------YT-------------VKD-----G--------------
A7AEU7          S---------------------YT-------------VKD-----G--------------
A0A5F0U645      S---------------------YS-------------IRE-----G--------------
K5ZBN2          S---------------------YS-------------IRE-----G--------------
A0A0J6CKW3      S---------------------YS-------------IRE-----G--------------
A0A0F5IQM7      S---------------------YS-------------IRE-----G--------------
A0A496CDT3      S---------------------YS-------------IRE-----G--------------
A0A6G1ZKM3      S---------------------YS-------------IRE-----G--------------
S0GLB0          S---------------------YS-------------IRE-----G--------------
A0A3R6NLC1      S---------------------YS-------------IRE-----G--------------
A0A416WYC9      S---------------------YS-------------IRE-----G--------------
A0A0F5IT40      S---------------------YT-------------IKD-----G--------------
A0A496CX20      S---------------------YT-------------IKD-----G--------------
A0A5F0UBI0      S---------------------YT-------------IKD-----G--------------
A0A6G1ZHG0      S---------------------YT-------------IKD-----G--------------
S0GSI7          S---------------------YT-------------IKD-----G--------------
K5YB65          S---------------------YT-------------IKD-----G--------------
A0A0F5IWP9      G---------------------YT-------------VKE-----G--------------
A0A0F5IZT8      G---------------------YT-------------VKE-----G--------------
A0A417LKQ2      S---------------------YT-------------VKE-----G--------------
A0A416TME1      S---------------------YT-------------EKD-----G--------------
A0A416XPE8      S---------------------YT-------------EKD-----G--------------
A0A3B0C2S4      S---------------------YF-------------QKG-----N--------------
L8JI02          S---------------------YF-------------SKE-----S--------------
A0A4Q5WS95      P---------------------VF-------------ESG-----R--------------
A0A501VZX6      P---------------------VF-------------EEG-----K--------------
A0A399SH26      P---------------------VY-------------EDT-----K--------------
A0A501W1A9      P---------------------IF-------------EES-----R--------------
A0A0E3ZGV6      P---------------------VY-------------EET-----K--------------
A0A1I2N4S1      P---------------------IY-------------EED-----R--------------
A0A2T5YE44      P---------------------IY-------------EED-----R--------------
A0A1M5BA90      P---------------------IF-------------EDG-----P--------------
A0A512B879      P---------------------VF-------------EAT-----P--------------
A0A559PPI3      P---------------------VY-------------EEKDFFGLN--------------
A0A1T5CS78      P---------------------IY-------------EDG-----R--------------
A0A0Q9Z8F1      P---------------------IY-------------EDA-----G--------------
A0A2N0U0M7      P---------------------IY-------------EDT-----G--------------
A0A1V9FHD0      P---------------------VS-------------EAADFGSLK--------------
A0A4V4H170      P---------------------VY-------------EAPDYKQGK--------------
A0A1V9F098      P---------------------IY-------------EAAG-NKGK--------------
A0A4R2VU64      P---------------------VY-------------EDAG-NKGK--------------
A0A4S8HY23      P---------------------VF-------------EAPDFKKRK--------------
A0A1V9F383      P---------------------IN-------------EGPEYSMGK--------------
G8TRZ6          P---------------------IY-------------EGIDFSQWK--------------
A0A4R5DL69      S---------------------YF-------------VSG-----N--------------
A0A1M4YED3      E---------------------IK-------------EET-----Q--------------
A0A2H3NSN0      D-----------------------------------------------------------
A0A2P6C324      D-----------------------------------------------------------
A0A7C2DZI7      N-----------------------------------------------------------
A0A1M6XHU0      E-----------------------------------------------------------
G2SF81          E-----------------------------------------------------------
A0A5S9EYW1      E-----------------------------------------------------------
D0MHQ9          E-----------------------------------------------------------
A0A126PFG0      L---------------------YQ-------------QRD-----H--------------
A0A3M1N7Z3      E---------------------VY-------------SIG-----K--------------
                                                                            

A0A1T5MMH4      --------LNH--ELFGN---------S-PILV-SY-------------KIE--NP----
A0A2W4R1L8      --------LNY--EFFGN---------L-PFTV-DY-------------TIT--RP----
A0A2E5CV79      --------LFNTRKYYPR---------GEKYRRILK-------------EIM--SL----
A0A2D4ZVH1      -------------DQYGN---------KFPILWRAY-------------PVDSTST----
A0A0K8QSK7      --------LDP--EVYTA---------A-PFVV-EW-------------DRS--HP----
A0A1V6CN82      --------STA--ENYTD---------A-AFRV-EW-------------DRN--HP----
A0A1M4XZ45      --------AIA--ERYEE---------V-PFQV-IW-------------DED--HP----
A0A399D319      --------AVS--ERYKE---------V-PFQV-VW-------------DEE--HP----
A0A1V5IPN7      ---------------------------S-AYPV---------------------GN----
A0A1M6GR99      -------------NAYNE---------S-PFKVFIF-------------KEH--------
A6EBM4          --------LQT--DLYPQ---------Q-PLQIDIL-------------KIDSLQS----
A0A7C5M4P4      --------LVD--EKFRN---------P-PFTV-DC-------------QLK--NA----
A0A1M6TTV4      --------LSD--ERYGN---------S-PFQV-LY-------------NEL--SS----
A0A4Q8RX32      --------YNE--NLYTS---------S-PFEV-II-------------DKN--HLQMTN
K0X1U5          --------KKK--EYYRN---------S-PFTVD--------------------IPESMV
R5EXK3          --------KKK--EYYRN---------S-PLTVE--------------------IPESMV
A0A401UAP7      --------LDY--ELYKN---------S-PFKVTPI-------------EVN--NS----
A0A1W2GF52      --------VD---ERYGN---------S-PFEV-QY-------------DLT--NS----
A0A2G5L7B8      --------YD---ERYGN---------S-PFIV-DV-------------QVS--DP----
A0A523GAC0      --------LED--EKYRS---------P-PFKV-EY-------------TFL--DN----
L8JW09          --------LND--EKFKT---------S-PFIV-DY-------------NLK--NP----
A0A364XUP5      --------LNH--ELFGN---------T-PYHI-EY-------------KNV--DD----
A0A1M5RLA9      --------LND--ELFQN---------A-PFLV-RY-------------KAQ--NE----
A0A385SFR9      --------LND--ELFQS---------A-PFVV-RY-------------KAQ--NE----
A0A5M4A9J4      --------MGLEKELYNN---------A-PFRI-EW-------------LSR--HQ----
A0A5M4B1C7      --------WGHTSELYHK---------S-PFVV-KW-------------NKG--HP----
A0A0D3LFR6      --------LDD--EKYRS---------A-PFKV-DY-------------LLK--DE----
M7N6D4          --------LDD--EKYRS---------S-PFEV-SY-------------LVK--DE----
A0A4D7K1D4      --------KNE--ERYRN---------K-PFRV-DY-------------QVK--SADLHN
A0A5C7MX19      --------ISE--ELYKN---------C-PFEL-KM-------------DVK--DL----
A0A1Q3ZMZ7      --------LTS--QIYQS---------S-SLGYKSL-------------LIK--DS----
A0A2D8JJW3      --------FKYKEDKKDT---------V-SFLFNNE-------------IID--VPIHIK
A0A2W2AFF7      --------KKT--PLYED---------V-PFHFVFI-------------PLY--EDSVSK
R7PCR1          --------RPI--SLFSI---------R-PFNV-VF-------------QAPFSKA----
A0A2N5YXE2      --------LYT--ELYGN---------T-PFEV-NY-------------RIN--NT----
A0A1G9E2A9      --------VNS--EAYHD---------S-PFRV-EY-------------KLK--SG----
A0A098LL25      --------LYE--ERYNN---------S-PFKV-IG-------------EIK--HP----
A0A6J4H627      --------KNE--ERFLS---------A-PFRV-ET-------------VRL--GP----
A0A6C0GJI1      --------LEE--ERYKN---------S-PFIV-NF-------------DAT--SN----
A0A2T2YJE8      --------LNE--ELYKN---------S-PFKI-TY-------------QLT--NE----
A0A7L7LEW0      --------LNE--ELYKN---------S-PFKI-TY-------------QLT--NE----
A0A127B287      --------LEV--ELYKD---------S-PFKV-AF-------------DSS--RF----
A0A6P1P2P6      --------LEV--ELYND---------S-PFRV-TF-------------DST--NF----
A0A3M9N829      --------LDA--ELYKD---------S-PFAV-NY-------------DTS--AF----
A0A0P0CSF9      --------LDA--ELYKD---------S-PFQV-SY-------------DNE--SF----
A0A5M8QQB8      --------LDA--ELYKD---------S-PFEV-LY-------------DSV--DF----
A0A3M9MNC3      --------LDA--ELYKS---------S-PFEV-VY-------------DST--NF----
A0A5B6TAX2      --------LDA--ELYKD---------S-PFEV-SY-------------DST--NF----
A0A7L5A132      --------LAS--EVYKT---------S-PFRV-EY-------------RIK--DN----
A0A512AYT3      --------LSE--ELYKN---------S-PFKV-IY-------------EIK--DD----
A0A5M6CYN7      --------LSE--ELYNN---------S-PFKI-TY-------------DIK--DG----
A0A369QP10      --------LNE--ELYRS---------S-PFHI-SY-------------EMS--NE----
A0A7G7G7M4      --------LNE--ELYRT---------A-PFGV-TY-------------EIT--NE----
A0A126PDF2      --------LES--ELYGI---------S-PFQI-AY-------------TIK--DK----
A0A2Z3GKA1      --------LES--ELYGI---------S-PFRI-AY-------------TIK--DK----
A0A502GZP7      --------LES--ELYGN---------S-PFHI-AY-------------VVR--DK----
A0A519SBU8      --------LET--EMYNT---------S-PFHV-RY-------------KVS--DP----
A0A4Q3JNZ3      --------LEA--ELYNS---------T-PFHV-QY-------------KIT--DP----
A0A519Q9V3      --------LEA--ELYNS---------A-PFHV-KY-------------KIA--DQ----
A0A0M3RW20      --------LES--ELYKA---------S-PFHI-EY-------------AIK--DP----
A0A495VFX4      --------LES--ELYKT---------S-PFHV-EY-------------YIT--NL----
A0A418R9X5      --------LES--ELYSL---------S-PVRI-EY-------------KAG--KG----
A0A428JSJ3      --------LES--ELYNL---------S-PVRV-EY-------------TAN--KG----
A0A428KI59      --------LES--ELYNL---------S-PVRV-EY-------------KAG--KG----
W8F1I6          --------LES--ELYNL---------S-PIRV-EY-------------KAG--KG----
A0A246FQC0      --------LES--ELYAS---------S-PFIV-KY-------------KPI--NN----
A0A372E5P8      --------LET--EIYGA---------S-PFEV-SY-------------EAT--AN----
A0A1H3EMW1      --------LET--EIYGI---------S-PFEV-SY-------------QAT--AD----
A0A1H9ZSN3      --------LET--EIYGS---------S-PFEV-SY-------------EAL--AD----
A0A1S9B3W0      --------LET--ELYGV---------S-PFHV-TY-------------TVR--EP----
A0A1W1VRL3      --------LES--ELYTR---------S-PFQV-TY-------------KIK--NP----
A0A7G6YQJ9      --------LER--ELYQI---------S-PFKV-SY-------------TVQ--DG----
A0A1M6R305      --------LET--ELYGV---------S-PFRV-DY-------------E----GD----
A0A7G7W8X3      --------LES--ELYGV---------S-PFRV-EY-------------G----GD----
A0A4Z0PHK3      --------LEN--ELYGV---------S-PFNV-EY-------------KIK--DP----
A0A2M9B9H9      --------LEN--ELYGI---------S-PFKV-SY-------------DIK--DP----
A0A4Z0QCY9      --------LET--ELYGI---------S-PFKV-SY-------------TIK--DP----
A0A5N1J2M4      --------LDQ--EVYTD---------S-PFNL-IF-------------KVN--NP----
A0A519S476      --------LES--ELYNN---------A-PFHV-RY-------------KIA--DA----
A0A4Q3JRW8      --------LEA--ELYNN---------S-PFYV-RY-------------KIT--DN----
A0A519M923      --------LEA--ELYSN---------S-PFRI-EY-------------KVT--DN----
A0A4Z0ENW1      --------LEN--ELFGS---------C-PYQV-KY-------------TIS--DP----
A0A519UDB4      --------LET--ELFGN---------S-PFKV-IY-------------TIS--DV----
A0A3S0QKV1      --------LET--ELYGN---------S-PFRV-EY-------------TVR--EP----
A0A328BL48      --------LET--ELYRT---------A-PFRV-EY-------------AVR--EP----
A0A5R8WLY4      --------LET--ELYRT---------A-PFRV-EY-------------TVR--EP----
A0A1I5WSL8      --------LEA--ELYGT---------S-PFKV-IY-------------KIT--DP----
A0A0U3JVM7      --------LES--ELYGI---------A-PFRV-KY-------------HIT--DP----
A0A1G1SSV2      --------LES--ELYGT---------S-PFRV-KY-------------NIT--DP----
A0A1G1SXV7      --------LES--ELYRT---------S-PFRV-KY-------------SIT--DP----
A0A6G8CBJ6      --------LES--ELYKR---------S-PFKV-AY-------------AIK--DP----
A0A0W8EDI5      --------LAS--ELYNA---------T-PFRI-DY-------------DPA--DQ----
A0A3B7RBP8      --------LAN--ELYTD---------T-PFRV-QY-------------STK--DG----
A0A3R9P8H7      --------LET--EMYNT---------S-PFKV-VY-------------TPT--DD----
A0A238WIA7      --------LET--ELYKT---------S-PFKV-EY-------------ESK--NG----
A0A212UCJ7      --------LET--ELYRA---------S-PFKV-EY-------------QTK--GG----
A0A4Z0MQE1      --------LET--ELYRA---------A-PFKV-EY-------------EVRAGGA----
A0A4Z0PCF4      --------LET--ELYRT---------S-PFKV-DY-------------ETKAGGA----
A0A6M6BED0      --------LET--ELYRA---------S-PFKV-VY-------------ETKAGGA----
A0A5D6VDG1      --------LES--ELYGI---------S-PFQV-NY-------------TIT--DP----
A0A243WHR7      --------LEN--ELYGL---------S-PFKV-NY-------------KIK--DG----
A0A5B8A0P6      --------LES--ELYGN---------S-PFKV-EY-------------NIK--NG----
A0A076HRT9      --------LES--ELYGT---------S-PFRV-QY---------------D--GE----
A0A4Z0PVM7      --------LEN--ELYGV---------S-PFKV-AY-------------IIK--DP----
A0A1M6DHW8      --------LEN--ELYGT---------S-PFEV-EY-------------RIK--DA----
A0A4Q5LC61      --------LEN--ELYGT---------S-PFKV-EY-------------NIK--DP----
K0XJ09          --------HYD--QLYAE---------S-PIRVNFL------------------------
R5EUZ0          --------HYD--QLYAE---------S-PIRVNFL------------------------
W0EQS0          --------HYK--SLYAE---------S-PIRVNFI------------------------
A0A1Y3WE15      --------HNK--QLYAE---------S-PIRVDFL------------------------
A0A1Y4GUK3      --------HNK--QLYAE---------S-PLRAHFL------------------------
A0A2U1FKU2      --------RKE--SLYAN---------S-PLSIKIT-------------NRD--ST----
A0A0A2F954      --------RNE--SLYGN---------S-PVSIQIT-------------DRD--ST----
A0A0A2FW91      --------RNE--SLYGN---------S-PVSIQIT-------------DRD--ST----
A0A2D2N2N1      --------RNE--SLYGN---------S-PVSIQIT-------------DRD--ST----
Q7MWZ2          --------RNE--SLYGN---------S-PVSIQIT-------------DRD--ST----
T2NDT6          --------RNE--SLYGN---------S-PVSIQIT-------------DRD--ST----
W1R7P9          --------RNE--SLYGN---------S-PVSIQIT-------------DRD--ST----
A0A1R4AFZ0      --------RNE--SLYGN---------S-PVSIQIT-------------DRD--ST----
A0A1R4DVZ7      --------RNE--SLYGN---------S-PVSIQIT-------------DRD--ST----
A0A7C0WKI7      --------FNS----------------P--------------------------------
A0A2A8CVM9      -----------------------------PLLYGED-------------GQA--RS----
A0A5M4B212      --------RTS--ELYRN---------L-PFHV-EW-------------DRN--HP----
A0A3D1KEX9      --------QPV--TLFKH---------N-PIKVEFL-------------S----------
A0A358Y7S2      --------LTQ--NLYRE---------T-GFSLMVY-------------SLN--DS----
A0A1X7J248      --------KDD--ERYRF---------T-PFTVSYD-------------KSC--AA----
E4TQD2          --------KNE--ERYRF---------S-PFTVSYE-------------KSC--AN----
A0A2J6HHN3      --------LNS--ELYKS---------A-PFKV-YY-------------ELI--DS----
A0A1Y3WMT8      --------FNK--VEYYG---------NSPITVDVP-------------ESM--LD----
A0A1Y4GQU1      --------FSK--KEYYG---------NSPITVDVP-------------ESM--LD----
A0A6A0R272      --------SSY--ELYRK---------S-PINLNLL-------------SAS--DE----
A0A1V5W8T5      --------LTS--ELYNK---------T-PFFV-EY-------------QDV--QS----
A0A2T8HKA9      --------RNI--ELYKD---------S-PIRVTFT-------------KLD--PE----
A0A2I0QZ80      --------LTE--QRYRQ---------G-NLEISPL-------------LLK--DS----
A0A3E1F1A3      --------LTE--TLYKQ---------N-SVSIDPV-------------LLK--DS----
A0A2U2XBJ3      --------LTE--TLYKQ---------G-VVRIMPL-------------IIK--DS----
A0A4Q4KU94      --------LTE--TLYKQ---------G-TIRIKPL-------------IIK--DS----
A0A3B8INU3      --------LDD--EKYKE---------S-PFEA-TI-------------TVR--NP----
A0A2W1NDY9      --------LIE--EKFKQ---------S-PYHLIFY-------------ELK--DS----
A0A5C8AQR5      --------LTE--EMYRT---------S-SFNVQPY-------------SLN--DS----
A0A1G0CI31      --------LTE--EKYLQ---------S-SFNVQPF-------------QLK--DS----
A0A556N0M0      --------LTE--EKYHQ---------S-TFTVLPY-------------ALR--DS----
F2IKD6          --------LTE--EKYHQ---------N-TFTILPY-------------SLS--DS----
A0A1I7BM74      --------LTE--ERYTQ---------S-QFQVQLF-------------KLN--EP----
A0A2G2FJ17      --------LTE--KRYKQ---------S-TFYIKQS-------------HIK--DS----
A0A2E3R1D0      --------LIEAETVPGT---------NRPLPI-LR-------------D----------
A0A2T2USC0      --------LDSMETNPYT---------GEQLSV-LT-------------GPK--DP----
A0A2T2V0F3      --------LDTMETHPRT---------GEPLAV-LT-------------G----------
A0A2T2S682      --------LDTMGTHPRT---------GKPLDV-LT-------------T----------
D5H561          --------LLEQGEARRVLSSQGVSPFGRLMDR-AW-------------A----------
A0A2H3NWA9      --------MDEM--YPEG---------EGPPIM-YT-------------A----------
A0A2A8CVB6      --------LLALGRHPET---------GRPIQM-LS-------------D----------
A0A2P6C1S6      --------LQRMGTHPDT---------GQPLQI-LR-------------G----------
A0A2T2UTM4      --------LQDLGTHPET---------GEPLQI-LR-------------G----------
A0A414ZBF2      --------RKR--ELYNS---------T-PFTV-VF-------------QDA--EPGQEI
A0A1Q3Q573      --------KFITEDLYQS---------A-PFEILPE-------------QIA--PE----
A0A662BAY3      --------KSR--EIYKE---------S-PFEV-IW-------------DYE--HP----
A0A4U3L369      --------RTI--ETFEK---------T-PYSVHLV-------------AMR--DSIAPF
A0A357YNR3      NVPSFLIIKSN--SLYGN---------ESPVLVRMS-------------DKD--LN----
A0A5E8AX52      --------LTE--ERYRN---------S-PFVV-SY-------------KLH--NT----
F4KK08          --------REK--DLYKQ---------S-PVSIRFV-------------NAD--PD----
A0A6B5PK86      --------LTE--EKYKL---------S-SVNVQPY-------------HLN--DS----
A0A2G2F510      --------LTE--EKYLS---------S-SYYIQPY-------------ELY--DS----
A0A316JZ08      --------LTE--ELYLA---------S-SFNIQPY-------------ELV--DS----
A0A496LCF9      --------KNV--PLYGR---------S-PISIEII-------------NIY--EE----
A0A5P2G2A9      --------GIR--ELYKD---------K-PFGI-TL-------------SNN--AD----
A0A3C0ZQC7      -----------IKRGYTD---------S--------------------------------
A0A3N2N6F7      --------RPV--SLYGD---------SMVLSVSLP-------------DIS--VN----
A0A419VXB7      --------GDF--ILYGN---------E-PCHV-EF-------------EPD--AF----
A0A0B0BTJ4      --------RYS--YLTAE---------SSPLKL-----------------TA--DT----
A0A3B9CNN6      --------RYS--YLTAE---------SSPLKL-----------------TA--DT----
R5X290          --------RYS--YLTAE---------SSPLKL-----------------TA--DT----
A0A1Q6E6I7      --------RYS--YLTAE---------SSPLKL-----------------TA--DT----
C3J7R8          --------RTE--MLYKD---------T-PLEVRFV-------------GNS--SD----
A0A1G8BVM8      --------RFK--DLYTS---------S-PIEV-EY-------------MDD--VA----
A0A1I1FXP9      --------VFS--EMYKS---------S-PFRV-EY-------------EVK--NP----
A0A4P7VVU7      --------KNI--TLYGD---------SCPVSVDFL-------------SIP--SK----
A0A2V1ILM4      --------KNI--TLYGD---------SCPVSVNFL-------------SIP--SK----
A0A3N2L0E8      --------KNI--TLYGD---------SCPVSVDFL-------------SIP--SK----
A0A3N2LFC5      --------KNI--TLYGD---------SCPVSVDFL-------------SIP--SK----
A0A7K3KWJ8      --------KNI--TLYGD---------SCPVSVDFL-------------SIP--SK----
A0A3N4H5N3      --------FKK--EISPF---------SLPVEIEVH-------------EIN--ND----
A0A2P8EAX2      --------FKR--EISPY---------NVSINIVVH-------------EFN--EE----
A0A4V2F6N9      --------FKK--ELSPY---------NVPVNLIVH-------------EFN--EE----
A0A3B9FXJ0      --------RNT--DMYYN---------G-PFWV-DI-------------DVQ--DS----
R5GSU5          --------GQS--TLYKK---------R-PFEA-TF-------------LRP--AE----
A0A2A3UE91      --------KNN--ELYDS---------S-PYLI-KI-------------NAK--KG----
A0A0A2G557      --------RSK--KLYKE---------T-PIRL--T-------------LLN--TS----
A0A2N2WFW8      --------LNF--ELYDG---------A-PFHI-QY-------------QIV--DS----
A0A1F3IU95      --------LNF--ELYDD---------V-PFDI-KY-------------EIV--DS----
A0A3D0VUF6      --------LNF--ELYDD---------V-PFDI-KY-------------EIV--DS----
A0A1T4PT95      --------SSK--KLYKD---------S-PIHLTLL-------------EFP--ED----
A0A6I6JYY3      --------KTS--ERYRE---------V-PFTV-EW-------------DEA--HP----
A0A2A4PYG9      --------LDS--EIYTA---------S-PYTV-EV-------------RNV--GP----
A0A1F3K695      --------LTN--ELYRM---------S-PFTV-EA-------------NIL--DS----
A0A353KZR1      --------LTN--ELYRM---------S-PFTV-EA-------------NIL--DS----
A0A2N2WYB5      --------LST--ELYKR---------S-PFKV-EW-------------KTL--NP----
A0A1F3K4G0      --------LST--ELYRR---------S-PFQI-EW-------------KMI--TG----
A0A356H8Y3      --------LST--ELYRR---------S-PFQI-EW-------------KMI--TG----
A0A351HSA6      --------LST--ELYRR---------S-PFQI-EW-------------KMI--TG----
A0A1F3Q014      --------KNN--ELYTS---------S-PYSV-DY-------------KII--NP----
A0A2D5KD44      --------LRN--EIYKN---------A-PFNV-EV-------------LYK--EP----
A0A6N9NIX1      --------LEK--ELYVE---------S-PFVV-EF-------------DLI--DS----
A0A2A4YXP3      --------LTN--ELYRS---------S-PIKV-EH-------------QVK--DS----
A0A1F3R158      --------LTF--ELYKN---------S-PINI-EY-------------YIK--DS----
A0A2M8ADX2      --------LTF--ELYKN---------S-PLDV-NY-------------DIK--DS----
A0A1J5B2H0      --------LNF--ELYKS---------S-PFEI-KY-------------SIK--NP----
A0A1V5N756      --------LNT--EMYRS---------N-HYNV-HY-------------VVK--KP----
A0A651GU15      --------LTR--QLYRV---------P-QPKLNLV-------------AIT--DS----
A0A3Q9FR88      --------RDS--ELFGD---------AVPFTFEYP-------------NNV--QP----
A0A553GEX3      --------RNS--ELFGD---------AVPFTFEYP-------------NNI--QP----
A0A150ADJ9      --------RDS--ELFGK---------NLPFSITFP-------------SGK--LP----
A0A1B1FWQ4      --------RDS--ELFED---------GVPFTLTYP-------------SGK--QP----
A0A1S1Z228      --------RDS--ELFGD---------GVPFTLTYP-------------SGK--QP----
A1ZKR2          --------LDA--EYYKN---------P-PFKVIDH-------------QVK--SD----
A0A1Q3GX01      --------LEA--EYYTN---------A-PFKVVDY-------------KIK--AP----
A0A349DQI4      --------LEA--EYYTN---------A-PFKVVDY-------------KIK--TP----
A0A4P5TMD1      --------LVE--ERYKT---------S-PFEI-VP-------------TVN--EP----
A0A2N3IIZ0      --------LDN--EMHGF---------S-PIEV-QA-------------VVL--NE----
A0A7K3WUF2      --------LTD--QRYPT---------S-SFVLELI-------------AIK--DS----
A0A1F3SJM1      --------LTE--EKYLS---------S-SFHVQPY-------------ELR--DS----
A0A2G2EB96      --------LTE--EKYLS---------S-AFNIQPY-------------QLS--DS----
A0A2G6PRA9      --------LTE--EKYLS---------S-SFNIQPY-------------ELS--DS----
A0A497D5Z2      --------MTS--EMYRN---------P-PFRV-QW-------------EEG--HP----
A0A662B170      --------MTS--EMYRN---------P-PFRV-QW-------------EEG--HP----
A0A2A5FYT6      --------MAT--ENYAN---------H-PYSV-GF-------------QVK--DS----
A0A2E6SYP1      --------LNT--ENYRS---------S-KYKI-SY-------------QIK--DK----
A0A2E5RLE8      --------LNT--ENYHS---------N-PFSI-SY-------------QLK--KR----
A0A2E7TQF6      --------LNT--ENYHS---------N-PFSI-SY-------------QLK--KR----
A0A2E6GVY9      --------LNT--ENYQS---------N-PFSI-SY-------------QLK--KR----
A0A350JJ90      --------LNH--ERYLS---------S-DFEV-IY-------------EIH--DP----
A0A3M1CDV2      --------KNH--ELYKN---------S-PYLA-DI-------------NIK--NE----
A0A6C1QGZ7      --------LNH--ELYRN---------S-PFTV-DI-------------IVK--DP----
A0A4P5U6G4      --------LVE--EKYKS---------S-PFEI-LP-------------LVK--TN----
A0A2E2TFD1      --------LNY--ELYMS---------S-PYIV-DY-------------DII--SA----
A0A2E4ELE6      --------LTF--EHYKS---------C-PFEV-KF-------------EIK--SP----
A0A522EYA6      --------KEN--EHYGT---------T-VYTA-ET-------------EVK--SD----
A0A2E3XZI5      --------ISR--LLYKK---------N-TYKLENF-------------YIK--DS----
A0A6I7QXV0      --------RVVHSELYRS---------S-PFTITID-------------EIK--DP----
A0A2M7NLQ9      --------WFNYFERFQD---------S-PFEVTEY-------------EVY--DA----
I4AFR0          --------WFNYFERFQD---------S-PFEVTDY-------------EVY--DN----
A0A2N2Y3E5      --------LET--EQYRN---------S-PFTV-VF-------------RNE--GF----
A0A2D9D7T6      --------LTK--DLYRS---------N-LVSVEPV-------------KLL--DS----
A0A1F3PPL5      --------LSN--EMYKS---------S-PFEV-KV-------------KIN--NG----
A0A357QK06      --------LSN--EMYKS---------S-PFEV-KV-------------KIN--NG----
A0A662AEA4      --------QST--ELYRT---------S-PFIV-KT-------------KIK--NP----
A0A0S2HYK8      --------LSD--EIYQS---------S-PFEI-QY-------------KIK--DS----
A0A2N5ZWN6      --------LST--ETYNN---------S-SYSV-NY-------------EIQ--NP----
A0A2E0FJ09      --------LKH--EKYNG---------S-LFLVEDF-------------QLL--NS----
A0A1F3FZ62      --------LNF--DVYRN---------T-PFII-EQ-------------KVF--NP----
A0A1F3K211      --------LNF--DVYRN---------T-PFII-EQ-------------KVF--NP----
A0A1V6I2U9      --------LST--ELYGS---------T-PFEI-KY-------------NII--NT----
A0A2H0B957      --------LVS--ELYKA---------T-PFTV-DF-------------HIT--KG----
A0A1F3CFW6      --------LEN--ELYKA---------N-PFSI-DY-------------KNT--KR----
A0A2M7E2T8      --------LEN--ELYKA---------N-PFSI-DY-------------KNT--KR----
A0A2M7NC69      --------LEN--ELYKA---------N-PFSI-DY-------------KNT--KR----
A0A1F3KLL5      --------LST--ETYRT---------S-SYII-EV-------------RNV--EP----
A0A359D1M1      --------LST--ETYRT---------S-SYII-EV-------------RNV--EP----
A0A0F2NS19      --------LEY--ELYKN---------S-PFKV-FF-------------EVK--DS----
A0A2A5H8X6      --------LEY--ELYKN---------S-PFKV-FF-------------EVK--DS----
A0A2H0GAU8      --------LNN--ELYVG---------S-PMKV-NY-------------AIK--DS----
A0A2M8FTK1      --------LNN--ELYVG---------S-PMKV-NY-------------AIK--DS----
A0A2A5B3B0      --------LIN--ELYRS---------T-PIKV-SY-------------VIK--DS----
A0A5C6RXM7      --------LEH--ELYKS---------A-PIDV-EF-------------NIK--DS----
A0A1F3C1M2      --------LKN--ELYKN---------A-PFTI-EF-------------NIK--NN----
A0A1F3DS87      --------LKN--ELYKN---------E-PFSI-EF-------------NIK--NN----
A0A6A0R6K9      --------LTN--EIYSN---------N-PFDV-NI-------------LWK--DS----
A0A2E7CT70      --------LTS--DLYKT---------S-PFEIKDL-------------KIR--DS----
A0A2D5V560      --------ITR--FLYNQ---------S-PXSFENF-------------SIK--DM----
A0A2D7K5A8      --------LTR--FLYNQ---------S-PFIFENF-------------SVK--DE----
A0A2E1XQ82      --------LTR--FLYNQ---------S-PFIFENF-------------SVK--DE----
A0A5C8A5B4      --------FL-KQEQYAY---------P-PFFVKLDSMAIQVIDVPIEVEVD--RAART-
A0A7C1LGX3      --------LK-DKQVWDA---------P-FIVVKET-------------SEE--LKKAQS
A0A4Y9ITE2      --------FL-KKKLKYD---------NTPVEIVIP-------------PMF--SDTVSE
A0A5M8NYX7      --------LK-KNEL-YN---------QTPLWVILK-------------NQI--G-----
A0A0E3V905      --------FG-KREI-YT---------DSPIELIVE-------------SGK--PELYKK
A0A553ETH6      --------VL-IDEK-YQ---------NSPFRVKFI-------------VKD--GNVYDK
A0A640Q161      ------------------------------------------------------------
A0A640QU49      ------------------------------------------------------------
A0A1Q3PII2      --------LK-TTEL-YE---------KTPYKITLL-------------KPR--T--AKP
A0A351BXT2      ------------------------------------------------------------
A0A2K8Z965      --------FS-KREL-YE---------DSPIELIIE-------------QPI--SALYKS
A0A418M8U8      --------FG-KREI-YK---------ASPVDVFVE-------------FGK--PELYEE
I2GTA4          --------FG-KREI-YK---------ASPVEVFIE-------------FGK--PELYEA
A0A2K8ZAJ2      --------TL-KKHI-YQ---------ESPIRLIVE-------------KPT--SQLYME
A0A368JPA3      --------FG-KREI-YE---------EAPIRIVLT-------------DPT--PNLYRA
A0A5N1JI29      --------FG-KREI-YE---------EAPIRIVLT-------------DPT--PNLYRA
A0A7K0EGC9      --------FG-KREI-YS---------DAPVRVVLN-------------APT--ANLYRA
A0A3P1BT12      --------FG-KREI-YD---------DAPLRIILK-------------EPT--ANLYRA
A0A3P1CI15      --------FG-KREI-YE---------EAPIRLVLS-------------DPT--PNLYRA
A0A4R8CUK1      --------FG-QREI-YD---------NTPVRLVLD-------------SPT--PNLYRA
A0A3D0MYJ7      --------------------------------LDTL-------------NTI--KDIDKS
A0A662AH13      --------------------------------IDSF-------------NVI--D--KPD
A0A5C7QA01      --------IF-KDNL-KS---------LHIKQFDLP-------------EAY--L--DQP
A0A3D3LS70      --------------------------------IDSF-------------KNS--D--SKT
A0A1G1TM36      --------FS-AQDL-YG---------KSPVQLTFL-------------HTL--R--GQH
A0A1G7ZF38      --------LK-TTEL-YD---------KTPYKVRFL-------------KSR--P--AKP
C6VS52          --------LK-TTEL-YE---------KAPYRVRFI-------------QKQ--P--PRP
A0A2A4G4B1      --------FK-NTELFLD---------K-PFKLEWL-------------SPI--NDS---
A0A0P7X1V8      --------LY--------------------------------------------------
A0A6P1P355      --------FR-AIPAYTS---------S-PIKIKLR-------------NPE--EARETE
A0A5C8KAD6      --------FK-STNAYTS---------S-PIRIKLK-------------NPE--DIKQTV
A0A5N1J695      --------FR-SIPAYAS---------S-PVIIKVK-------------NPE--RISEVP
A0A3N2M1H3      --------FH-PVTLYGH---------TLPYIVDMQ-------------GIE--EQGGAS
A0A4S2G8T2      --------FH-PVTLYGH---------TLPYIVDMQ-------------GIE--EQGGAS
A0A212K7W5      --------FR-NKPLYKN---------S-PVIVSID-------------STN--VNESFS
F5IU11          --------FR-NRSLYKN---------S-PVIVSTG-------------PVN--VNESFS
A0A7C1QWC7      --------YY-TVNIDKS---------HVQSINARF-------------YIE--ALTDTT
A0A352Z1R7      --------DL-DFKLLDF---------SSTAKTPSY-------------RIE--MTGADT
A0A0A2F501      --------YY-KEVLYGQ---------ELPYRVKFL-------------GLK--DTDNAS
R5B7P0          --------FH-RNVLYGT---------SLPISADLL-------------DVD--ENVGVG
R5B0L5          --------FH-KDLLYGS---------SLPIDVDFS-------------TLA--DGESGS
A0A6I1TEC0      --------FH-RNVLYGN---------DLPVTVQFL-------------TIG--EEHYGS
A0A3R5XWG1      --------FH-RNVLYGN---------DLPVTVQFL-------------TIG--EEHYGS
A0A5P0Y910      --------FH-RNVLYGN---------DLPVTVQFL-------------TIG--EEHYGS
A0A414YFM3      --------FH-RNVLYGN---------DLPVTVQFL-------------TIG--EEHYGS
A0A6A7UIA7      --------FH-RNVLYGN---------DLPVTVQFL-------------TIG--EEHYGS
A0A6A7VPS3      --------FH-RNVLYGN---------DLPVTVQFL-------------TIG--EEHYGS
A0A374THP7      --------FH-KEALYGG---------DLPVTVDFI-------------GFT--DDQSGS
A0A6G1VND1      --------FH-KEALYGG---------DLPVTVDFI-------------GFT--DDQSGS
A0A0A2EVS5      --------FH-RSTLYGS---------ELPIVVSID-------------RFY--GALEWS
A0A1T4NAJ7      --------FH-RSTLYGS---------ELPIMVSID-------------RFY--GALEWS
A0A255T941      --------LK-RVELYGT---------S-PVEVMMR-------------KQS--K-YPFS
A0A4P7VSV0      --------FH-DVVAYGS---------NLPVRVEMP-------------GFA--ENGSAS
A0A7J0AX49      --------FH-DVVAYGS---------NLPVRVEMP-------------GFA--ENGSAS
A0A3N2KCL3      --------FH-DVVAYGS---------NLPVRVEMP-------------GFA--ENGSAS
A0A2V1IJY1      --------FH-DVVAYGS---------NLPVRVEMP-------------GFA--ENGSAL
A0A4P7VXK7      --------FH-DVVAYGS---------NLPVRVEMP-------------GFA--ENGSAL
A0A1Y4CHN5      --------FY-DRVLYGQ---------NLPVSVSFL-------------DLN--DNESAS
A0A1M6I2S6      --------LK-DVGLYKS---------N-PVAVSYR-------------HQD--E-TPVS
A0A1Y3V692      --------LK-DVGLYKS---------N-PVAVSYR-------------HQD--E-TPVS
F3PXM2          --------LR-RVELYRS---------A-PVAVRFC-------------GKA--E-RPVA
A0A174AHH7      --------LK-RIELYKS---------S-PILVTYL-------------VDN--K-KNVS
A0A174JCE8      --------LK-RIELYKS---------S-PILVTYL-------------VDN--K-KNVS
A0A3E4JMC4      --------LK-RIELYKS---------S-PILVTYL-------------VDN--K-KNVS
A0A412SND6      --------LK-RIELYKS---------S-PILVTYL-------------VDN--K-KNVS
A0A414IEQ9      --------LK-RIELYKS---------S-PILVTYL-------------VDN--K-KNVS
A0A7K0HNT3      --------LK-RIELYKS---------S-PILVTYL-------------VDN--K-KNVS
A0A0M1W8D8      --------LK-RIELYKS---------S-PILVTYL-------------VDN--K-KNVS
A0A3R6GKX5      --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A7V4S1          --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
B0NU19          --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
D4V601          --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A0A4Q0U3M9      --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A0A7J5G2G2      --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A0A7J5HH13      --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A0A397WLT5      --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A0A6A2J529      --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A0A6N8DDD8      --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A0A015XH67      --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A0A078RZN2      --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A0A6M4L7F4      --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A6L0K5          --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A7ACT5          --------LK-RIELYKS---------S-PILVTYL-------------FDN--K-KSVS
A6KY94          --------LK-RIELYKS---------S-PILVTYL-------------FDD--K-KSVS
A0A173UQR8      --------LK-RIELYKS---------S-PILVTYL-------------FDD--K-KSVS
A0A3R6HK75      --------LK-RIELYKS---------S-PILVTYL-------------FDD--K-KSVS
A0A412B7D1      --------LK-RIELYKS---------S-PILVTYL-------------FDD--K-KSVS
A0A412VNY9      --------LK-RIELYKS---------S-PILVTYL-------------FDD--K-KSVS
A0A414LTU9      --------LK-RIELYKS---------S-PILVTYL-------------FDD--K-KSVS
I9Q4U4          --------LK-RIELYKS---------S-PILVTYL-------------FDD--K-KSVS
A0A373ISF0      --------LK-NVGLYKA---------N-PVAVTFG-------------EVM--E-KPVS
U6RF62          --------LK-NVDLYKA---------N-PVAVTFG-------------EVM--E-KPVS
A0A662ZZD5      --------LK-DVELYKS---------S-PLAVTYR-------------HLD--E-TPVG
A0A3A5TI83      --------LK-DVELYKS---------S-PLAVTYR-------------HLD--E-TPVG
A0A415NEB6      --------LK-DVELYKS---------S-PLAVTYR-------------HLD--E-TPVG
A7AJ60          --------LK-DVELYKS---------S-PLAVTYR-------------HLD--E-TPVG
A0A7J5MKN5      --------LK-DVELYKS---------S-PLAVTYR-------------HLD--E-TPVG
A0A6A2JF01      --------LK-DVELYKS---------S-PLAVTYR-------------HLD--E-TPVG
A0A7J4Y8G3      --------LK-DVELYKS---------S-PLAVTYR-------------HLD--E-TPVG
A0A015UXN7      --------LK-DVELYKS---------S-PLAVTYR-------------HLD--E-TPVG
A0A6I2NTL0      --------LK-DVELYKS---------S-PLAVTYR-------------HLD--E-TPVG
A0A6I2Q447      --------LK-DVELYKS---------S-PLAVTYR-------------HLD--E-TPVG
A0A016E4F9      --------LR-TIGLYKC---------N-PIAVTYR-------------HLD--E-IPIS
A0A6N3HG44      --------LR-TIGLYKC---------N-PIVITYR-------------HLD--E-TPVS
A0A7K0HSP7      --------LR-TIGLYKC---------N-PIVITYR-------------HLD--E-TPVS
A0A7K1HEJ5      --------LR-TIGLYKC---------N-PIVITYR-------------HLD--E-TPVS
A0A6H9P0U9      --------LK-NVDLYKV---------S-PVTITFC-------------DKI--E-VPLS
A0A108TH71      --------LK-NVDLYKV---------S-PVTITFC-------------DKI--E-VPLS
I8VXH0          --------LK-NVDLYKV---------S-PVTITFC-------------DKI--E-VPLS
A0A412S0N6      --------LK-NVDLYKV---------S-PVTITFC-------------DKI--E-VPLS
A0A412IIJ0      --------LK-NVDLYKV---------S-PVTITFC-------------DKI--E-VPLS
A0A0P0FM97      --------LK-NVDLYKV---------S-PVTITFC-------------DKT--E-VPLS
R6KTP3          --------LK-NVDLYKV---------S-PVTITFC-------------DKT--E-VPLS
A0A139LU87      --------LK-NVDLYKV---------S-PVTITFC-------------DKI--E-VPLS
A0A1C6B3Y5      --------LK-NVDLYKV---------S-PVTITFC-------------DKI--E-VPLS
A0A6L3KCD1      --------LK-NVDLYKV---------S-PVTITFC-------------DKI--E-VPLS
E2NMQ4          --------LK-NVDLYKV---------S-PVTITFC-------------DKI--E-VPLS
A0A412YDB9      --------LK-KVDLYKA---------A-PFTVTFR-------------DQP--E-APLS
R7DY01          --------LK-KVDLYKA---------A-PFTVTFR-------------DQP--E-APLS
A0A414LGK8      --------LK-KVDLYKA---------A-PFTVTFR-------------DQP--E-APLS
A0A415IPQ4      --------LK-SVDLYKG---------S-PVTITFC-------------DKI--E-VPLS
A0A3E5BRW7      --------LK-NVDLYQS---------T-PVTVTFF-------------DKV--E-TPLS
K9DXS6          --------LK-NVDLYQS---------T-PVTVTFF-------------DKV--E-TPLS
A0A1M6KFV3      --------LK-NVDLYKS---------A-PVAVTFL-------------DKM--E-APLS
A0A1Q6G7L3      --------LK-NVDLYKS---------A-PVAVTFL-------------DKV--E-APLS
A0A413H235      --------LK-NVDLYKS---------A-PVAVTFL-------------DKV--E-APLS
A0A1M5B2J8      --------FH-KNTIYGD---------QLPVAVTLT-------------DFP--DNQSAA
A0A255RCT5      --------FH-KVTIYGD---------QLPVAVSFA-------------DFP--DNQSAS
A0A1Y4GLF5      --------FH-RVVAYGK---------NLPVTVTLC-------------DLP--EDETGS
A0A1H3XSC0      --------FH-RQVAYGP---------TLPVNVSIN-------------GLS--ENESVG
A6LE40          --------FH-RKVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A4Y1VPX5      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A6N2XMM4      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
B3JI46          --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A358R8U0      --------FQ-DRVAYGA---------SLPLTVSLP-------------ELT--ENESAR
R6WSB6          --------FQ-DRVAYGA---------SLPLTVSLP-------------ELT--ENESAR
A0A401LPX7      --------FH-KQTVYGN---------QLPVHVVIP-------------NLS--ENESAT
A0A6G0GNY9      --------FH-KQTVYGN---------RLPVQVVIP-------------TLS--ENESAT
A0A6I1BFM0      --------FH-KQTVYGN---------RLPVQVVIP-------------TLS--ENESAT
A0A3A5Z900      --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
A0A7K0GW19      --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
A0A285TGL6      --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
A0A3A5RFX4      --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
A0A1Q6IUW9      --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
A0A413XDP6      --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
A0A6N8CVT6      --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
K6AP24          --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
A0A6I2NHV3      --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
A0A078RYI7      --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
A0A7I0QD01      --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
C7XEQ8          --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
D7INX6          --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
K5ZG55          --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
A0A662ZYI7      --------FH-KQTVYGN---------QLPVQVVIP-------------NLS--ENESAT
A0A3N2N9B8      --------FH-DEVAYGT---------TLPIELSIV-------------NAP--ADASAE
A0A3N2NMI0      --------FH-NIVAYGT---------GLPIQLEIV-------------NFP--TDASAT
A0A359I8H7      --------FH-EKTLYGS---------NLPVNVKFH-------------DLE--EQQCAG
A0A3N2KA63      --------FH-EKTLYGS---------NLPVNVKFH-------------DLE--EQQCAG
A0A4Q0IMT7      --------FH-EKTLYGS---------NLPVNVKFH-------------DLE--EQQCAG
A0A7J0B660      --------FH-EKTLYGS---------NLPVNVKFH-------------DLE--EQQCAG
A0A3B9FAU3      --------WH-KNILYGR---------SLPANVRMM-------------GLG--DHESAA
A0A3C1E5L7      --------WH-KNILYGR---------SLPANVRMM-------------GLG--DHESAA
A0A4Q0UAV1      --------LH-NKLLYNN---------SPVTAVNMA-------------PED--KKLKGY
A0A354SN68      --------LK-EITLYGK---------NLPIKVSFL-------------EAT--SMDNLS
A0A6L5XFL0      --------FH-DNILYGR---------TLPVNVLLP-------------DAG--EEQSVD
A0A3N2N595      --------FH-KEIAYGY---------TLPICAELI-------------DFS--AYGTLK
A0A7J0ACS3      --------FH-DVVAYGY---------DLPVKLTLL-------------DYP--DEGSLS
A0A0A2DUD9      --------FH-DHLLYGT---------NLPLNLRFT-------------DLS--EQESAE
A0A3P1ZBJ5      --------FH-DITLYGR---------TLPFQVRFL-------------SLN--EEQGAR
R5FHS9          --------FY-KGVLYGQ---------NMPYTVSMP-------------DVQ--DEDVVK
A0A413TW79      --------FH-PVALYGR---------TLPVTVHFY-------------SLN--DMQSAS
A0A7K0AAG2      --------FH-PVALYGR---------TLPVTVHFY-------------SLN--DMQSAK
A0A7K0ASF1      --------FH-PVALYGR---------TLPVTVHFY-------------SLN--DMQSAN
A0A3E5E9M7      --------FH-PVALYGR---------TLPVTVHFY-------------SLN--DMQSAN
A0A3E4SK73      --------FH-PVALYGR---------TLPVTVHFY-------------SLN--DMQSAN
A0A415GGC6      --------FH-PVALYGR---------TLPVTVHFY-------------SLN--DMQSAS
A0A413DBH9      --------FH-PVALYGR---------TLPVTVHFY-------------SLN--DMQSAN
A0A495WI87      --------FY-REVLYGR---------TLPINVSID-------------TPN--DNESSA
A0A354M4S6      --------FY-REVLYGR---------TLPINVSID-------------TPN--DNESSA
R7DH52          --------FY-REVLYGR---------TLPINVSID-------------TPN--DNESSA
A0A7J5IAE7      --------FH-QQVAYGL---------TLPVNVTMS-------------DLS--ENESAG
A0A016CWA4      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A4P8LP09      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A0M1W0V2      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A139KA16      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A174VQ92      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A1Q6HCG0      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A1Y4JYM9      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A3A5QW67      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A3A5RQE6      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A3A6BP07      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A3E5E153      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A3Q9IP20      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A412WV15      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A413ICP6      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A414KYB9      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A5B3FWR2      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A7J5QHB9      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
E5WX00          --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
K0X3P3          --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A1C6H117      --------FH-RQVAYGL---------TLPVDVTIS-------------DFP--ENESAG
A0A6I1AQV4      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A5C6L2P1      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A412MJT7      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3E4WKT5      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3A5YY33      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A1E9CFZ7      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A373FYU5      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3A5TZ72      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3A5XBP2      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3A6MEG9      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3E4JP35      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3E4KP40      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3E4NX82      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3E4XFU8      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A412RG70      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A412TD37      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A413GAA4      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A414M7I4      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A496BTA0      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A496D2V6      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A5C6KCA6      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A5M5AHM5      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A6I0Y5K7      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A6I1BFB8      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A6I2P5W5      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A6N8DC51      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A7J5HGP0      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A7J5HVL8      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A7J5JHD3      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
E5UZA2          --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A069SMG6      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
C3RFN5          --------FH-RKVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3A5Z014      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A7J5GD93      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A7K0HGR5      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A078S3Q8      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A069SJV7      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3E5DXI5      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3E5EM98      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A6N2YYD4      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
I9T3G6          --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A3E4SYU0      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A6LGY1          --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
K5ZSH4          --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A6A2RTB3      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A7J5PEN4      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A1M4YZ07      --------FH-RQVAYGL---------TLPVDVTIN-------------DLP--ENESAG
A0A7J5I238      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A0P0FQW1      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A7K0I229      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A5M5C0W6      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A642NJ89      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A6L3JTQ2      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A7J5FQU6      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A7J4YLH7      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A6N3AEV2      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A6G0G4T5      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A6L3KG29      --------FH-RQVAYGL---------TLPVDVTIS-------------DLP--ENESAG
A0A1Y4PQK7      --------FH-DRLLYGM---------ALPFQANIT-------------GLQ--ENESVG
A0A1Y4IH41      --------FH-DRLLYGM---------TLPFQANIA-------------GIQ--ENDFAG
A0A3A6AAP4      --------FH-DRLLYGM---------TLPFQANIA-------------GIQ--ENDFAG
A0A6I0ZRD2      --------FH-DRLLYGM---------TLPFQANIA-------------GIQ--ENDFAG
A0A7L4SP06      --------FH-DRLLYGM---------TLPFQANIA-------------GIQ--ENDFAG
A0A1Y4DYA7      --------FY-NHILYGQ---------NCPYEVEFF-------------DLQ--DNDVAS
A0A1Y3X4I9      --------FY-KQVLYGQ---------ACPYEVEFF-------------DLL--DNEGAS
A0A1Y4FNK8      --------FY-KKVLYGG---------TCPYSVSFN-------------DLQ--DNESVS
A0A355FD59      --------FH-RKTLYGS---------ELPVRVVFT-------------DLT--DKENAK
A0A359CEZ9      --------FH-RKTLYGS---------ELPVRVVFA-------------DLT--DKENAK
A0A353Q7B4      --------FH-RKTLYGS---------ELPVRVVFT-------------DLT--DKENAK
F8X3A5          --------FY-KKVLYGP---------DLPITVSFT-------------DLA--DNESAE
A0A1M3KVR9      --------FY-KKVLYGP---------DLPITVSFA-------------DLA--DNESVE
A0A4Y9IJS3      --------FY-KKVLYGP---------DLPITVSFA-------------DLA--DNESAE
A0A1H4ADG3      --------FR-SKPLYKK---------SLPFTTSIT-------------GFS--TD---N
A0A5B8VUR8      --------FK-SEPLYKE---------SLPFKISIE-------------GFT--TD---N
A0A0D3L8Q3      --------IK-DPELYGN---------KLPFRVVTN-------------KLD--SLAY-G
A0A7G7G5F9      --------IK-AKEVYVN---------YLPIKVAVR-------------QFN--PLVYDN
A0A2N3U785      --------IK-TEEIYGS---------SLPIKVVVS-------------DLK--QPAF-G
A0A5B6TJH8      --------FQ-DIEIYGK---------ELPIKLVVE-------------SLH--NSGY-N
A0A519U664      --------VV-DKEIYGQ---------SVPIKVLRS-------------NVD--STAA-G
A0A519MA34      --------II-DKEIYGQ---------SVPIKVLRN-------------NVD--STAA-G
A0A519UCX0      --------AI-DKEIYGQ---------SVPIKVLRN-------------NMD--STAA-G
A0A0E3ZG78      --------VN-DIEIYGS---------EVPIKVLVN-------------DLA--PPAY-R
A0A1I6BRK6      --------IT-DREIYGE---------ALPFRIVRN-------------GLD--STMT-G
A0A243WAB1      --------FV-NREIYGR---------ELPAKLLID-------------KLD--STAI-G
A0A6G8C8X6      --------VK-DREIYGR---------ALPIKVLLN-------------GLD--STAA-G
A0A416GA42      --------WR-PTDLYGV---------S-PVTVHFV-------------QGD--D--L-A
A0A1T3IYP5      --------LR-DYELYKK---------S-PVHVKIE-------------GKT--QE-S-S
A0A1T5K9D4      --------LR-NIELYRN---------A-PIRIFFS-------------RED--NPIG-Y
A0A077ENE7      --------LR-DYELYKK---------S-PVQVKVE-------------GIS--SE-G-S
A0A7H1Z2Z7      --------LR-DYELYKK---------S-PVQVKVE-------------GIS--SE-G-S
A0A6I5UW06      --------LR-DYELYKK---------S-PVQVKVE-------------GIS--SE-G-S
T0NN57          --------LR-EYELYKK---------S-PIYAKVL-------------GKR--AE-D-S
X5K347          --------LR-EYELYKK---------S-PIYAKVL-------------GKR--AE-D-S
A0A060RD97      --------FR-KLDIYGE---------ETPIVVKNV-------------AES--EQ-S-N
A0A3C1ITV0      --------IGYVTDWYDK---------T-PICVEYK-------------NLP--DH-V-G
R7HN19          --------IGYVTDWYDK---------T-PICVEYK-------------NLP--DH-V-G
A0A350IHV0      --------LR-SRELFTS---------S-PIALVQT-------------GDN--HA-S-A
R5RVP0          --------LR-SREKFTD---------S-PIALVLA-------------GDN--NA-S-A
R6A0L2          --------LH-SITLYGK---------ELPFQVLFQ-------------KQY--KG-K-R
R7LG80          --------LH-KVALYKN---------ERPIEVLFH-------------DSL--PS-E-N
A0A2L2WX98      --------LH-EVSLYRN---------R-PFRIEFS-------------SEC--QR-P-E
G5GD56          --------LH-SVALYTD---------R-PFEIAFQ-------------QKA--E--N-L
R5KD55          --------FY-DKTLYGK---------TLPVKVVFR-------------DIP--KD-E-T
A0A174QNT3      --------LR-HDHIFGE---------L-PFEINFL-------------DNY--P--G-Y
A0A4S2FGS1      --------LR-HDNLFGD---------L-PFEVRFL-------------DIC--P--G-F
A0A7K3KG59      --------LR-RDNLFGD---------L-PFEVRFL-------------DIY--P--G-F
R9I0H0          --------LR-RDNLFGD---------L-PFEVRFL-------------DIY--P--G-F
K5BUT9          --------LR-DTPLYAE---------S-PVDVHFI-------------DPY--N--Q-P
A0A174FPA3      --------LR-DAPLYAE---------S-PVEVHFI-------------DPY--N--Q-P
R6S9Y6          --------LR-DAPLYAE---------S-PVEVHFI-------------DPY--N--Q-P
A0A7J4YSB2      --------LR-DAPLYAE---------S-PVEVHFI-------------DPY--N--Q-P
C9KX15          --------LR-DAPLYAE---------S-PVEVHFI-------------DPY--N--Q-P
A0A6H0KRK1      --------FR-NTSLYAE---------S-PVEVNFI-------------DPY--H--A-Y
R6DAG6          --------FR-NTSLYAE---------S-PVEVNFI-------------DPY--H--D-Y
A0A3L8AAP1      --------FR-NTSLYAE---------S-PVEVNFI-------------DPY--H--A-Y
A0A4S2AYX2      --------FR-NTSLYAE---------S-PVEVNFI-------------DPY--H--A-Y
A0A7J0A2L4      --------FR-NTSLYAE---------S-PVEVNFI-------------DPY--H--A-Y
A0A7K3MN31      --------FR-NTSLYAE---------S-PVEVNFI-------------DPY--H--A-Y
A0A0E2M2Y7      --------WR-HESLYGK---------S-PVSIRIT-------------DRD--ST-E-S
A0A0K2J6Z0      --------WR-HESLYGK---------S-PVSIRIT-------------DRD--ST-E-S
B2RKZ8          --------WR-HESLYGK---------S-PVSIRIT-------------DRD--ST-E-S
A0A212GC82      --------WR-HESLYGK---------S-PVSIRIT-------------DRD--ST-E-S
A0A254MU12      --------WR-HESLYGK---------S-PVSIRIT-------------DRD--ST-E-S
R6CQ93          --------LR-MNELYNL---------S-PVQVSFF-------------NVL--PE-R-Y
A0A3D1NQW3      --------LR-PQDLYGQ---------S-PIAVEFI-------------NDN--DR-Q-G
B0MT10          --------LR-PQDLYGQ---------S-PIAVEFI-------------NDN--DR-Q-G
R7JGW9          --------LR-PQDLYGQ---------S-PIAVEFI-------------NDN--DR-Q-G
A0A3D2BF46      --------LR-TENLYRR---------S-PIDVTFI-------------DDN--ER-Q-A
A0A358R538      --------LR-ARDLYGQ---------S-PLRVRFI-------------DET--ED-L-S
A0A1Y4AAB8      --------LR-TQDLYGR---------S-PIEADFV-------------DEG--EN-Q-S
A0A1Y3WWY9      --------LR-DRDLYGQ---------S-PIDVDFI-------------NGD--DN-Q-S
A0A1Y4U5L4      --------LR-DRDLYGQ---------S-PIDVDFI-------------NGD--DN-Q-T
A0A1Y3VCJ1      --------FQ-DRDLYGQ---------S-PVEVVFV-------------NDN--DN-L-T
A0A1Y3QTW7      --------LR-TLDLYGR---------S-PIEVDFI-------------DDD--N--Q-R
R6XWY7          --------LR-TLDLYGR---------S-PIEVDFI-------------DDD--N--Q-R
A0A4Y1X9Y9      --------LR-TLDLYGR---------S-PIEVDFI-------------DDD--N--Q-R
A0A4Y1WM66      --------LR-TLDLYGR---------S-PIEVDFI-------------DDD--N--Q-R
A0A6N4GYT3      --------LR-TLDLYGR---------S-PIEVDFI-------------DDD--N--Q-R
A0A174AVF1      --------LR-TLDLYGR---------S-PIEVDFI-------------DDD--N--Q-R
A0A656Q4F4      --------LR-TLDLYGR---------S-PIEVDFI-------------DDD--N--Q-R
A0A1Q6EIY0      --------LR-TADLYGR---------S-PIEVDFI-------------NDN--SK-Q-K
A0A5B5VN71      --------LR-TADLYGR---------S-PIEVDFI-------------NDN--SK-Q-K
E4M8L3          --------LR-TADLYGR---------S-PIEVDFI-------------NDN--SK-Q-K
I3YQ50          --------LR-TADLYGR---------S-PIEVDFI-------------NDN--SK-Q-K
R5UEY8          --------LR-TADLYGR---------S-PIEVDFI-------------NDN--SK-Q-K
A0A1H4D866      --------LR-RRDLYAQ---------S-PVEVTFV-------------NDS--DN-Q-S
A0A5B3G4Y7      --------LR-RRDLYGQ---------A-PIDVKFI-------------NDN--DN-Q-S
A0A374A9J5      --------LR-RRDLYGQ---------A-PIDVKFI-------------NDN--DN-Q-S
A0A5B3GQN5      --------LR-RRDLYGQ---------A-PIDVKFI-------------NDN--DN-Q-S
A0A1Q6E9S3      --------LR-RRDLYGQ---------A-PIDVKFI-------------NDN--DN-Q-S
D4IJ36          --------LR-RRDLYGQ---------A-PIDVKFI-------------NDN--DN-Q-S
A0A414Q925      --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
A0A415PUS9      --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
A0A108TCU0      --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
A0A413BA42      --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
S3Y344          --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
A0A7J5LEW3      --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
A0A412TGL3      --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
A0A413VJ33      --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
A0A414L0W6      --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
A0A412DP39      --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
A0A413ZSE8      --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
B0NP84          --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
R6AK43          --------LR-KKELYTS---------T-PFAVTFL-------------DAT--PS-Q-Q
A0A412N2D9      --------LR-KKELYTS---------T-PFTVNFL-------------DAD--PA-Q-K
A0A1Y4JYS9      --------LR-KKELYTS---------T-PFTVNFL-------------DAD--PA-Q-K
R6LHA4          --------LR-KKELYTS---------T-PFTVNFL-------------DAD--PA-Q-K
A0A3E5HPT8      --------LR-PRELYTD---------S-PVRVAFL-------------EAG--LD-E-V
C6IJ48          --------LR-PRELYTD---------S-PVRVAFL-------------EAG--LD-E-V
Q8A3U2          --------LR-PRELYTD---------S-PVRVAFL-------------EAG--LD-E-V
A0A3R6S1H6      --------LR-EIELYKE---------S-PVVLRFP-------------DAE--ET-S-S
A0A3R6SD81      --------LR-ELELYKE---------S-PVVLRFP-------------DAE--ET-S-S
A0A354WXN6      --------LR-TVDLYTQ---------S-PINLTFP-------------EAE--GE-Q-V
A0A7G1HW11      --------LR-DRSLYKD---------S-PLAVSFI-------------TKD--NN-S-Q
R5IP14          --------LR-DRSLYKD---------S-PLAVSFI-------------TKD--NN-S-Q
A0A316SZX7      --------LQ-TIDLYRN---------T-PIEVSFV-------------DDD--DK-S-Y
A0A1Y4AIY1      --------LR-TVELYRQ---------S-PVILSFP-------------DAS--ET-Q-S
A0A0J6CIR2      --------LR-TEELYTQ---------S-PIAVRFP-------------EAE--AS-Q-S
A0A3D8HG59      --------LR-TTELYTQ---------S-PVHLEFP-------------DAE--PN-Q-Q
A0A3R6S408      --------LR-TTELYTQ---------S-PVHLEFP-------------DAE--PN-Q-Q
F3ZRU7          --------LR-KKDLYGN---------N-PFEVVFL-------------EAS--TE-Q-P
A0A1C5Q1F3      --------FR-DWDLYTT---------S-PVTLTFP-------------EAL--ET-S-S
R7A239          --------FR-DWDLYTT---------S-PVTLTFP-------------EAL--ET-S-S
A0A3R6HIK7      --------LR-MVELYTH---------S-PVVLSFP-------------ETE--ES-Q-S
K5ZVW7          --------LR-TVELYTH---------S-PVVLSFP-------------ETE--ES-Q-S
A0A1Y4D5Z0      --------LR-TVELYRE---------S-PVVLSFP-------------EAG--EG-Q-S
A0A413VXJ7      --------LR-NKELYTH---------S-PIILSFP-------------EAE--ER-Q-S
I9RSN9          --------LR-NKELYTH---------S-PIILSFP-------------EAE--ER-Q-S
U6RJK5          --------LR-NKELYTH---------S-PIILSFP-------------EAE--ER-Q-S
A0A1Q6GA32      --------LR-NKELYTH---------S-PIILSFP-------------EAE--ER-Q-S
I9RPU6          --------LR-NDELYTH---------A-PVTVSFP-------------EAE--ER-Q-V
I8YFS5          --------LR-EDELYTH---------S-PITVLFP-------------ESE--ER-Q-V
A0A7J4XCM0      --------LR-EDELYTH---------S-PITVLFP-------------ESE--ER-Q-V
I8Y597          --------LR-EDELYTH---------S-PITVLFP-------------ESE--ER-Q-V
A0A1Q6GBF5      --------LR-EDELYTH---------T-PVTVSFP-------------EAE--ER-Q-V
I8YFZ3          --------LR-NDELYTH---------A-PVTVSFP-------------EAE--ER-Q-V
A0A7J4XFW0      --------LR-NDELYTH---------A-PVTVSFP-------------EAE--ER-Q-V
A0A1Q6GDH2      --------LR-NDELYTH---------A-PVTVSFP-------------EAE--ER-Q-I
U6RSB0          --------LR-NDELYTH---------A-PVTVSFP-------------EAE--ER-Q-V
I9GXM2          --------LR-NDELYTH---------A-PVTVSFP-------------EAE--ER-Q-I
I9SIK1          --------LR-NDELYTH---------A-PVTVSFP-------------EAE--ER-Q-V
A0A7J4XIJ5      --------LR-NDELYTH---------A-PVTVSFP-------------EAE--ER-Q-V
I9TP59          --------LR-NDELYTH---------A-PVTVSFP-------------EAE--ER-Q-V
R5S343          --------LC-TVDLYGI---------S-PIRVRFL-------------DRG--ED-E-A
A0A1M6K7I9      --------LR-TIELYTQ---------S-PIKVAFP-------------DAE--DN-Q-Y
A0A5M6A8C8      --------LR-TIELYTQ---------S-PIKVAFL-------------DAE--DN-Q-Y
A0A7J4XCJ1      --------LR-DDELYTH---------S-PITVSFP-------------ESE--ER-Q-V
A0A7J4XNQ7      --------LR-EDELYTH---------S-PIVVVFP-------------ESE--ER-Q-V
A0A3R5ZMK1      --------LR-TVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
A0A7K1HMX0      --------LR-TVELYTQ---------S-PVLLSFP-------------DAE--EA-Q-A
A0A1Y3ZIA4      --------LR-TVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
K5Y1A4          --------LR-TVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
A0A7K1HDC0      --------LR-TVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
A0A3R6K8X4      --------LR-TVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
A0A6N8D6C8      --------LR-TVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
A0A3R6BKI7      --------LR-TVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
A0A412M2W1      --------LR-TVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
K5ZX55          --------LR-TVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
A0A415BDM7      --------LR-TVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
A0A1Q6I3T6      --------LR-MVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
A0A414XX40      --------LR-MVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
A7AEU7          --------LR-TVELYTQ---------S-PVQLSFP-------------DAE--EA-Q-A
A0A5F0U645      --------LR-TVELYSH---------S-PVVVRFP-------------EAN--EN-L-E
K5ZBN2          --------LR-TVELYSH---------S-PVVVRFP-------------EAN--EN-L-E
A0A0J6CKW3      --------LR-TVELYSH---------S-PVVVRFP-------------EAN--EN-L-E
A0A0F5IQM7      --------LR-TVELYSH---------S-PVVVRFP-------------EAN--ES-L-E
A0A496CDT3      --------LR-TVELYSH---------S-PVVVRFP-------------EAN--EN-L-E
A0A6G1ZKM3      --------LR-TVELYSH---------S-PVVVRFP-------------EAN--EN-L-E
S0GLB0          --------LR-TVELYSH---------S-PVVVRFP-------------EAN--EN-L-E
A0A3R6NLC1      --------LR-TVELYSH---------S-PVVVRFP-------------EIN--EN-L-E
A0A416WYC9      --------LR-TVELYSH---------S-PVVVRFP-------------EIN--EN-L-E
A0A0F5IT40      --------LR-TEELYTQ---------S-PIAVRFP-------------EAE--AS-Q-S
A0A496CX20      --------LR-TEELYTQ---------S-PIAVRFP-------------EAE--AS-Q-S
A0A5F0UBI0      --------LR-TEELYTQ---------S-PIAVRFP-------------EAE--AS-Q-S
A0A6G1ZHG0      --------LR-TEELYTQ---------S-PIAVRFP-------------EAE--AS-Q-S
S0GSI7          --------LR-TEELYTQ---------S-PIAVRFP-------------EAE--AS-Q-S
K5YB65          --------LR-TEELYTQ---------S-PIAVRFP-------------EAE--AS-Q-S
A0A0F5IWP9      --------LR-TVELYTQ---------S-PIAVQFP-------------EAE--AT-Q-A
A0A0F5IZT8      --------LR-TVELYTQ---------S-PIAVQFP-------------EAE--AT-Q-A
A0A417LKQ2      --------LR-TVELYTQ---------S-PVAVQFP-------------ETE--AV-Q-A
A0A416TME1      --------LR-TVELYTQ---------S-PVAVQFP-------------EAE--AT-Q-A
A0A416XPE8      --------LR-TVELYTQ---------S-PVAVQFP-------------EAE--AT-Q-A
A0A3B0C2S4      --------IK-TTEIWNP---------P-FAITKLI-------------AED--SIGQPR
L8JI02          --------FR-AEEKYGD---------F-PFIVELDSTISQMIDVPVYIEPL--PGGSYR
A0A4Q5WS95      --------FG-DRSAYTS---------S-PVVITAF-------------NLD--QVRTTP
A0A501VZX6      --------FK-TTSAYIT---------S-PVQIEVK-------------HPE------AL
A0A399SH26      --------FK-EVAAYTS---------S-PVIVTHY-------------NPD--AILATE
A0A501W1A9      --------FR-TVSAYTS---------S-PIKVILK-------------SFD------KV
A0A0E3ZGV6      --------LR-SVPAYTS---------S-PITITLK-------------DPE------KA
A0A1I2N4S1      --------FK-SIPAYNT---------S-PITISLK-------------SPE------TA
A0A2T5YE44      --------FK-SIPAYTT---------S-PITISLK-------------SPE------TA
A0A1M5BA90      --------IV-SRSAYTS---------S-PVTIELE-------------YPN--NIQ---
A0A512B879      --------IA-SYSAFTS---------S-PVTVELA-------------DPD--MIV---
A0A559PPI3      --------IK-SVSAYNS---------S-PIQIKLK-------------NPD--EIVIEK
A0A1T5CS78      --------IK-AISAYTS---------S-PIKVIVK-------------EPN--RISISN
A0A0Q9Z8F1      --------IK-TISAYTS---------S-PIKVIVE-------------DPN--KISLSE
A0A2N0U0M7      --------IK-TISAYTS---------S-PIRVIVQ-------------DPN--RISISA
A0A1V9FHD0      --------MH-ATSAYLS---------S-PITIVAQ-------------DPD--QVKETG
A0A4V4H170      --------IH-ATSAYTS---------S-PITITAR-------------KPD--DLKETG
A0A1V9F098      --------IK-PTSAYNS---------S-PVTIIAR-------------KPD--ELKSTG
A0A4R2VU64      --------LK-ATSAYTS---------S-PITIMAR-------------KPD--DLKETG
A0A4S8HY23      --------IN-VTSAYTS---------S-PITITAR-------------KPD--ELKETG
A0A1V9F383      --------FN-ETSAYVS---------S-PVSIVAK-------------DPD--ELIETG
G8TRZ6          --------FN-ETSAYIS---------S-PVSIVAR-------------NPD--ELTETG
A0A4R5DL69      --------IK-TAEIYDK---------S-PVILHLI-------------DPK--SDQIKR
A0A1M4YED3      --------WG-LRSAYNT---------S-PVKVIAQ-------------NPA--DLKRTE
A0A2H3NSN0      ------------------------------------------------------------
A0A2P6C324      ------------------------------------------------------------
A0A7C2DZI7      ------------------------------------------------------------
A0A1M6XHU0      ------------------------------------------------------------
G2SF81          ------------------------------------------------------------
A0A5S9EYW1      ------------------------------------------------------------
D0MHQ9          ------------------------------------------------------------
A0A126PFG0      --------LG-ARDLYGR---------S-PVQFTLV-------------PTH--SVPRQH
A0A3M1N7Z3      --------VG--RSLVFP---------H-PFQISF-------------------SSPRAE
                                                                            

A0A1T5MMH4      AFFNQPFF-LEKE---SPET-FSL-VW-GEGTQKI-------------------SGRY-G
A0A2W4R1L8      AFYGVPIF-VDLG---STEA-VRL-RI-NQDGDQV-------------------SGKY-G
A0A2E5CV79      GIYSPEIE--------KEEH-YTE------------------------------------
A0A2D4ZVH1      ------------------------------------------------------------
A0A0K8QSK7      QMIGTRIR-LTFA---GDGK-IRY-QA-EGENVRVHDFVTGENIRTIPNVNIDETRLL-G
A0A1V6CN82      QLIGFDFR-ISVH---PDRS-ITL-SG-FGEGVGVYNYSENRGAGYFPEVKIEQKVQS-G
A0A1M4XZ45      QIINADFY-LTIQ---PDGK-LRV-EM-DQEDVAVYNYLDEKIVERLPQFSFSRDISA-G
A0A399D319      QVIDADFF-LTIE---PNGK-LKI-DM-EEEVISAYSYTEEEVVKRIPGYSFSRTIDP-G
A0A1V5IPN7      ------------------------------------------------------------
A0A1M6GR99      PQLVGPVFDVILN---SDGS-YAL-KV-EKQDAMVYNYNTGHKIGERKDLEFSINGNV-G
A6EBM4          ---GRQLILFDPI---DHEK-FTL-TW-TIGKEDIRK-----------------NFRF-N
A0A7C5M4P4      NIYNKNID-VTIL---DKER-YLL-AY-SLDEKTVEE-----------------EHRF-D
A0A1M6TTV4      ELLDRRIY-IEFV---GDNH-FYL-SL-DHDQTEGRP-----------------KYKF-G
A0A4Q8RX32      VVFNVEVL--------SASE-FVL-SA-KNEECMLYDFQKERNDREVANFEMSQKFNF-G
K0X1U5          DTLSSGFV-VKVQTGGSDDK-IKVLLK-KG------------------------FFTT-L
R5EXK3          DTLSSGFV-VKVQTGDSDDK-IKVLLK-KG------------------------FFTT-L
A0A401UAP7      -YYNLNHT-IDKK---SEAQ-FEI-TL-SDGEKL--------------------TGNF-G
A0A1W2GF52      ALLDKRFD-IEIL---NETD-FYI-SS-EYLGGRIGE-----------------KQQF-G
A0A2G5L7B8      SILNRRID-VEIL---SDDH-FVM-DF-ELHGTSHRT-----------------RYPF-G
A0A523GAC0      WVYDQQFT-VAIS---NEDE-FIL-GY-PDHTQIPDQ-----------------SCRF-S
L8JW09          QLLDRRIF-VNIV---DEKT-YTI-NF-SGDEQEKAM-----------------KYNF-G
A0A364XUP5      GLYNIPLH-LTET---DGNS-FSI-KV-GESQRKI-------------------TGKF-N
A0A1M5RLA9      SSFNVPIH-LDDS---GSDE-FTL-QV-GDEGQKT-------------------TGRY-N
A0A385SFR9      SSFNAPIH-LDDT---GNDE-FTL-QV-GDEGQKA-------------------AGRY-N
A0A5M4A9J4      QLVGATFE---FDAQPHSGR-FIL-NV-TGEKPRTWDFRHRQAIHQYSDYSVTLPVRL-N
A0A5M4B1C7      QLIGATFE---FTVDDKGHT-SEL-KV-KGEKPAIYNYENKTVLQKPEEIDKTIPFSI-N
A0A0D3LFR6      RFFNQKIY-VNIH---DLQE-YTL-SY-FQGENEVSN-----------------RYRF-G
M7N6D4          SFFNRRFF-VRIH---NSEE-YTL-SY-QLGDQEISG-----------------RHRF-G
A0A4D7K1D4      RLFNVHIS--------SKEH-YTL-TY-ELGEVTQRF-----------------EANF-G
A0A5C7MX19      DILRVPIY-INII---DEEK-FSI-NH-IYKDGEFER-----------------IYRF-G
A0A1Q3ZMZ7      SIIGQPVY-LILQ---DENL-I---RY-QSKGKTYTF-----------------PFVF-G
A0A2D8JJW3      EGCGTLIENISETIQIKNEK-NALNNL-SLHSDNTVFDLSGVVIP---------DGDF-K
A0A2W2AFF7      DMYTFSVK-I------NGDN-IALKCS-GKKCNNVDW-----------------KGKF-G
R7PCR1          LAFDVKIL--------DENS-FELKNL-QFEDFDSEFNY---------------KGTF-G
A0A2N5YXE2      VILDQKVN-IEFVDYKCHLY-YKIGNQ-DY------------------------EYLI-S
A0A1G9E2A9      AIQDRSIE-LEVL---NERE-YRL-KY-ELNGEEIQG-----------------NFLF-D
A0A098LL25      DFLDFKFD-ITFL---DKDK-FLL-SY-KKNDEEIKS-----------------EHYF-G
A0A6J4H627      AAYDKPID-ITIQ---DNSE-FVL-AY-TEDGKELSH-----------------TGTF-G
A0A6C0GJI1      VPYDRPFD-VQLL---NNSQ-YEL-TY-KQGSNDVSN-----------------TYTF-G
A0A2T2YJE8      AYYDRRYN-VTLL---DATR-FNL-SY-LEGDQEITE-----------------EHTI-G
A0A7L7LEW0      AYYDRKYN-ITLL---DVNR-FNL-SY-LEGEEEITE-----------------EHTI-G
A0A127B287      DLYDQKIY-VTFD---SRTR-YTV-QI-GEDGKK-SD-----------------VHTV-G
A0A6P1P2P6      DLYDQKIY-VNFE---SRTT-YTT-QI-GEEGEK-SK-----------------AHTV-G
A0A3M9N829      DLFDQQIF-IAFS---SPSR-YEV-YV-GEEGERLV-------------------ATV-G
A0A0P0CSF9      NLYDQKIY-VKFT---SPSR-FDL-YV-GENGNQSS-------------------YTV-G
A0A5M8QQB8      NLYDQKIY-VKFQ---SPSR-FDL-YV-GETGTPSS-------------------HAV-G
A0A3M9MNC3      SLFDQKVY-IHFN---SPSK-FDI-YI-GKEGKHSS-------------------HAV-G
A0A5B6TAX2      DVYDQKIY-VKFE---SPSK-FDV-YV-GEEGSHTS-------------------HIV-G
A0A7L5A132      SFYNRKFN-LNFL---DANR-FRL-TY-LLNGQEAGG-----------------EYRF-G
A0A512AYT3      GFYNKNFD-VNFL---DENR-FTL-SY-QVGEEEISG-----------------EYRF-G
A0A5M6CYN7      RFYNKKIN-VDFL---DANR-FRL-SY-LVGEEEISG-----------------DYRF-G
A0A369QP10      AYYNIKFG-VSIL---DATR-YNL-SY-VQGDQEVTE-----------------EHTI-G
A0A7G7G7M4      AFYNVKFG-VTLL---DANR-FNL-TY-LQGDEEITE-----------------EHSI-G
A0A126PDF2      DLYNQKIS-LAFT---SPTR-YSI-SY-SGPGTALDG-----------------EYDL-E
A0A2Z3GKA1      ELYNQKIS-LEFT---SPTR-YSI-SY-SGPGAALDG-----------------EYNL-G
A0A502GZP7      ELYNQKIS-LVFV---SPTR-YSI-DY-SGTAATLSG-----------------EYAV-G
A0A519SBU8      QFYSRKFQ-VSFP---APNQ-YVV-SV-KSGAETLTS-----------------TRAL-G
A0A4Q3JNZ3      ELYSHKFL-LNFL---DSNR-YTV-SV-KAHNQTLAG-----------------TYTV-G
A0A519Q9V3      GLYNHKFL-INFL---TPSK-YEV-SV-KVHSQTLTG-----------------TYTV-G
A0A0M3RW20      GYYGIQFN-IQFL---NKDK-FIL-SY-ALRGNEIKE-----------------EKVV-G
A0A495VFX4      NLYGVRFN-VQFL---SDEK-FIL-SF-NLKNEEYTR-----------------EYKV-G
A0A418R9X5      AMFNQKIG-LQLL---ENDR-FSL-QL-PNG-ASATQ-----------------ALKF-G
A0A428JSJ3      AAFNQKIG-LELL---DNDQ-FKL-HL-PGN-GSETS-----------------ALTF-G
A0A428KI59      AMFNQKIG-FQLL---ENDR-FRL-QL-PGG-AAETG-----------------ELSY-G
W8F1I6          ALFNQKIG-FQLL---ENDR-FRL-QL-PNG-GTETG-----------------ELSY-G
A0A246FQC0      AVFDLKIG-INLL---SATT-FQL-IL-PDGLGGGEQ-----------------EYRF-D
A0A372E5P8      AAFDQKIA-LRFL---SPTT-FEL-IL-PEDLGGTEQ-----------------QHTF-G
A0A1H3EMW1      ATFDQKLA-LRFL---SPTT-FEL-TL-PEQLGGGEQ-----------------QHSF-G
A0A1H9ZSN3      AAFDRKIA-LRFL---SPTT-FEL-TL-PEELGGTEQ-----------------QHTF-G
A0A1S9B3W0      SQFNLKFS-VKLL---DAQR-FKL-SY-PAGAGETEG-----------------EYRF-G
A0A1W1VRL3      AFYNRKFN-VNFS---SPTQ-FRL-SY-LEGEQEVSG-----------------VYSV-G
A0A7G6YQJ9      SQFNTRFA-VDFL---DEQR-FTL-SY-EVQGKEQGQ-----------------EYQV-G
A0A1M6R305      ILYNTKFS-VVFT---SPQK-FRI-SY-LQGGQEQTS-----------------EHTV-N
A0A7G7W8X3      ILFNTKFG-LSFT---SPTR-FRL-SY-LQAGQEQTG-----------------EYSI-G
A0A4Z0PHK3      SFYNTKFS-LTFT---GPQQ-FRL-SY-LYQGQERTA-----------------DHAL-G
A0A2M9B9H9      NFYNSKFN-LNFT---GGKQ-FRL-SY-LYLGQERSA-----------------TYTL-G
A0A4Z0QCY9      NYYNTKFN-LNFT---GPQQ-FRL-SY-LYQGQEKTG-----------------DYTL-G
A0A5N1J2M4      ELYDKPVE-VEFL---NKDR-FRL-TY-TLGNKTNTG-----------------EYGF-G
A0A519S476      ELYGHKFQ-VSFP---TPDT-YQI-SV-KAHGQTLTG-----------------TYPV-G
A0A4Q3JRW8      ELYNHKFL-VNFL---PSNR-YQI-SV-KVRNQTLTG-----------------TYAV-G
A0A519M923      ELYGHKFQ-VSFP---TVSQ-YQV-SV-KAHNQALTG-----------------TYPV-G
A0A4Z0ENW1      VYYNHKFD-VEYI---DTKH-YRL-SI-TTANTTLGG-----------------NYEF-G
A0A519UDB4      SYYNRKFN-IEYI---DAKT-YRL-SV-NVGSNILTG-----------------NYAF-G
A0A3S0QKV1      IQFNKKFS-VRLL---EGKR-FRL-SY-LMGQQEIDG-----------------EYQL-E
A0A328BL48      LQFGQKFS-VEVL---DQNR-FRL-SY-AQGQAEQGG-----------------EYSF-G
A0A5R8WLY4      LQFGQKFN-VEIL---DQNR-FRL-SY-AQGQGEQGG-----------------EYRF-G
A0A1I5WSL8      SLYNRKFD-LRFI---NKQR-FIL-EF-MGQGRPTSG-----------------EYAL-G
A0A0U3JVM7      SLYNHKFD-LKFV---GPQR-FAL-EF-TGQGRPLGG-----------------EYSL-G
A0A1G1SSV2      SLYNRKFE-LRFT---GPSR-FKL-DF-VAQGRPLGG-----------------EYAL-G
A0A1G1SXV7      SLYNRKFE-LRFT---APGR-FRL-EF-VGQGRPLGG-----------------EYAL-G
A0A6G8CBJ6      AFYNRKLN-VSFI---SPTQ-FRL-SY-LEDKEEVSG-----------------DYAV-G
A0A0W8EDI5      ILYNRKFD-IVFS---DAKR-FSL-VS-KAESGDVRV-----------------DGVF-N
A0A3B7RBP8      FLFNKKIY-INFI---DEQH-FLL-LY-RKNDVEQKV-----------------NGKI-N
A0A3R9P8H7      AAYDQKIA-VQFM---SPTT-FRL-TL-PESLGGGVQ-----------------EHTI-G
A0A238WIA7      SLFNTRFN-LKFL---SPNR-VQL-TY-LEGGQEVVK-----------------ETGF-D
A0A212UCJ7      GQYNTKFG-LRFL---TPQQ-IEL-TY-QENGQEVIQ-----------------KAIL-G
A0A4Z0MQE1      GQFNSKFG-LHFL---SPQQ-IEL-TY-QEGGQEKSQ-----------------KAAV-G
A0A4Z0PCF4      GQLNTKFG-LRFL---SPQQ-VEL-TY-QEAGQEKTD-----------------KANI-N
A0A6M6BED0      GQLNTKFG-LRFL---SPQQ-VEL-TY-QEAGQERTE-----------------KAAI-G
A0A5D6VDG1      SLYNTRFN-VLFT---SSTK-FQL-SH---EGHEATS-----------------EYAI-D
A0A243WHR7      SLYNTRFD-LTFS---NPQQ-FRL-SY-QYKGQEISA-----------------EYRF-G
A0A5B8A0P6      VFYNTPIN-IQFV---DNKH-FKI-SY-NFQGQEVNR-----------------EHSV-G
A0A076HRT9      VLYNTKFN-LRFK---DAQF-FHL-SY-QKDGQEQGG-----------------DYAL-N
A0A4Z0PVM7      NFYNSKFN-LNFT---GPQQ-FRL-SY-MYQGQEKTG-----------------DYTI-G
A0A1M6DHW8      SLYNTKFN-LVFT---GSQR-IRL-SY-LYAGQERSG-----------------EYSL-G
A0A4Q5LC61      GLYNTKFN-LIFT---GPQR-IRL-NY-LYGGQEQSG-----------------EYSL-G
K0XJ09          DAYTAPVS-MEIKPL-NGNR-FLLNQL-KIGTKKSDNEGQ--------------EFLF-G
R5EUZ0          DAYTAPVS-MEIKPL-NGNR-FLLNQL-KIGTKKSDNEGQ--------------EFLF-G
W0EQS0          DPYTAPVF-MKIRPL-DDTH-YLLKQF-SVGGVKSEDREQ--------------EIAF-G
A0A1Y3WE15      DDYTAPVS-MKIKPV-DENR-FLLKQL-SIGGGKKSESEQ--------------EIAF-G
A0A1Y4GUK3      DAYTLPVS-MKVSPI-DENH-YALKEL-NVGGKKTNEGNQ--------------QIAF-G
A0A2U1FKU2      EGYSFRIQ-IK-----DEKT-FRLTHF-KRHAGRGLSGMEV-------------DGTF-G
A0A0A2F954      ENYSFRIR-IN-----DAHS-FQLTHF-EQKERNGIGDIKI-------------DGSF-G
A0A0A2FW91      ENYSFRIR-IN-----DAHS-FQLTHF-EQKERNGIGDIKI-------------DGSF-G
A0A2D2N2N1      ENYSFRIQ-IN-----DAHS-FQLTHF-EQKERNGIGDIKI-------------DGSF-G
Q7MWZ2          ENYSFRIQ-IN-----DAHS-FQLTHF-EQKERNGIGDIKI-------------DGSF-G
T2NDT6          ENYSFRIQ-IN-----DAHS-FQLTHF-EQKERNGIGDIKI-------------DGSF-G
W1R7P9          ENYSFRIQ-IN-----DAHS-FQLTHF-EQKERNGIGDIKI-------------DGSF-G
A0A1R4AFZ0      ENYSFRIQ-IN-----DAHS-FQLTHF-EQKERNGIGDIKI-------------DGSF-G
A0A1R4DVZ7      ENYSFRIQ-IN-----DAHS-FQLTHF-EQKERNGIGDIKI-------------DGSF-G
A0A7C0WKI7      ----------------EKDS-LKL------------------------------------
A0A2A8CVM9      ------------------------------------------------------------
A0A5M4B212      QLLDANFD-LHIL---PDNR-IEM-TV-RGKEAIRYDFQNEKELKPAREIEQTRTFPV-N
A0A3D1KEX9      PYFEDISFEVELL---PSKQ-LKVSDM-QIDDSDVDFKQ---------------VVSY-G
A0A358Y7S2      SLCGTEMH-VS-----VEND-LILIDY-EKSGAKNKL-----------------KLKP-N
A0A1X7J248      --YGEKFF-VDII---DKTN-FKI-ST-NQDGEEWV------------------SQKF-G
E4TQD2          --YDQKFY-VDII---DKEN-FKL-TT-NPDEDQWI------------------NQKF-G
A0A2J6HHN3      TFYAESLD-ITI----HDDH-LNV-SY-MNLDGSMEDK----------------SFQP-Y
A0A1Y3WMT8      TLVSGFVVKVQTNKGSDKIK-VLL---------------------------KQGFFTT-L
A0A1Y4GQU1      TLVSGFVVKVQTDKSSDKIK-VVL---------------------------KRGFFET-L
A0A6A0R272      -ITPLEID-LEFK---DENH-FII-SY-EKNGIRDTSI----------------NLTY-N
A0A1V5W8T5      AIFNKNIY-LDYN---KKTD-KITIEY-SLDGEKSIKH----------------EIKR-N
A0A2T8HKA9      AHASMTII--------PKDS-NHVDFL-LMENDNIIHSQ---------------RIKL-R
A0A2I0QZ80      SLLNTPIN-ITT----EGNK-IFL-NF-THQNKAHHI-----------------AIQP-N
A0A3E1F1A3      SLFGVPIY-LSV----DEEK-VLM-RF-NHKGVDYNY-----------------KFIP-N
A0A2U2XBJ3      SLFGTPIF-LSS----MEDK-IIM-NF-KFNGGNYNY-----------------KFAP-N
A0A4Q4KU94      SLFGTPIF-LSA----FDDK-VIM-NF-KYNGGNYNY-----------------KFSP-N
A0A3B8INU3      AVFDKKVM-VTIL---DNDR-YEI-RF-PWVGEDVQPE----------------EHRF-G
A0A2W1NDY9      SLINVPIY-LK-D---GQDG-LYL-VF-NANQKKNEI-----------------PVAH-D
A0A5C8AQR5      ALCNVPIY-VEYM---GNNR-IRL-NY-ELHGQKISI-----------------NGSL-N
A0A1G0CI31      SLCDIPIW-IE-L---KGNK-VQL-SY-QVGGKSYSM-----------------LKPI-N
A0A556N0M0      SLCDVPIG-VETT---DNRR-VKL-TY-VLNGQTYSK-----------------TSEI-N
F2IKD6          SLCDIPIW-IETL---ENRK-IRL-SY-SLLGRNYSK-----------------VSAI-N
A0A1I7BM74      DLYNLPIY-FYKD---NSNQ-YKI-KY-NYKGKEYIE-----------------EVFL-N
A0A2G2FJ17      SVFHIPIY-IKPK---AQGL-VEL-SM-QRHGERLKW-----------------DIES-N
A0A2E3R1D0      ------------------------------------------------------------
A0A2T2USC0      ------------------------------------------------------SDTS-E
A0A2T2V0F3      ------------------------------------------------------------
A0A2T2S682      ------------------------------------------------------------
D5H561          ------------------------------------------------------------
A0A2H3NWA9      ------------------------------------------------------------
A0A2A8CVB6      ------------------------------------------------------------
A0A2P6C1S6      ------------------------------------------------------------
A0A2T2UTM4      ------------------------------------------------------------
A0A414ZBF2      SLTATAI---------DGNR-ALLSDF-VLDENDFDEVV---------------TVQM-G
A0A1Q3Q573      -FYGNPVY-IRLV---NKNS-MVV-SY-SF-NGDEFEK----------------EIKP-E
A0A662BAY3      QLIYADFL-LEIL---PDGK-LLI-KV-EDEHAAIFDFLNSEIVTYVTNLSFSKEAAY-N
A0A4U3L369      TLHWKEVNPTSYALFDSKDK-QVV------------------------------TGTY-G
A0A357YNR3      NLIDKVSIDVVVY---PTGN-YNF-SV-EYNKNNFHYN----------------LSPG-D
A0A5E8AX52      GFFDRPID-IEII---SESE-FEL-SF-EPAEQSGAS-----------------RHKF-G
F4KK08          EKISLRIK-SDKEAHNQVIL-YDI-KS-SLIGKVQEPI----------------AATL-G
A0A6B5PK86      TLVGTPVT-ITY----VNQL-VNL-NY-VH-EGKAYTV----------------KGKL-G
A0A2G2F510      TLINKEVR-VDY----DGEN-ISL-SY-LK-NGETKVV----------------KGYV-N
A0A316JZ08      TLIGQEIG-ITT----RNDQ-VIL-SY-SK-GGKNVKL----------------KGPL-N
A0A496LCF9      GYYMYYSY-----KKRDSHS-FTITIY-DNTDNEIETI----------------EGTF-N
A0A5P2G2A9      PIKGYKFE-ISSW---DEKG-IAL-IR-KIKDEDDSTF----------------FVKW-G
A0A3C0ZQC7      ----------------TNSE-RILIIW-DRAESGPEDI----------------------
A0A3N2N6F7      RGLRMRMTILE-----DGKV-EVSDMY-DHLGNELDVM----------------TVTL-G
A0A419VXB7      NLKGVPVH-ISPI---NDRE-FKI-EV-KSKANLLGINTEVDFEG---------TGVF-G
A0A0B0BTJ4      IRYTFNIH-IKSIEDADGSF-KALLEY-RLPGQKTTEKTI--------------TGAF-G
A0A3B9CNN6      IRYTFNIH-IKSIEDADGSF-KALLEY-RLPGQKTTEKTI--------------TGAF-G
R5X290          IRYTFNIH-IKSIEDADGSF-KALLEY-RLPGQKTTEKTI--------------TGAF-G
A0A1Q6E6I7      IRYTFNIH-IKSIEDADGSF-KALLEY-RLPGQKTTEKTI--------------TGAF-G
C3J7R8          VYCKLEVSSVDA----SHVS-LLCEES-SIEAARGTTS----------------QVQI-G
A0A1G8BVM8      KQGMFTIT-VTLL---KNNK-AKL-TY-NISETRDDGEIISNDVVD--------DISL-D
A0A1I1FXP9      AFYDIPVD-VLFI---DEKQ-FSL-KY-KL-GNVNYSR----------------NFNF-D
A0A4P7VVU7      QSASMELD-IRDDGKIDISK-MMLNGV-ECDPSEM-------------------TVNI-G
A0A2V1ILM4      QSASMELD-IRDDGKIDISK-MMLNGV-ECDPSEM-------------------TVNI-G
A0A3N2L0E8      QSASMGLD-IRDDGKIDISK-MMLNGV-ECDPSEM-------------------TVNI-G
A0A3N2LFC5      QSASMELD-IRDDGKIDISK-MMLNGV-ECDPSEM-------------------TVNI-G
A0A7K3KWJ8      QSASMELD-IRDDGKIDISK-MMLNGV-ECAPSEM-------------------TVNI-G
A0A3N4H5N3      FVGGGELLQIHLK---EENK-FEL-IL-EDEKKA--------------------EFEF-N
A0A2P8EAX2      FLLEGEVFTIKVL---NEKK-FEI-EF-AKNKKT--------------------EFNF-G
A0A4V2F6N9      FLSGVEVFAITIL---GDKK-FEI-NF-KDNKKA--------------------EFNF-G
A0A3B9FXJ0      TVLGDVIE-LRPI---GDQK-IRC-AY-EW-KGETWSQ----------------ELEY-N
R5GSU5          IDEDITFK-VDLI---DNQK-FRIFDV-RYKDEDCRIDK---------------VVAY-G
A0A2A3UE91      TVYGSQIK-VELNKQLTGGV-LKIGTQ-KL------------------------NFAL-N
A0A0A2G557      DTLSGSFS-LSFI---EENK-VSLSNF-EGDFEQLSSAPKM-------------IVSL-G
A0A2N2WFW8      LSYGTPYS-LTV----GDST-FVI-ST-KTAGGTESET----------------EFRF-H
A0A1F3IU95      TFYGVPLL-IEV----HDTG-FVI-T---EINGIQTDK----------------SFRF-H
A0A3D0VUF6      TFYGVPLL-IEV----HDTG-FVI-T---EINGIQTDK----------------SFRF-H
A0A1T4PT95      --HSGSFI-LSFE---GSDK-VRLSHF-KG----DFSK----------------TSPL-S
A0A6I6JYY3      QLTNSEFL-LQID---ANGK-LHL-KA-QGENAEVYSYSEDEVLKKISNFSFSKDMDP-G
A0A2A4PYG9      GLLGKPIY-ISFP---STKK-IYT--S-YYVGEEQFNK----------------PIXI-G
A0A1F3K695      RIYEIPIY-IDFI---SSKE-TKA--L-YKIGEENHEF----------------AIYS-N
A0A353KZR1      RIYEIPIY-IDFI---SSKE-TKA--L-YKIGEENHEF----------------AIYS-N
A0A2N2WYB5      SIFNTPIY-IDFT---DDKN-GIITTY-VKKEGYDQK------------------IEL-N
A0A1F3K4G0      KLYDIPVY-IEFD---GSEK-ALI--Y-YGDGGVNASY----------------PIEI-G
A0A356H8Y3      KLYDIPVY-IEFD---GSEK-ALI--Y-YGDGGVNASY----------------PIEI-G
A0A351HSA6      KLYDIPVY-IEFD---GSEK-ALI--Y-YGDGGVNASY----------------PIEI-G
A0A1F3Q014      KISGVKIY-IDFV---DSTH-GTI-SY-SFDNETEQQH----------------NFIS-N
A0A2D5KD44      SLSSTKID-ISFA---NSSS-GKL-SW-GEG--KESSV----------------DFYA-G
A0A6N9NIX1      SLIGRPIF-VDFS---NKTN-GSI-SY-TNTNLEVNNY----------------DVTF-N
A0A2A4YXP3      SILGQHFY-VKFI---DTHK------F-ELVVNKLVLG----------------EYQT-N
A0A1F3R158      SVIGISHF-VEIT---NNNK------F-KLYENEKLIG----------------EFSD-R
A0A2M8ADX2      SIIGLPFY-IELT---QNDK------F-KLFENETFLG----------------EFIN-N
A0A1J5B2H0      AIYGIPIY-INFN---DDKQ-IKI-SY-CISDNSKIEK----------------TFGL-T
A0A1V5N756      VIYNVPIN-ISFL---SNSN-IHI-DF-EAEKKSN-QY----------------EFSI-L
A0A651GU15      SILDKQIF-IRNL---ADGR-YEL-HL----NNNAISD----------------PFLP-N
A0A3Q9FR88      TLKDLPFF-LEFSN--GGKD-FII-TY-KI-GEQQIEI----------------AGKS-G
A0A553GEX3      ALKDLPFL-LEFSN--GGKN-FII-TY-KI-GEQENEI----------------EGKS-G
A0A150ADJ9      FLQDKPIL-LNFSG--DGKS-YQL-TY-NQ-GKS--VV----------------EGIS-G
A0A1B1FWQ4      ALKNTPFY-LQFSN--EGKE-YVI-TY-KV-GQTEKEI----------------KGSS-G
A0A1S1Z228      AFKDIPLF-LQFLN--GGDQ-YQV-TY-KT-GDQENTI----------------SGKS-G
A1ZKR2          AFLDKNIN-IEII---DDQR-FQL-SY-VL-GTQTVKK----------------TYRF-D
A0A1Q3GX01      VYYDKKFN-IRIK---NQNE-FEL-SF-QV-GTNLKKQ----------------IYKF-D
A0A349DQI4      GYYDKKFN-IKLK---SQKE-FEL-SF-QT-GKVLNKQ----------------VYKF-N
A0A4P5TMD1      ALYDIPIY-FIFK---SARE-FQI-EY-RI-LKVKYSF----------------NGKF-N
A0A2N3IIZ0      NLYNQKFY-IESE---DGHS-YNI-EV-KNDKKTLAEY----------------KGKF-G
A0A7K3WUF2      SIMDTPIF-VHFN---KDNT-FQL-KV-GERNLGEQER-------------------V-G
A0A1F3SJM1      SLVYEGTE-VAVAY--NNGK-VVL-SY-LK-NGKKKTI----------------RGNL-N
A0A2G2EB96      SLINQEIA-V-TSS--GNSK-VKL-TY-VK-NGKQVIL----------------SGKL-N
A0A2G6PRA9      SIINQEVA-V-VSK--GRNK-VEL-SY-VK-GGEKQRV----------------EGML-N
A0A497D5Z2      QVINADFY-VSFL---PGGK-LEL-SV-DGENVPVYDYLNDKVIKRLPDLAWFGEGDA-G
A0A662B170      QVINADFY-VSFL---PGGK-LEL-SV-DGENVPVYDYLNDKVIKRLPDLSWFGEVDA-G
A0A2A5FYT6      SIFGRKIY-IQFD---DEFK-AIA-SY-TI-NDSVYSR----------------EAPI-N
A0A2E6SYP1      SVLNKLIQ-IEFV---KGCA-LLS-FN-DD---PSSNT----------------IVPV-N
A0A2E5RLE8      EAVKSPIM-VNFS---NGSA-IIS-KV-DV---DSGTV----------------LIPV-N
A0A2E7TQF6      EAVKSPIM-VNFS---NGSA-IIS-KV-DV---DSGTV----------------LIPV-N
A0A2E6GVY9      KAVNYPLM-INFK---NGSA-VIS-KM-DV---DSGSF----------------IIPV-N
A0A350JJ90      IILDRRIY-IEFE---TPTS-GTI-NY-LV-GTKSFSE----------------KFAE-E
A0A3M1CDV2      NIYGKKIY-VDFNDNLQTGK-IKI-LL-SE--DNLIQI----------------PFHI-N
A0A6C1QGZ7      SIYGIPVY-LDFV---SQEN-III-SF-TH-RGQSKKY----------------EIHV-N
A0A4P5U6G4      SIYDLPIN-FEFI---NNKS-FKI-SY-RI-GQQKFIY----------------NGSY-G
A0A2E2TFD1      EAFAHKYY-IYFP---NTTQ-IHL-SI-DEPIGDANYQ----------------VFKI-D
A0A2E4ELE6      EAFGKDYY-VYFE---SEKE-LIL-TI-ENGKETVEKR----------------LSTN-K
A0A522EYA6      IIYGTKIY-VYFD---SETS-GEI-TY-TV-GDQIKTH----------------KFKQ-G
A0A2E3XZI5      SIISKKIY-LKF----EKNY-FSL-VD-EE-NEKIYAE----------------YIEA-N
A0A6I7QXV0      AIYEREIY-INII---DRNT-FTL-EY-EI-NRNRIRE----------------TLSF-D
A0A2M7NLQ9      SFYNRHLD-IQII---DEEE-FVL-TY-QTATGEDFSK----------------IYKF-N
I4AFR0          SFYNHPLN-IQII---DEEE-FVL-TY-ETPTGDNFSK----------------IYKF-N
A0A2N2Y3E5      KHFDVPIA-LDFE---NITD-GWL-YF-QN-NSSAEKV----------------KIKT-G
A0A2D9D7T6      TLCGVHFD-IKE----KKGK-LEI-SY-TH-NGQSKKI----------------SGEL-N
A0A1F3PPL5      AIYDKKIY-IDFE---NPTT-YHL-KI-NS-DDLEFE-----------------NLSV-G
A0A357QK06      AIYDKKIY-IDFE---NPTT-YHL-KI-NS-DDLEFE-----------------NLSV-G
A0A662AEA4      SIYNTPIF-VNFN---NKNS-FSI-QY-EI-NGNEYKY----------------ELKT-N
A0A0S2HYK8      KAFGIPVF-ISFK---DKKN-VVF-EY-EY-NGETYSY----------------PGEA-G
A0A2N5ZWN6      SIYGEPIH-IQFI---DENN-AKI-EF-EI-GDNIITK----------------DIEI-N
A0A2E0FJ09      SLVNVPIY-VLLK---PDKT-IHL-KY-TV-DEETFEF----------------NESL-N
A0A1F3FZ62      SIYGINFD-IEFK---GNNK-YIL-RY-LL-NEKLNIR----------------EFYF-N
A0A1F3K211      SIYGINFD-IEFK---GNNK-YIL-RY-LL-NEKLNIR----------------EFYF-N
A0A1V6I2U9      EIYDQNID-LEF----KDYK-CHI-AY-TL-GNQKYEY----------------TIQP-E
A0A2H0B957      NLYNIPIY-VSFS---LNGD-AAI-KY-TY-NNQIVQK----------------SLKS-N
A0A1F3CFW6      NLYNVPIY-VSFD---KNGD-SNI-KY-KT-NNTNFEK----------------TIKK-N
A0A2M7E2T8      NLYNVPIY-VSFD---KNGD-SNI-KY-KT-NNTNYEK----------------TIIK-N
A0A2M7NC69      NLYNVPIY-VSFD---KNGD-SNI-KY-KT-NNTNYEK----------------TIIK-N
A0A1F3KLL5      EMYNNQIY-ISFL---NKNS-FTL-EY-YI-NGVKSHY----------------SLKP-D
A0A359D1M1      EMYNNQIY-ISFL---NKNS-FTL-EY-YI-NGVKSHY----------------SLKP-D
A0A0F2NS19      SVLGKKFY-LEKT---NNEK-FNL-FQ-SE----KLIG----------------EFSS-N
A0A2A5H8X6      SVLGKKFY-IEKT---NNEK-FNL-FQ-SE----KLIG----------------EFSS-N
A0A2H0GAU8      SIVGIPFF-IEIT---KNNK-FNL-FE-NE----TLLG----------------EFEV-D
A0A2M8FTK1      SIVGIPFF-IEIT---KNNK-FNL-FE-NE----TLLG----------------EFEV-D
A0A2A5B3B0      TILGQSFF-VEFI---DDYK-FRL-TQ-ND----KVIG----------------DFNV-N
A0A5C6RXM7      SIINHTFN-VVIN---DINQ-FEL-RD-GE----EILG----------------VFKS-G
A0A1F3C1M2      IVYDIPIY-IEFI---DKLN-FNL-SF-TI-NEKTIEK----------------KFTI-G
A0A1F3DS87      IIYDVPIY-IEFI---DKIN-YNL-SY-EI-NDKKFER----------------KYTI-G
A0A6A0R6K9      TMGSRKVM-IDFVSKEKGTL-SWH-EG-EK-IVRQNVH----------------FNQK-V
A0A2E7CT70      IIIGLPIY-IQK----KGDY-FIL-TD-FD-NQKSYAK----------------FIKP-G
A0A2D5V560      SIISKPIY-LLF----DGNY-FSL-TD-EK-AEIIYAK----------------YILP-N
A0A2D7K5A8      SILSKAIY-LLY----DGTY-FSL-TD-EN-EEIEYAN----------------YILP-N
A0A2E1XQ82      SIFSKPIY-LSF----DGTY-FSL-KD-KN-QEIEYAN----------------YILP-N
A0A5C8A5B4      -------YRVKAQGKN-----VRLYNV------------------KTQEVLPELIEKY-E
A0A7C1LGX3      -------LSVNFMAND-----IEVTDS------------------NGNNFTLFYKQSE-N
A0A4Y9ITE2      -------------------P-VIFKLTATKDGKVDIKLKKGRFSTIAETSGKTFPAK--F
A0A5M8NYX7      --------------------------WG---------------SFILDKKGDTFSIEAQG
A0A0E3V905      -------------------P-LEVSMLS---------------NKAVKINEQVYPVNHAI
A0A553ETH6      -------------------R-IYVRLIN---------------KTKYQISFDGEDVSGAA
A0A640Q161      -------------------------------------------AEFMPKDEEPSFVDALK
A0A640QU49      -------------------------------------------DDFMPAEDESSIVDDIK
A0A1Q3PII2      -------------------T-TY---------------------HIERRTGNTFTVRTPS
A0A351BXT2      -----------------------------------------------------------I
A0A2K8Z965      -------------------P-LDITLPG---------------DNTVTINEHVYPLNKSI
A0A418M8U8      -------------------P-MLLTFID---------------SSSVEINEQVYPLNQRI
I2GTA4          -------------------P-MLLTFID---------------SSSVEINEQVYPLNQRI
A0A2K8ZAJ2      -------------------E-LKFLFVD---------------SKMVKLNGHMYPVNQSI
A0A368JPA3      -------------------D-LEIGIIS---------------PTTVRLNDWVYPANQII
A0A5N1JI29      -------------------D-LEIGIIS---------------PTTVRLNDWVYPANQII
A0A7K0EGC9      -------------------D-LQIGIIS---------------PTTVRLNDWVYPANQVI
A0A3P1BT12      -------------------D-LEIGIIS---------------PTTIRLNDWVYPANQII
A0A3P1CI15      -------------------D-LEISIIS---------------PTTVRLNDWVYPANQVI
A0A4R8CUK1      -------------------D-LHIGILS---------------PTMVQLNDGVYPANQSV
A0A3D0MYJ7      -------------------L-YP---------------------NLYIKNKENTYNLINE
A0A662AH13      -------------------S-FY---------------------NIFDPKFEIIEENNNP
A0A5C7QA01      -------------------L-HL---------------------KINQNNYQLLDANTAE
A0A3D3LS70      -------------------D-FY---------------------YLINRNKKVNSEHILQ
A0A1G1TM36      -------------------V-LN---------------------IVLQDTASFAVRAADG
A0A1G7ZF38      -------------------E-SY---------------------LIIRETDSTFRLQTSD
C6VS52          -------------------E-TY---------------------HIVRQAGDFYIIEISG
A0A2A4G4B1      -------YTFDFALLDSENFSLSINGS------------------------EEMPLHF-N
A0A0P7X1V8      -------------------P-VIWRAF---------------------------------
A0A6P1P355      ----KVYFAFDKGKQQ-----VTVGHK---------------------------AYPM-N
A0A5C8KAD6      ----QVYFTYNNKTKK-----VKFDGM---------------------------KYPL-N
A0A5N1J695      ----QVYFTFNEGTHK-----IKFQEK---------------------------EYPL-D
A0A3N2M1H3      -------FKMELSADG---N-IKMREF-------RKFTIDGKIELAGEATL--PKG---K
A0A4S2G8T2      -------FKMELSADG---N-IKMREF-------RKFTIDGKIELAGEATL--PKG---K
A0A212K7W5      -------FYIELLPQN---K-IRLANL-------T---LNGEELDFPD-----EEINL-S
F5IU11          -------FQIELLSQN---K-IRLSDL-------I---LNGEELDFTD-----KEINL-S
A0A7C1QWC7      -------YRLRIAEDN-----VSLYNY-------LDNKITSSG--IQVYSD--TVCKF-N
A0A352Z1R7      -------FTVKDDDDK----------------------LVGEG----------SSGRL--
A0A0A2F501      -------LTLTILANG---Q-FAISNL-------M---LNDNE--LQTQR---ITCSL-G
R5B7P0          -------FTVS-ENGG---R-VTLNDF-------I---HKNEK--VGGKP---VVGHY-G
R5B0L5          -------VIVKINKKG---V-IVLSDL-------V---LNNIP--VDLPNS--GVAIP-G
A0A6I1TEC0      -------MTVYLKGGD---K-FELTDF-------KGTSSNGTP--VETNKT--VTGKL-G
A0A3R5XWG1      -------MTVYLKGGD---K-FELTDF-------KGTSSNGTP--VETNKT--VTGKL-G
A0A5P0Y910      -------MTVYLKGGD---K-FELTDF-------KGTSSNGTP--VETNKT--VTGKL-G
A0A414YFM3      -------MTVYLKGGD---K-FELTDF-------KGTSSNGTP--VETNKT--VTGKL-G
A0A6A7UIA7      -------MTVYLKGGD---K-FELTDF-------KGTSSNGTP--VETNKT--VTGKL-G
A0A6A7VPS3      -------MTVYLKGGD---K-FELTDF-------KGTSSNGTP--VETNKT--VTGKL-G
A0A374THP7      -------FQLQLKGDG---S-YVISKI-------KGSNRDNLP--VDDSDE--ISGRL-G
A0A6G1VND1      -------FQLQLKGDG---S-YVISRL-------KGITRDNLP--VDDSDE--ITGRL-G
A0A0A2EVS5      -------LSVTVRGDG---M-VEVSDM-------I---LDGEP--MGEGQI--FLGEL-V
A0A1T4NAJ7      -------LSLTVRGDG---M-VEVSDM-------I---LDGEP--MGEGQI--FLGEL-V
A0A255T941      -------FVIKLNDEH---S-FTLYDF-------K---MYTEDGKVEYDKE--VKGNI-G
A0A4P7VSV0      -------FRVEVDGDG---K-VSVSDV-------K---SGDLK--SEER----VQGAM-N
A0A7J0AX49      -------FRVEVDGDG---K-VSVSDV-------K---SGDLK--SEER----VQGAM-N
A0A3N2KCL3      -------FRVEVDGDG---K-VSVSDV-------K---SGDLK--SEER----VQGAM-N
A0A2V1IJY1      -------FRVEVDGAG---K-VSVSDV-------K---SGDLK--SEER----VQGAM-N
A0A4P7VXK7      -------FRVEVDGAG---K-VSVSDV-------K---SGDLK--SEER----VQGAM-N
A0A1Y4CHN5      -------FTIKPAADG---T-LGFSDF-------V---RNGEE--SDAE----ATGKL-N
A0A1M6I2S6      -------FKIDFSSKE---E-FTISDV-------M---INGEE--LETE----FSGKM-G
A0A1Y3V692      -------FKIDFSSKE---E-FTISDV-------M---IDGEE--LETE----FSGKM-G
F3PXM2          -------FDLELTSRN---D-FLLSGF-------K---VEGEE--TGET----FSGKT-G
A0A174AHH7      -------FDIEVDTQN---K-FYLSNF-------I---VAGKE--TGER----FEGNI-G
A0A174JCE8      -------FDIEVDTQN---K-FYLSNF-------I---VAGKE--TGER----FEGNI-G
A0A3E4JMC4      -------FDIEVDTQN---K-FYLSNF-------I---VAGKE--TGER----FEGNI-G
A0A412SND6      -------FDIEVDTQN---K-FYLSNF-------I---VAGKE--TGER----FEGNI-G
A0A414IEQ9      -------FDIEVDTQN---K-FYLSNF-------I---VAGKE--TGER----FEGNI-G
A0A7K0HNT3      -------FDIEVDTQN---K-FYLSNF-------I---VAGKE--TGER----FEGNI-G
A0A0M1W8D8      -------FDIEVDTQN---K-FYLSNF-------I---VAGKE--TGER----FEGNI-G
A0A3R6GKX5      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A7V4S1          -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
B0NU19          -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
D4V601          -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A0A4Q0U3M9      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A0A7J5G2G2      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A0A7J5HH13      -------FDIEVDAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A0A397WLT5      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A0A6A2J529      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A0A6N8DDD8      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A0A015XH67      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A0A078RZN2      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A0A6M4L7F4      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A6L0K5          -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A7ACT5          -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----FEGII-G
A6KY94          -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----LEGII-G
A0A173UQR8      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TEER----LEGII-G
A0A3R6HK75      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TEER----LEGII-G
A0A412B7D1      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TEER----LEGII-G
A0A412VNY9      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TEER----LEGII-G
A0A414LTU9      -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TGER----LEGII-G
I9Q4U4          -------FDIEVGAQN---K-FYLSNF-------I---VAGEE--TEER----LEGII-G
A0A373ISF0      -------FTIRIDSKD---A-FTISGL-------K---VAGVE--SENT----FAGRM-G
U6RF62          -------FTIRIDSKD---A-FTISGL-------K---VAGVE--SENS----FAGRM-G
A0A662ZZD5      -------FTIDISSKE---T-FVISDM-------E---VNGKA--FGED----FSGKM-G
A0A3A5TI83      -------FTIDISSKE---T-FVISDM-------E---VNGKA--FGED----FSGKM-G
A0A415NEB6      -------FTIDISSKE---T-FVISDM-------E---VNGKA--FGEE----FSGKM-G
A7AJ60          -------FTIDISSKE---T-FVISDM-------E---VNGKA--FGED----FSGKM-G
A0A7J5MKN5      -------FTIDISSKE---T-FVISDM-------E---VNGKA--FGED----FSGKM-G
A0A6A2JF01      -------FTIDISSKE---T-FVISDM-------E---VNGKA--FGED----FSGKM-G
A0A7J4Y8G3      -------FTIDISSKE---T-FVISDM-------E---VNGKA--FGED----FSGKM-G
A0A015UXN7      -------FTIDISSKE---T-FVISDM-------E---VNGKA--FGED----FSGKM-G
A0A6I2NTL0      -------FTIDISSKE---T-FVISDM-------E---VNGKA--FGED----FSGKM-G
A0A6I2Q447      -------FTIDISSKE---T-FVISDM-------E---VNGKA--FGED----FSGKM-G
A0A016E4F9      -------FTINLPSKK---E-FTISDV-------M---IDGEE--LGID----FSGKM-G
A0A6N3HG44      -------FTINLPSKK---E-FTISDV-------M---IDGEE--LGTD----FSGKM-G
A0A7K0HSP7      -------FTINLPSKK---E-FTISDV-------M---IDGEE--LGTD----FSGKM-G
A0A7K1HEJ5      -------FTINLPSKK---E-FTISDV-------M---IDGEE--LGTD----FSGKM-G
A0A6H9P0U9      -------FTIKFSSKE---A-FAISEL-------E---ISGED--IGET----LSAQM-G
A0A108TH71      -------FTIKFSSKE---A-FAISEL-------E---ISGED--IGET----LSAQM-G
I8VXH0          -------FTIKFSSKE---A-FAISEL-------E---ISGED--IGET----LSAQM-G
A0A412S0N6      -------FTIKFSSKE---A-FAISEL-------E---ISGED--IGET----LSAQM-G
A0A412IIJ0      -------FTIKFSSKE---A-FAISEL-------E---ISGED--IGET----LSAQM-G
A0A0P0FM97      -------FTIKFSSKE---A-FAISEL-------E---ISGED--IGET----LSAQM-G
R6KTP3          -------FTIKFSSKE---A-FAISEL-------E---ISGED--IGET----LSAQM-G
A0A139LU87      -------FTIKFSSKE---A-FAISEL-------E---ISGED--IGET----LSAQM-G
A0A1C6B3Y5      -------FTIKFSSKE---A-FAISEL-------E---ISGED--IGET----LSAQM-G
A0A6L3KCD1      -------FTIKFSSKE---A-FAISEL-------E---ISGED--IGET----LSAQM-G
E2NMQ4          -------FTIKFSSKE---A-FAISEL-------E---ISGED--IGET----LSAQM-G
A0A412YDB9      -------FTIEFSSKD---T-FTISDL-------K---VSDES--TGET----FSAQM-G
R7DY01          -------FTIEFSSKD---T-FTISDL-------K---VSDES--TGET----FSAQM-G
A0A414LGK8      -------FTIEFSSKN---T-FTISDL-------K---VSDES--TGET----FSAQM-G
A0A415IPQ4      -------FTIEFSSKE---A-FTISEF-------E---ISGES--IGET----FSAQI-G
A0A3E5BRW7      -------FTIEFSSKD---M-FTISEF-------E---ISEES--TRET----FSARP-G
K9DXS6          -------FTIEFSSKD---M-FTISEF-------E---ISEES--TGET----FSARP-G
A0A1M6KFV3      -------FTIEFSSKD---T-FAISEF-------E---VSGVD--TRET----FSAQT-G
A0A1Q6G7L3      -------FTIEFSSKD---T-FAISEF-------E---VSGVD--TREN----FSAQT-G
A0A413H235      -------FTIEFSSKD---T-FAISEF-------E---VSGVD--TREN----FSAQT-G
A0A1M5B2J8      -------FQLHLGKDG---H-YTISDL-------T---RNGTP--VEG-E---VNGQL-G
A0A255RCT5      -------FRLHLGTNG---R-YTLYEL-------T---RNGEH--VGG-E---VKGKL-G
A0A1Y4GLF5      -------FTVEIRPGR---S-FGLSDF-------T---RNGDD--MKSDK---ITGTL-A
A0A1H3XSC0      -------FTLQVQPDS---T-VRLSDF-------T---RNGNE--FDD-E---ISGRL-S
A6LE40          -------FTLEVQPDG---T-LFLSDF-------T---RNGTE--LDGKD---IKGSL-L
A0A4Y1VPX5      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEEKD---VKGSL-L
A0A6N2XMM4      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEEKD---VKGSL-L
B3JI46          -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEEKD---VKGSL-L
A0A358R8U0      -------FTLKVRPGG---E-VELSEF-------V---RNGEE--IPSEKV--IKGNL-T
R6WSB6          -------FTLKVRPGG---E-VELSEF-------V---RNGEE--IPSEKV--IKGNL-T
A0A401LPX7      -------FELYLAKDG---A-VELSSF-------T---RNGTE--IENDDI--VKGSL-N
A0A6G0GNY9      -------FELHLAKDG---A-VELSSF-------T---RNGTE--TGDDNA--VKGKL-N
A0A6I1BFM0      -------FELHLAKDG---A-VELSSF-------T---RNGTE--TGDDNA--VKGKL-N
A0A3A5Z900      -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
A0A7K0GW19      -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
A0A285TGL6      -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
A0A3A5RFX4      -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
A0A1Q6IUW9      -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
A0A413XDP6      -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
A0A6N8CVT6      -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
K6AP24          -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
A0A6I2NHV3      -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
A0A078RYI7      -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
A0A7I0QD01      -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
C7XEQ8          -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
D7INX6          -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
K5ZG55          -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
A0A662ZYI7      -------FELHLAKDG---A-VELSSF-------T---RNGTE--IENDGF--VKGNL-N
A0A3N2N9B8      -------MNVDISPEG---K-ASISEL-------R---YAGKE--FKGT----FTGSI-G
A0A3N2NMI0      -------LELNISADK---K-VTIREL-------K---QGELK--WEES----FTGSL-G
A0A359I8H7      -------FRIELGKDG---N-VVLRKF----HLET---PDGDE--EIE-KE--VKAKIGA
A0A3N2KA63      -------FRIELGKDG---N-VVLSKF----HLET---PDGDE--EIE-KE--VKAKIGA
A0A4Q0IMT7      -------FRIELGKDG---N-VVLSKF----HLET---PDGDE--EIE-KE--VKAKIGA
A0A7J0B660      -------FRIELGKDG---N-VVLSKF----HLET---PDGDE--EIE-KE--VKAKIGA
A0A3B9FAU3      -------MQMELQPNG---V-VKLSNF-------M---RNGKP--VGS-PEVTVTGRT-S
A0A3C1E5L7      -------MQMELQPNG---V-VKLSNF-------M---RNGKP--VGS-PEVTVTGRT-S
A0A4Q0UAV1      -------YSFTITMVSAT-R-FTLSDF------------AGGA--GDT-KNLILSGEV-G
A0A354SN68      -------FEIQLEKGG---K-AILSHFKGDFGDEV---VNDEE--AEM-KT--ILSQE-G
A0A6L5XFL0      -------FTLELPSSG---V-VKLSNF-------V---VNGVE--KQV-QP--VTMRF-G
A0A3N2N595      -------FDLMVNGDG---N-VTISGM-------K---IGEKD--IIK-AD--FSGKL-N
A0A7J0ACS3      -------MNLSVSKDG---K-VSVKDL-------K---ESNHD--ALK-QT--FTGWL-N
A0A0A2DUD9      -------CILSQLPSG---E-LQLHSF-------V---LNGEK--TEVQDP--VTLVL-G
A0A3P1ZBJ5      -------LSINYQQDG---S-FELTGF-------E---SANTK--KKD-KELRIKGRF-K
R5FHS9          -------FTVKMEGTR-----FVLSKF-------I---RNKEE--LDG-ED--VTAKL-N
A0A413TW79      -------LDVEVKHGNLF-SIVHVSGT-------D---KAGNQ--VESDEE--VQGKL-G
A0A7K0AAG2      -------LDVEVKHGNQF-AIVHVSGT-------D---KAGNE--VESDEE--VKGKL-G
A0A7K0ASF1      -------LDVEVKHGNLF-SIVHVSGT-------D---KAGNQ--VESDEE--VQGKL-G
A0A3E5E9M7      -------LDVEVKHGNLF-SIVHVSGT-------D---KAGNQ--VESDEE--VQGKL-G
A0A3E4SK73      -------LDVEVKHGNLF-SIVHVSGT-------D---KAGNV--VESDEE--VQGKL-G
A0A415GGC6      -------LDVEVKHGNLF-SIVHVSGT-------D---KAGNV--VESAVE--VQGKL-G
A0A413DBH9      -------LDVEVKHDDLF-SIVHVSGT-------D---KDGNQ--VESDEE--VQGKL-G
A0A495WI87      -------LTVKILADS---T-VELSDF-------I---RNGEE--LPG-KL--VKGQL-T
A0A354M4S6      -------LTVKILADS---T-VELSDF-------I---RNGEE--LPG-KL--LKGQL-R
R7DH52          -------LTVKILADS---T-VELSDF-------I---RNGEE--LPG-KL--LKGQL-R
A0A7J5IAE7      -------FTLEIHPDS---T-LLLSDF-------T---RNGTD--LDG-KD--IKGRL-L
A0A016CWA4      -------FTLEVRPDS---T-LLLSGF-------T---RNGTD--LEG-KD--IKGRL-L
A0A4P8LP09      -------FTLEVRPDS---T-LLLSGF-------T---RNGTD--LEG-KD--IKGRL-L
A0A0M1W0V2      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A139KA16      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A174VQ92      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A1Q6HCG0      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A1Y4JYM9      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A3A5QW67      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A3A5RQE6      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A3A6BP07      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A3E5E153      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A3Q9IP20      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A412WV15      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A413ICP6      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A414KYB9      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A5B3FWR2      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A7J5QHB9      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
E5WX00          -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
K0X3P3          -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A1C6H117      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGRL-L
A0A6I1AQV4      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A5C6L2P1      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A412MJT7      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A3E4WKT5      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A3A5YY33      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A1E9CFZ7      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A373FYU5      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A3A5TZ72      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A3A5XBP2      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A3A6MEG9      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A3E4JP35      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A3E4KP40      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A3E4NX82      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A3E4XFU8      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A412RG70      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A412TD37      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A413GAA4      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A414M7I4      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A496BTA0      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A496D2V6      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A5C6KCA6      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A5M5AHM5      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A6I0Y5K7      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A6I1BFB8      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A6I2P5W5      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A6N8DC51      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A7J5HGP0      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A7J5HVL8      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A7J5JHD3      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
E5UZA2          -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A069SMG6      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
C3RFN5          -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGSL-F
A0A3A5Z014      -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGSL-L
A0A7J5GD93      -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-L
A0A7K0HGR5      -------FTLEVQSDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-L
A0A078S3Q8      -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-L
A0A069SJV7      -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-L
A0A3E5DXI5      -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-L
A0A3E5EM98      -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-L
A0A6N2YYD4      -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-L
I9T3G6          -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGNL-L
A0A3E4SYU0      -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGSL-L
A6LGY1          -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGSL-F
K5ZSH4          -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDE-KD--IKGSL-F
A0A6A2RTB3      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A7J5PEN4      -------FTLEIQPDG---T-LYLSDF-------I---RNGTD--LEE-KD--VKGSL-L
A0A1M4YZ07      -------FTLEVQPDG---T-LFLSDF-------I---RNGTD--LDG-KD--IKGNL-L
A0A7J5I238      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-L
A0A0P0FQW1      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-L
A0A7K0I229      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-L
A0A5M5C0W6      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-L
A0A642NJ89      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-L
A0A6L3JTQ2      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-L
A0A7J5FQU6      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-L
A0A7J4YLH7      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-L
A0A6N3AEV2      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-L
A0A6G0G4T5      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-L
A0A6L3KG29      -------FTLEVQPDS---T-LLLSDF-------T---RNGTE--LDG-KD--IKGNL-L
A0A1Y4PQK7      -------FTVNVYKDG---H-VQLSDF-------V---LKGES--LKEVKP--VTGKF-P
A0A1Y4IH41      -------FTVNVYKDG---R-VQLSDF-------V---LKGEL--LKEVKP--VTGKF-P
A0A3A6AAP4      -------FTVNVYKDG---R-VQLSDF-------V---LKGEL--LKEVKP--VTGKF-P
A0A6I0ZRD2      -------FTVNVYKDG---R-VQLSDF-------V---LKGEL--LKEVKP--VTGKF-P
A0A7L4SP06      -------FTVNVYKDG---R-VQLSDF-------V---LKGEL--LKEVKP--VTGKF-P
A0A1Y4DYA7      -------FTIFPVSGN---KGVELTDF-------I---HGGEE---SD-KR--IVVEF-N
A0A1Y3X4I9      -------LTILPVSGN---KGVELTDF-------V---RGEEE---SG-QA--VKALF-N
A0A1Y4FNK8      -------FTVNPSSIG---Q-VKLTDF-------V---HNGED---VD-GE--VTATL-N
A0A355FD59      -------LTLRVSEDS---T-VVLSDF-------V---WGDGS--KSS-KA--IDTRL-G
A0A359CEZ9      -------LTLRVSEDS---T-VVLSDF-------V---WGDGS--KSS-KA--IDTRL-G
A0A353Q7B4      -------LTLRVSEDS---T-VVLSDF-------V---WGDGS--KSS-KT--IDTRL-G
F8X3A5          -------LIIKLLADG---T-FECSDF-------A---CDNKD--IAN-NV--IKGKL-N
A0A1M3KVR9      -------LVIKLLADG---T-FECSDF-------T---SDNKD--IAN-NV--IKGKF-N
A0A4Y9IJS3      -------LVIKLLADG---T-FECSDF-------T---SDNKD--IAN-NV--IKGKF-N
A0A1H4ADG3      LDPSQLSYEFTLNGKSGF-T-VSSDKH-------------------------VWKGKW-S
A0A5B8VUR8      LDPKQLRYEFHIISTSGF-E-ISSADH-------------------------IWKGSW-D
A0A0D3L8Q3      -------KVIKVHLKGNN-S-YDI-EY------NEK----------------ISSHKF-G
A0A7G7G5F9      -------QRIAISLEDKN-T-FTLKDA------SG-----------------VKAYKI-G
A0A2N3U785      -------KTLRVQIKDKN-N-FVLND-------EEK----------------ETLHEF-G
A0A5B6TJH8      -------KELIIHTKDNN-S-FVLEEQ------DGK----------------RSIHSF-G
A0A519U664      -------KSFVVFLKADN-S-FQLQDY------TGT----------------TNTYKL-G
A0A519MA34      -------KSFTVFLKADN-S-FQLQDY------TGA----------------VTTHKF-G
A0A519UCX0      -------KSFTVFLKADN-S-FQLQDY------TGA----------------VTTHRF-G
A0A0E3ZG78      -------KSFVIHIKSDS-T-YNLDDN------EGK----------------MYTYKF-G
A0A1I6BRK6      -------KSIIIHLKKNN-F-FDLEDY------KGI----------------TTSHRF-G
A0A243WAB1      -------KSITLHLHPDN-S-FQLEDY------DGT----------------VTSHSF-G
A0A6G8C8X6      -------QSFAVYLKGGN-S-FTLDDY------SGK----------------VTTHSF-G
A0A416GA42      -------CSFRLRLLPGR-K-VELSQL------KYQAQELTE----------TKTFVL-N
A0A1T3IYP5      -------YSFIITPFDSK-T-VILKGW------DQSGK--------------DVKVAL-N
A0A1T5K9D4      -------FTIKATPRDSK-T-IELD--------LSSLGQK------------NVVVSY-G
A0A077ENE7      -------YNFTVIPLDGN-S-VIIKNW------NPENKDK------------EIKIAL-N
A0A7H1Z2Z7      -------YNFTVIPLDGN-S-VIIKNW------NPENKDK------------EIKIAL-N
A0A6I5UW06      -------YNFTVIPLDGN-S-VIIKNW------NPENKDK------------EIKIAL-N
T0NN57          -------YSFVITPIDSR-S-VIIKNW------SKNGNEK------------EIKVSI-N
X5K347          -------YSFVITPIDSR-S-VIIKNW------SKNGNEK------------EIKVSI-N
A0A060RD97      NP-----VSFTVTPKNSE-A-FQLSYI------DENETRV------------SIEKKF-G
A0A3C1ITV0      EQPLNS-VTFVAEKEGQS-Q-LTVKDF------KINGIKSDAP---------AQTVKL-G
R7HN19          EQPLNS-VTFVAKKEGQS-Q-LTVKDF------KINGIKSDAP---------AQTVKL-G
A0A350IHV0      -------YSFELTKTGDS-T-FVIKNL------RVA----GEKMKYKG----KIKGSF-R
R5RVP0          -------FSFEIVNEKDS-T-FVIKDL------AVV----GETIKHTE----KITGRL-R
R6A0L2          G------QHIDVVKKGSN-T-VTLKGM------TDRMGNDVPD----------VDVQL-G
R7LG80          PIPKNMIVSLKIKKLDQN-T-VEIKGF------RNKKGKKTDE---------KIKANF-G
A0A2L2WX98      --------KFEVVKTGDR-K-FALSNF------ERGKDKYKG----------KVSIAV-G
G5GD56          -------VRFEAKIQADG-T-VKLSDF------VCYNRSTGKKKIFKE----HLSVRP-G
R5KD55          -------ASLHIRLKKDG-S-IKMSEF------VKNGKPQNSY---------DLTCHV-G
A0A174QNT3      -------TELKVSVVNDK-Q-CRISNI------EIEEETRDYD----------KIVAF-N
A0A4S2FGS1      -------TKFTVSVINEK-G-VRLSQL------EIDGNAQSYE----------QAVAF-N
A0A7K3KG59      -------TELTVSIINEK-G-VRISQL------EIDGNAPSYE----------QVVAF-N
R9I0H0          -------TELTVSIINEK-G-VRISQL------EIDGNAPSYE----------QVVAF-N
K5BUT9          -------VSFNITPLNTT-K-FRISDW------KVMGEKGEIQ---------EQELAY-N
A0A174FPA3      -------VSFNITPLNTT-K-FRISDW------KVAGEKGRMQ---------EQDLTY-N
R6S9Y6          -------VSFNITPLNTT-K-FRISDW------KVAGEKGRMQ---------EQDLTY-N
A0A7J4YSB2      -------VSFNITPLNTT-K-FRISDW------KVAGEKGRMQ---------EQDLTY-N
C9KX15          -------VSFNITPLNTT-K-FRISDW------KVAGEKGRMQ---------EQDLTY-N
A0A6H0KRK1      -------YHTKVTPLDVK-N-YTILG---------------------------EKYAY-G
R6DAG6          -------YRTKVTPLDVK-N-YTILG---------------------------EKYAY-G
A0A3L8AAP1      -------YRTKVTPLDVK-N-YTISD---------------------------KKYAY-G
A0A4S2AYX2      -------YRTKVTPLDVK-N-YTISD---------------------------KKYAY-G
A0A7J0A2L4      -------YRTKVTPLDVK-N-YTISD---------------------------KKYAY-G
A0A7K3MN31      -------YRTKVTPLDVK-N-YTISD---------------------------KKYAY-G
A0A0E2M2Y7      -------YSFKIDIKDSR-S-FQLSDF------KQQKLNRISEI--------KVEGSF-G
A0A0K2J6Z0      -------YSFKIDIKDSR-S-FQLSDF------KQQKLNRISEI--------KVEGSF-G
B2RKZ8          -------YSFKIDIKDSR-S-FQLSDF------KQQKLNRISEI--------KVEGSF-G
A0A212GC82      -------YSFKIDIKDSR-S-FQLSDF------KQQKLNRISEI--------KVEGSF-G
A0A254MU12      -------YSFKIDIKDSR-S-FQLSDF------KQQKLNRISEI--------KVEGSF-G
R6CQ93          -------FSFVVTPKDET-S-VELSEI------EGIPGAQE-----------TYKVQL-N
A0A3D1NQW3      -------FRFEVSLRPDS-I-VKLNYF------EIF---GPDKQKFKQ----EISAVF-G
B0MT10          -------FRFEVSLRPDS-I-VKLNYF------EIF---GPDKQKFKQ----EISAVF-G
R7JGW9          -------FRFEVSLRPDS-I-VKLNYF------EIF---GPDKQKFKQ----EISAVF-G
A0A3D2BF46      -------LAFELTPVDNE-K-FSLTKF------VNRTSADSDKDKDSEIYEVEMTGRF-N
A0A358R538      -------AELTVTPLPDG-R-LRLSDF------DDGFLPKSERRT-------QIVVES-G
A0A1Y4AAB8      -------FSFRARPLAGGEQ-VELTDF------DDGYISDEERGR-------VVTAAY-G
A0A1Y3WWY9      -------LSMTVTPRGEQ-Q-IEISQF------QDGFVSKQESRS-------VVTAQY-G
A0A1Y4U5L4      -------LSMTITPRGEQ-Q-IEISQF------QDGFVSKQESRS-------VVTAQY-G
A0A1Y3VCJ1      -------LSLEVTPVDDQ-N-IRLSNF------HDPFISKQESED-------RVSARF-G
A0A1Y3QTW7      -------LSLEVTELEDG-R-IKLADF------DDKYLTKQEKRR-------VIRGQY-G
R6XWY7          -------LSLEVTELEDG-R-IKLADF------DDKYLTKQEKRR-------VIRGQY-G
A0A4Y1X9Y9      -------LSLEVTELEDG-R-IKLADF------DDKYLTKQEKRR-------VIRAQY-G
A0A4Y1WM66      -------LSLEVTELEDG-R-IKLADF------DDKYLTKQEKRR-------VIRAQY-G
A0A6N4GYT3      -------LSLEVTELEDG-R-IKLADF------DDKYLTKQEKRR-------VIRAQY-G
A0A174AVF1      -------LSLEVTELEDG-R-IKLADF------DDKYLTKQEKRR-------VIRAQY-G
A0A656Q4F4      -------LSLEVTELEDG-R-IKLADF------DDKYLTKQEKRR-------VIRAQY-G
A0A1Q6EIY0      -------LSLEVTPLRNG-K-IELTDF------EDKFVTRQETKR-------VILAEY-G
A0A5B5VN71      -------LSLEVTPLRNG-K-IELTDF------EDKFVTRQETKR-------VILAEY-G
E4M8L3          -------LSLEVTPLRNG-K-IELTDF------EDKFVTRQETKR-------VILAEY-G
I3YQ50          -------LSLEVTPLRNG-K-IELTDF------EDKFVTRQETKR-------VILAEY-G
R5UEY8          -------LSLEVTPLRNG-K-IELTDF------EDKFVTRQETKR-------VILAEY-G
A0A1H4D866      -------LSMEITPLEGD-K-VRLTNF------EDRFVTKQETRS-------SITAAY-G
A0A5B3G4Y7      -------LAMEITPIDDD-K-IRLSGF------EDQFVTKHESRS-------VITAAY-G
A0A374A9J5      -------LAMEITPIDDD-K-IRLSEF------KDQFVTKHESRS-------VITAAY-G
A0A5B3GQN5      -------LAMEITPIDDD-K-IRLSEF------KDQFVTKHESRS-------VITAAY-G
A0A1Q6E9S3      -------LAMEITPIDDD-K-IRLSEF------KDQFVTKHESRS-------VITAAY-G
D4IJ36          -------LAMEITPIDDD-K-IRLSEF------KDQFVTKHESRS-------VITAAY-G
A0A414Q925      -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
A0A415PUS9      -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
A0A108TCU0      -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
A0A413BA42      -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
S3Y344          -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
A0A7J5LEW3      -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
A0A412TGL3      -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
A0A413VJ33      -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
A0A414L0W6      -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
A0A412DP39      -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
A0A413ZSE8      -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
B0NP84          -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
R6AK43          -------ISLTVTMSDNG-K-VTLADM------TLQ--NEEEEEEFDE----ILTVQP-G
A0A412N2D9      -------ISLTVTMTDNG-K-VTLTDM------VLQ--NELEEEEFDE----SLTVQP-G
A0A1Y4JYS9      -------ISLTVTMTDNG-K-VTLTDM------VLQ--NELEEEEFDE----SLTVQP-G
R6LHA4          -------ISLTVTMTDNG-K-VTLTDM------VLQ--NELEEEEFDE----SLTVQP-G
A0A3E5HPT8      -------CSLSVIPKNKQ-Q-VELADF------SLD--------ELEQ----RKTVNL-N
C6IJ48          -------CSLSVIPKNKQ-Q-VELADF------SLD--------ELEQ----RKTVNL-N
Q8A3U2          -------CSLSVIPKNKQ-Q-VELADF------SLD--------ELEQ----RKTVNL-N
A0A3R6S1H6      -------LQMVVTPLDDK-T-VMLAGW------KGD--------DEEW----KQKVAL-K
A0A3R6SD81      -------LQMVVTPLDDK-T-VMLAGW------KGD--------DEEW----KQKVAL-K
A0A354WXN6      -------FSLKATPLDDK-K-VLLHDF------KIA-NTEGKLVEAGK----PMEVLL-G
A0A7G1HW11      -------FSFDIVPISDQ-E-VLLSDF------TSN---------EDW----SKKVQL-G
R5IP14          -------FSFDIVPISDQ-E-VLLSDF------TSN---------EDW----SKKVQL-G
A0A316SZX7      -------SGFTAKK-KGK-E-IYLSDL------RTS--AQVSDIDRDL----TIKASL-Y
A0A1Y4AIY1      -------FSLTAIPLSKE-K-VRLFDF------VTV-NEAGEPVEIKN----PQEVVL-N
A0A0J6CIR2      -------FSLVATPLSAG-E-ILLSGF------STN------E---AK----SLKVAL-N
A0A3D8HG59      -------FRLVATAIDEG-K-VALSDF------EAD------SVDVSD----AVTVAL-N
A0A3R6S408      -------FRLVATAIDES-K-VALSDF------EAD------SVDVSD----AMTVAL-N
F3ZRU7          -------IQLK-GKLKEN-Q-VQFTDV------KTW---TGGEEVELP----HFSVQL-N
A0A1C5Q1F3      -------FSFKVTPLNDK-E-VLLSDF------PEM-----EGVKPVE----QMKVHL-N
R7A239          -------FSFKVTPLNDK-E-VLLSDF------PEM-----EGVKPVE----QMKVHL-N
A0A3R6HIK7      -------FALKVTPLSKE-K-VRLSDF------IMA-DSNGQRVEIKK----AQDVAL-N
K5ZVW7          -------FALKVTPLSKE-K-VRLSDF------ITA-DSNGQRVEIKK----AQDVAL-N
A0A1Y4D5Z0      -------FSLTVTPMSDK-E-VVLSKF------ITR-NEEGKLVEIEK----AQRVAL-N
A0A413VXJ7      -------ILVTVTPIDSA-R-VRLSDL------KMS--VGDGEVTSNE----VLEVNL-H
I9RSN9          -------ILVTVTPIDSA-R-VRLSDL------KMS--VGDGEVTSNE----VLEVNL-H
U6RJK5          -------ILVTVTPIDSA-R-VRLSDL------KMS--VGDGEVTSNE----VLEVNL-H
A0A1Q6GA32      -------ILVTVTPIDSA-R-VRLSDL------KMS--VGDGEVTSNE----VLEVNL-H
I9RPU6          -------ITVVVTPVDSV-T-VRLSGF------SLA--VGGGGVHSEE----ALDVHL-N
I8YFS5          -------IEMTVTPVDSA-T-VRLSDF------SLS--IAGEEIRSAE----VVDARL-N
A0A7J4XCM0      -------IEMTVTPVDSA-T-VRLSDF------SLS--IAGEEIRSAE----VVDARL-N
I8Y597          -------IEMTVTPVDSA-T-VRLSDF------SLS--IAGEEIRSAE----VVDARL-N
A0A1Q6GBF5      -------IKVAVVPVDSV-T-VRLSGF------SLA--VGGGIIHSEE----ILDVHL-N
I8YFZ3          -------IRVVVTPVDSI-M-VRLSGF------SLA--VGGGEVHSEE----VLDVRL-N
A0A7J4XFW0      -------IKVVVTPVDSA-T-VRLSNF------SLA--VGEGEIHSEE----VLDVNL-N
A0A1Q6GDH2      -------ITVVVTPVDSV-T-VRLSGF------SLA--VGGGGVHSEE----VLDVHL-N
U6RSB0          -------ITVVVTPVDSV-T-VRLSGF------SLA--VGGGGIHSEE----VLDVHL-N
I9GXM2          -------IKVVVTPVDSV-T-VRLSDF------SLA--VGGGEISSEE----VLDVHL-N
I9SIK1          -------IKVVVTPVDSA-T-VRLSGF------SLA--VGGGGVRSEE----VLDVHL-N
A0A7J4XIJ5      -------IKVVVTPVDSA-T-VRLSGF------SLA--VGGGVVRSEE----VLDVHL-N
I9TP59          -------IKVVVTPVDSA-T-VRLSGF------SLA--VGEGEIHSEE----VLDVHL-N
R5S343          -------ATCAVTFMTCE-R-VLLSGF------KEE----------NR----EIEAVL-N
A0A1M6K7I9      -------IHVCVTPLSEN-K-VRLSEL------LMI--VNNEEIQSVD----EPEVAL-G
A0A5M6A8C8      -------IRVCVTPLSEK-K-VRLSEL------LMI--VNNEEIQSVD----EPEVAL-G
A0A7J4XCJ1      -------IEMKVTPVDSV-T-VKLSDL------TLT--IGDEELRSTE----TIDVHL-N
A0A7J4XNQ7      -------IKTAITPIDSV-T-VRLSDF------VLS--VNGEESHFAE----TVDVHL-N
A0A3R5ZMK1      -------FSLKAVPVSGK-E-VVLSGF------TLG----GQEVADGK----PVKVAL-N
A0A7K1HMX0      -------FSLRAKPISAE-E-VVLSDF------VID----DE--SAGE----PMTVAL-N
A0A1Y3ZIA4      -------FSLQAVPVSGK-E-VMLSGF------TLG----DQEVSDGK----PMKVAL-N
K5Y1A4          -------FSLQAVPVSGK-E-VMLSGF------TLG----DQEVSDGK----PMKVAL-N
A0A7K1HDC0      -------FSLKAVPVSGK-E-VVLSGF------TLD----GQEVADGK----PVKVAL-N
A0A3R6K8X4      -------FSLKAVPVSGK-E-VILSGF------TLG----GQEVADGK----PVKVAL-N
A0A6N8D6C8      -------FSLKAVPVSGK-E-VILSGF------TLG----GQEVADGK----PVKVAL-N
A0A3R6BKI7      -------FSLKAVPVSGK-E-VVLSGF------TLG----GQEVADGK----PVKVAL-N
A0A412M2W1      -------FSLKAVPVSGK-E-VVLSGF------TLG----GQEVADGK----PVKVAL-N
K5ZX55          -------FSLKAVPVSGK-E-VVLSGF------TLG----GQEVADGK----PVKVAL-N
A0A415BDM7      -------FSLKAVPVSGK-E-VVLSGF------TLG----GREVADGK----PVKVAL-N
A0A1Q6I3T6      -------FSLKAVPVSGK-E-VVLSGF------TLG----GQEVADGK----PVKVAL-N
A0A414XX40      -------FSLKAVPVSGK-E-VILSGF------TLG----GQEVADGK----PVKVAL-N
A7AEU7          -------FSLKAVPVSGK-E-VILSGF------TLG----GQEVADGK----PVKVAL-N
A0A5F0U645      -------FGLTVVPVSDK-E-VSLSGF------FSEELEEEGQVQEDQ----TLTVAL-N
K5ZBN2          -------FGLTVVPVSDK-E-VSLSGF------FSEELEEEGQVQEDQ----TLTVAL-N
A0A0J6CKW3      -------FGLTVVPVSDK-E-VSLSGF------FSEELEEEGQVQEDQ----TLTVAL-N
A0A0F5IQM7      -------FGLTVVPVSDK-E-VSLSGF------FSEELEEEGQVLEDQ----TLTVAL-N
A0A496CDT3      -------FGLTVVPVSDK-E-VSLSGF------FSEELEEEGQVLEDQ----TLTVAL-N
A0A6G1ZKM3      -------FGLTVVPVSDK-E-VSLSGF------FSEELEEEGQVQEDQ----TLTVAL-N
S0GLB0          -------FGLTVVPVSDK-E-VSLSGF------FSEELEEEGQVQEDQ----TLTVAL-N
A0A3R6NLC1      -------IGLTVVPVSDK-E-VSLSGF------TSEELEEEGQSLEDQ----TLTVAL-N
A0A416WYC9      -------IGLTVVPVSDK-E-VSLSGF------TSEELEEEGQTLEDQ----TQTVAL-N
A0A0F5IT40      -------FSLVATPLSAG-E-ILLSGF------STN---------EAK----SLKVAL-N
A0A496CX20      -------FSLVATPLSAE-E-ILLSGF------STN---------EAK----SLKVAL-N
A0A5F0UBI0      -------FSLVATPLSAG-E-ILLSGF------STN---------EAK----SLKVAL-N
A0A6G1ZHG0      -------FSLVATPLSAG-E-ILLSGF------STN---------EAK----SLKVAL-N
S0GSI7          -------FSLVATPLSAG-E-ILLSGF------STN---------EAK----SLKVAL-N
K5YB65          -------FSLVATPLSAG-E-ILLSGF------STN---------EAK----SLKVAL-N
A0A0F5IWP9      -------FSLNVTPLTET-E-VMLSDF------STD---------ETK----MLKVVL-N
A0A0F5IZT8      -------FSLNVTPLTET-E-VMLSDF------STD---------ETK----MLKVVL-N
A0A417LKQ2      -------FSLTVTPLSEK-E-VMLSDF------STD---------EGK----MQKIAL-N
A0A416TME1      -------FSLVVTPLSEK-E-VLLSDF------SMA---------EGK----MQKVVL-N
A0A416XPE8      -------FSLVVTPLSEK-E-VLLSDF------SMA---------EGK----MQKVVL-N
A0A3B0C2S4      VYDISLDAFEARITNMDGATTV--------------------------------------
L8JI02          IEAVGRDVDVYNFLTNRTEDTFDEINL--------------------------REVVEAG
A0A4Q5WS95      NIP----FTYDAAA---------------------------------------RQVRIGA
A0A501VZX6      KETAKVYFHYNRAS---------------------------------------KQVIINN
A0A399SH26      DEPQKIYFTYNPDL---------------------------------------EEVTVDG
A0A501W1A9      QEQPAVYFTYDEAK---------------------------------------KQVIIDN
A0A0E3ZGV6      TENPMIFFTYDESS---------------------------------------KEVIIDS
A0A1I2N4S1      VEYPAVYFTYDQAT---------------------------------------QKVQIDG
A0A2T5YE44      AEYPAVYFTFDQAT---------------------------------------QKVKIDG
A0A1M5BA90      D-TDRIDFVYNKGN---------------------------------------NTVAIEG
A0A512B879      EVVERIDFTYNKIK---------------------------------------KTIDIAG
A0A559PPI3      DVPAEHYFTVDFSK---------------------------------------KNVKVDG
A0A1T5CS78      EEPEKHFFNYNFNE---------------------------------------ENVVFSG
A0A0Q9Z8F1      DEPEKHFFKYNAND---------------------------------------EKVIFSG
A0A2N0U0M7      DEPEKHFFKYNAND---------------------------------------EKVVFSG
A0A1V9FHD0      DTDVLFSVNYFPGPNGKASK-----EI--------------------------KEVVIDK
A0A4V4H170      EVDVQFTVNYFSDNNGGEFRDVIK-KV--------------------------REIVIGE
A0A1V9F098      DSVVHFQVNYYDDNNAGEFRNVDEPKV--------------------------KEVVIGK
A0A4R2VU64      DSDVYFMVNYYANNNAGEFKELSNLKV--------------------------KEVVIKK
A0A4S8HY23      EVDVPFSVNYFSNNNAGEFNGLIKQKV--------------------------KEVIIDN
A0A1V9F383      DTDIVMSVNYYTDKERRAATNVYKDKV--------------------------KEVVIEN
G8TRZ6          DTDIAIAVNYYSPKEMQVAHNGYKDKV--------------------------KEVVIEN
A0A4R5DL69      TEVTYKI-----------------------------------------------------
A0A1M4YED3      EIDLSVNATTNVVTVDG-------------------------------------------
A0A2H3NSN0      ------------------------------------------------------------
A0A2P6C324      ------------------------------------------------------------
A0A7C2DZI7      ------------------------------------------------------------
A0A1M6XHU0      ------------------------------------------------------------
G2SF81          ------------------------------------------------------------
A0A5S9EYW1      ------------------------------------------------------------
D0MHQ9          ------------------------------------------------------------
A0A126PFG0      VL-------DIVLKDQTSFYMAATNGN--------------------------LTAHPFG
A0A3M1N7Z3      SLFWQGGRVRVIFDAERKVEIWRAETL--------------------------I------
                                                                            

A0A1T5MMH4      APVH-ISGIELTLRKNEN-----------------FLDENDID-----------------
A0A2W4R1L8      EPID-LNGLTVTIHRNPA-----------------FTSESGLN-----------------
A0A2E5CV79      ------------------------------------------------------------
A0A2D4ZVH1      ------------------------------------------------------------
A0A0K8QSK7      ERFS-GNDYSFAIRVKEN-----------------APSGLSGT-----------------
A0A1V6CN82      EEVVIPGQCSFKINLNEG-----------------FFPPVTDY-----------------
A0A1M4XZ45      TKLK-AEQFSITILLNEK-----------------FNPNAANS-----------------
A0A399D319      TKIT-SDEFSFTILLNEL-----------------FDSNASNN-----------------
A0A1V5IPN7      ------------------------------------------------------------
A0A1M6GR99      QVVE-TDDFKILVTINEN-----------------DSLLSSDNRR---------------
A6EBM4          SRIK-VGNVSFMIRNTAQ-----------------AAPSSS-------------------
A0A7C5M4P4      IPVE-NEDLKLTVHLQPI-----------------WNPSMGHE-----------------
A0A1M6TTV4      EMIS-HRLGELTIQKTSN-----------------FASQKNLVE----------------
A0A4Q8RX32      KTIE-SEYFKFTVLLKEG-----------------VALEEVSAND---------------
K0X1U5          AEME-ATSFPIKVDYGEG-----------------IVIDKTEFYKPGKKLK---------
R5EXK3          VEME-ATSFPIKVDYGEG-----------------IIIDKTQFYEPGKKLK---------
A0A401UAP7      KVVQ-MEGFKVLIESAKG-----------------YTYEPKNT-----------------
A0A1W2GF52      NPIV-TKDFSFTLEKTNF-----------------FDDQKNLID----------------
A0A2G5L7B8      KKIN-TAFGELIVSKTIF-----------------FKEQQNLID----------------
A0A523GAC0      Q--T-IQNEHFALRLTMN-----------------LPLNEVDKDQL--------------
L8JW09          EHAN-LPDIEFIIYLTNY-----------------F---DPKGDKN--------------
A0A364XUP5      EPIN-LDASVVTIKRNPN-----------------FKESDEEIE----------------
A0A1M5RLA9      SKVS-LNGVDLYIEKNEA-----------------FRKGD-EIG----------------
A0A385SFR9      SKVS-LNGVDLYIEKNEA-----------------FKKGD-EIG----------------
A0A5M4A9J4      EVIE-RSEFAFRIIPVNG--------------------------ATLPEGT---------
A0A5M4B1C7      KTTT-DSQFSFCVVPKNG--------------------------EPIPSGT---------
A0A0D3LFR6      QAVE-TGSFNLTLTLLEG------------------------TTGDAINSN---------
M7N6D4          QTVE-TDPLTFSLSLRNG------------------------INKDIPESR---------
A0A4D7K1D4      KPLV-VNGGIITLFLTEH------------------------YSRGEGFDD---------
A0A5C7MX19      QDIY-SPSFKGVVIKKVP-----------------------KFQKQDFRGV---------
A0A1Q3ZMZ7      KLIS-TPHFEVIINGD-------------------KESFSSSRDND--------------
A0A2D8JJW3      DGCD-LPKYRQLHVLNTRDYKPVGWRETFNSAISLFGLWPVSNQKKHDLVN---------
A0A2W2AFF7      QTVS-LPIGKLQVIKNPL-----------------VKADEEE------------------
R7PCR1          RPFS-TPVGKIVLNKNSQ-----------------YISEFVGKK----------------
A0A2N5YXE2      PEEW-QSVFGMEVFIHFP-----------------SKKDMEFELNPDNKSQ---------
A0A1G9E2A9      KSYE-NQHFRFEI--HKT-----------------RFFTVPGSIRR--------------
A0A098LL25      EKIS-TDNYSFTLY--PT-----------------TFWSTNETGAK--------------
A0A6J4H627      HPIK-ARDFELVI--RKM-----------------PGFDPKASPGA--------------
A0A6C0GJI1      QAVN-LDNFRFTI--DTT-----------------AQYSSELDNNK--------------
A0A2T2YJE8      KPVE-KPGFSFTL--TLR-----------------VPLSADVIAQK--------------
A0A7L7LEW0      QPVI-KPGFSFTL--TLR-----------------VPLSADVLSQQ--------------
A0A127B287      SPIS-LSGNNINVL--TN-----------------PSFSANHIGES--------------
A0A6P1P2P6      TPIT-LSGNNLVVY--TN-----------------SRFNTNHIGES--------------
A0A3M9N829      QPVN-ISGNNITI--TTT-----------------SSFSSAKVGET--------------
A0A0P0CSF9      NPIT-VSGSTFSI--NPV-----------------NNFSSSNVGIV--------------
A0A5M8QQB8      EPVS-VVGSRVTI--KTA-----------------PSFSSASVGVE--------------
A0A3M9MNC3      VPFA-LSGSTITV--NSL-----------------PSFTSVNVGET--------------
A0A5B6TAX2      VPFK-FSGSTLTV--NPS-----------------SSFTTSNVGET--------------
A0A7L5A132      QPIS-TPQMELTIY-RTS-----------------PATGAEELKVN--------------
A0A512AYT3      EKID-KKEISLTLY-PNN------------------NFNEDAQGRK--------------
A0A5M6CYN7      EKID-KKEISLTLY-PNN------------------NFGEGTLDGK--------------
A0A369QP10      EPVQ-KPGFTFTL--KLT-----------------APLNSDILAQK--------------
A0A7G7G7M4      KPVQ-KPGFNFTL--NLR-----------------VPLTSDILAQQ--------------
A0A126PDF2      KQVS-LPGLDLKVT-PT------------------QYFGPASLIAK--------------
A0A2Z3GKA1      QQVS-LPGLDLKVT-PT------------------RYFGPATLTAK--------------
A0A502GZP7      QQVT-LPGLDLTVT-TT------------------SYFGPATLGEK--------------
A0A519SBU8      QWAK-LPGIDLLVE-AAP-----------------DQTIPTSESSP--------------
A0A4Q3JNZ3      QWAT-FPGMQLLLE-AVP-----------------GRALPVGDDPQ--------------
A0A519Q9V3      QWAA-FPGMQLLLE-AAP-----------------GRTLPVGNDPQ--------------
A0A0M3RW20      SAII-QPGINLQLN-LT------------------PQFSSDVIGKD--------------
A0A495VFX4      DAII-LPGIHLKLV-KA------------------PYFSDEAIGRD--------------
A0A418R9X5      QPID-IAGFTLYMY-KT------------------AQYEGANRDAN--------------
A0A428JSJ3      QPFQ-AAGFTLRVY-KT------------------AQYTSADRDAT--------------
A0A428KI59      QPIE-AAGFTLQVY-KT------------------PQHASADPDAN--------------
W8F1I6          QPIE-AAGFTLQVY-KT------------------PQHANADPEAN--------------
A0A246FQC0      EPFT-AAGFRLVIS-KA------------------ANYNESVLEEQ--------------
A0A372E5P8      QPFT-AAGFRLTIR-QT------------------KDYNLAALDGQ--------------
A0A1H3EMW1      QPFT-VAGFRLTVR-PT------------------REYSPEALDGE--------------
A0A1H9ZSN3      QPFT-VAGFRLTIR-KA------------------ADSGAAAPEGQ--------------
A0A1S9B3W0      QPIT-TPGFTLELQ-PT------------------KHFNPQDTEGA--------------
A0A1W1VRL3      QPLN-LAGLDLRLT-THG-----------------TYFDANALDAQ--------------
A0A7G6YQJ9      QPIE-TPGFILTVS-KT------------------DFFGSETIDGN--------------
A0A1M6R305      QPFR-IGGMTLRLR-PT------------------AYMGATTLDNN--------------
A0A7G7W8X3      EPFR-IGGMTLRIR-TT------------------PTMDASALDRT--------------
A0A4Z0PHK3      QPVL-VPGMELLLT-AT------------------PLLTDESREKN--------------
A0A2M9B9H9      QPVV-VPGMTLVVT-AT------------------PLLDEEALEKN--------------
A0A4Z0QCY9      QPII-VPGMELKVT-ST------------------ALLDADAREKN--------------
A0A5N1J2M4      EIIS-NNDLDLKVL-K-T-----------------NTFSNQVINQH--------------
A0A519S476      TWAK-LPGVELVLE-AVP-----------------GRPLPTAEAAQ--------------
A0A4Q3JRW8      QWAS-FPGMQLLLE-DVP-----------------GRALPVGDDPQ--------------
A0A519M923      QWVT-FPGMQLRLT-PVA-----------------GRALPTGDASP--------------
A0A4Z0ENW1      QLVK-LPGISLQLL---------------------EILVPTQLDAT--------------
A0A519UDB4      QFVK-LPGISFRLLLTSP-----------------EGLNENFSENP--------------
A0A3S0QKV1      QPVT-TPGFNLRLV-P-T-----------------KYFSGQLADAT--------------
A0A328BL48      ETLT-TPGFTLTLV-R-T-----------------RFFNEQTPETK--------------
A0A5R8WLY4      EPLT-TPGFTLNLT-R-T-----------------RFFNEQTPETK--------------
A0A1I5WSL8      QTID-LSGITLQIV-GTP-----------------AL-KGDVQDEN--------------
A0A0U3JVM7      QEIK-LPGITLAVL-GTN-----------------EL-TNAAQDAS--------------
A0A1G1SSV2      QQIT-FPGIQLQVL-ETE-----------------SFAANNTADAS--------------
A0A1G1SXV7      QQIK-FPGIQLQVL-GTK-----------------NLVTDTPDDAS--------------
A0A6G8CBJ6      QPIN-LPGISLKLT-TDS-----------------SFFDASALEAQ--------------
A0A0W8EDI5      QPLK-IGNSFIVLK-P-T-----------------E--QAIQPNIP--------------
A0A3B7RBP8      QTLN-IEGSSISVY-S-T-----------------N--KSPQAGVN--------------
A0A3R9P8H7      TPFT-AGGFRMEVR-K-T-----------------PQFNDKAFEGE--------------
A0A238WIA7      APVE-TTGFRLRLY-R-T-----------------AFYQPSDLERN--------------
A0A212UCJ7      NQIE-TLGFWFRIY-P-T-----------------SLFRPSDTERN--------------
A0A4Z0MQE1      DPIE-TAGFTFKIL-Q-T-----------------PLFRPVDTDRS--------------
A0A4Z0PCF4      EVIE-TAGFRFKIQ-Q-T-----------------SRFRPTDVERS--------------
A0A6M6BED0      EIVE-TAGLRLKIE-Q-T-----------------PLFRPTDVDRS--------------
A0A5D6VDG1      VPIE-LPGITLYLS-K-N-----------------KNFTEDALNRS--------------
A0A243WHR7      QPIV-TPAMELVLA-S-T-----------------PWMNESVVGKK--------------
A0A5B8A0P6      QTIS-TPDMVLAIT-T-T-----------------PAFNDQAINKK--------------
A0A076HRT9      QPIR-LGGMTLRIL-P-E-----------------GKIDASVIERN--------------
A0A4Z0PVM7      QPVV-VPGLELRIT-T-T-----------------DLMNQEARDKN--------------
A0A1M6DHW8      QPIV-LPGMELLFI-G-T-----------------SFLNAEALDKK--------------
A0A4Q5LC61      QPIV-IPGMEMRIL-A-T-----------------PLLNAEAQDKK--------------
K0XJ09          DTII-SAAGRFIVEDIPD-----------------KISAYYNVP----------------
R5EUZ0          DTII-SAAGRFIVEDIPD-----------------KISAYYNVP----------------
W0EQS0          DTLV-SEAGRIVVEAVPE-----------------YLPAYYNIP----------------
A0A1Y3WE15      DTLV-TNAGRMVVTAVPE-----------------FLPNYYTLL----------------
A0A1Y4GUK3      DTLV-SDAGRIVVESVPE-----------------FLPAYYNVP----------------
A0A2U1FKU2      QPVA-TPVGELQIDQTPF-----------------FVAAWKGQV----------------
A0A0A2F954      RPIA-TPVGELKLDTTLF-----------------FADSWKGEV----------------
A0A0A2FW91      RPIA-TPVGELKLDTTLF-----------------FADSWKGEV----------------
A0A2D2N2N1      RPIA-TPVGELKLNTTLF-----------------FADSWKGEV----------------
Q7MWZ2          RPIA-TPVGELKLNTTLF-----------------FADSWKGEV----------------
T2NDT6          RPIA-TPVGELKLNTTLF-----------------FADSWKGEV----------------
W1R7P9          RPIA-TPVGELKLNTTLF-----------------FADLWKGEV----------------
A0A1R4AFZ0      RPIA-TPVGELKLNTTLF-----------------FADSWKGEV----------------
A0A1R4DVZ7      RPIA-TPVGELKLNTTLF-----------------FADSWKGEV----------------
A0A7C0WKI7      ------------------------------------------------------------
A0A2A8CVM9      ------------------------------------------------------------
A0A5M4B212      SYVA-SDDYAFRIIPAAD-----------------TQLEGS-------------------
A0A3D1KEX9      QSFN-SPAGNIRISQAEF-----------------DPEFVGKI-----------------
A0A358Y7S2      SRFK-NPQFDIMFKVK-N-----------------IDELKEHCAENE-------------
A0A1X7J248      QEFI-VDGCKYKLEITPH-----------------FFNTES-------------------
E4TQD2          EYFT-FNGCGYKLETTPH-----------------FFNTER-------------------
A0A2J6HHN3      ESVV-LPKVIFSVEPVDT-----------------VNFMQKFKNRE--------------
A0A1Y3WMT8      AETE-ATSFPIRVDYGEG-----------------IVIDTTRYYNPDKKLR---------
A0A1Y4GQU1      AETE-ATSFPIKVDYGEG-----------------IVIDKTSYYKPGEKLR---------
A0A6A0R272      QPFK-IFEESYSIDRV----------------------YSEPLKSIETDGS---------
A0A1V5W8T5      EWTQ-IQGLKLYVNII-N-----------------VEQILENKGNK--------------
A0A2T8HKA9      EETT-TPIGKLTISSNKL-----------------YKPSIFGEE----------------
A0A2I0QZ80      EILK-NNLFDIKMKVN-D-----------------FQELKTDAETNQ-------------
A0A3E1F1A3      SLVQ-TPFFKMRVDIL-N-----------------WNQFKTNSSNNK-------------
A0A2U2XBJ3      SLLK-TPFFDMRVIVD-N-----------------WSQFVLNSTSNK-------------
A0A4Q4KU94      SLLK-TPFFDMRVSID-N-----------------WDQYLANTTSNK-------------
A0A3B8INU3      ETLS-VPHLDLRLESTSH-----------------LNSSYLGEP----------------
A0A2W1NDY9      QLVD-NEYFKFVFKIN-N-----------------EKVFKADLEKDD-------------
A0A5C8AQR5      DVIQ-NNHFKIVVKTA-S-----------------IGAFKFASEANQ-------------
A0A1G0CI31      SRFS-NQHFDIAFKVD-N-----------------IENLRSDDEQNE-------------
A0A556N0M0      KTIH-TRHFDIAFKVE-N-----------------WNILKQDDEANR-------------
F2IKD6          QTIK-TSHFEIGFKVN-N-----------------WQSLKQEDVSND-------------
A0A1I7BM74      QAHK-NEFFHIFIKSE-N-----------------EEVLKRDINDNE-------------
A0A2G2FJ17      KLLA-TPYFDLEIEIP-N-----------------WESFVTDAETNV-------------
A0A2E3R1D0      --------------DDPS-----------------TP-----------------------
A0A2T2USC0      QSAS-ETVAGLLMSPEEE-----------------RR-----------------------
A0A2T2V0F3      --------------PEGE-----------------RR-----------------------
A0A2T2S682      --------------PSGE-----------------GR-----------------------
D5H561          --------------WAGQ-----------------GTGGAEGGASGDDPSP---------
A0A2H3NWA9      --------------ETQE-----------------RL-----------------------
A0A2A8CVB6      --------------VEGN-----------------RL-----------------------
A0A2P6C1S6      --------------PEGE-----------------QR-----------------------
A0A2T2UTM4      --------------PEGK-----------------RR-----------------------
A0A414ZBF2      DTTD-TPVGKVVVASTLF-----------------MNEEYMGKP----------------
A0A1Q3Q573      QKLK-TPYFQATISLK-----------------------PDKLSDGSFNSL---------
A0A662BAY3      EVIK-TDYFSFIIKPKRE-----------------RNKIETAT-----------------
A0A4U3L369      DTVH-YNKFVFYINRNKY-----------------IKIDKDNEDK---------------
A0A357YNR3      STLK-FPFGEIEVATTPI-----------------IHSRNMM------------------
A0A5E8AX52      ETIS-TPDYNLLIEKTEN-----------------FAEDNGIGK----------------
F4KK08          DTIA-TPIGKVVVEATPY-----------------YSNFPNYEV----------------
A0A6B5PK86      EHLI-SQHFDVVVKSE-N-----------------ISAFLEETESNE-------------
A0A2G2F510      EHLK-NEDFDVVVKVI-S-----------------DDALRDASTINE-------------
A0A316JZ08      KHVT-NDDMNVVVKSA-N-----------------PKVFRKMASENE-------------
A0A496LCF9      EPIG-CKYFLVKVIPNSD-----------------FMDLKT-------------------
A0A5P2G2A9      DSIP-LSKGKFVIYKQTF-----------------FDKKKAN------------------
A0A3C0ZQC7      ------------------------------------------------------------
A0A3N2N6F7      DTVS-TSFGRMVISAGPN-----------------FSPDFDHD-----------------
A0A419VXB7      EKFE-NRYFSFTLQKK----------------------------VLPTEGD---------
A0A0B0BTJ4      ETIR-DTVGVFRLERAVA-----------------TAGYNPKAANS--------------
A0A3B9CNN6      ETIR-DTVGVFRLERAVA-----------------TAGYNPKAANS--------------
R5X290          ETIR-DTVGVFRLERAVA-----------------TAGYNPKAANS--------------
A0A1Q6E6I7      ETIR-DTVGVFRLERAVA-----------------TAGYNPKAANS--------------
C3J7R8          VPQD-TPMGRVLVTATEH-----------------FPSSEASFS----------------
A0A1G8BVM8      SVVA-FSHGKIKIKPTIF-----------------MHSGYIGQN----------------
A0A1I1FXP9      KTYE-NQDVKFKITKTPF-----------------YKPDVINYE----------------
A0A4P7VVU7      DTVA-TSFGPITINPGPA-----------------YAKRFGNTIKI--------------
A0A2V1ILM4      DTVA-TSFGPITINPGPA-----------------YAKRFGNTIKI--------------
A0A3N2L0E8      DTVA-TSFGPITINPGPA-----------------YAKRFGNTIKI--------------
A0A3N2LFC5      DTVA-TSFGPITINPGPA-----------------YAKRFGNTIKI--------------
A0A7K3KWJ8      DTVA-TSFGPITINPGPA-----------------YAKRFGNTIKI--------------
A0A3N4H5N3      EKIR-TNFGVFSLVKKEE-----------------EGERLESVSS---------------
A0A2P8EAX2      DKIK-TEFGVFSLEKKSE-----------------EDAISFPFST---------------
A0A4V2F6N9      DKIK-TEFGVFSIEKKSE-----------------ESAVSFPFST---------------
A0A3B9FXJ0      KPYS-TPAFSISVSRNGK-----------------GKVLAES------------------
R5GSU5          QRIA-TPAGNVYLTRKMN-----------------LEGLEPTTVTVSRLPV---------
A0A2A3UE91      SWLK-TADFDINIYLN-P-----------------NIQASVINEIVKDNKG---------
A0A0A2G557      ETIE-TPIGSFFLTSN-T-----------------IATSKKEP-----------------
A0A2N2WFW8      ETVS-LPQVNFLLT---P-----------------VAGDAKSFFAANNGKQ---------
A0A1F3IU95      EPVS-LPQVNFVLT---P-----------------INNDAHAFFKSNRNKQ---------
A0A3D0VUF6      EPVS-LPQVNFVLT---P-----------------INNDAHAFFKSNRNKQ---------
A0A1T4PT95      DRVV-LFGETIETPIG-S-----------------FVLTGNPSTEVEDKE----------
A0A6I6JYY3      VRLT-ANEFSFTILLNEK-----------------FDPQAPNE-----------------
A0A2A4PYG9      XWXA-LEHLEVKIDVT-D-----------------FSLISTQQNQFAQNP----------
A0A1F3K695      VWSN-IGLAEIKLKID-D-----------------TSQIQAQLSDLKQNS----------
A0A353KZR1      VWSN-IGLAEIKLKID-D-----------------TSQIQAQLSDLKQNS----------
A0A2N2WYB5      QWTA-IQGGEIKVSIL-N-----------------IDDIESQQEYYKSNR----------
A0A1F3K4G0      KWSA-IRADSIRCTVS-D-----------------YLTIESQKENYKGNR----------
A0A356H8Y3      KWSA-IRADSIRCTVS-D-----------------YLTIESQKENYKGNR----------
A0A351HSA6      KWSA-IRADSIRCTVS-D-----------------YLTIESQKENYKGNR----------
A0A1F3Q014      KWMK-FPEMDLFISIK-N-----------------FTEIANEQNVVKKNA----------
A0A2D5KD44      KSCH-LPFAEVIVTVT-D-----------------YSRIKKEVEAVKGIE----------
A0A6N9NIX1      EWVG-VPEGRIKIIIK-N-----------------FDFIKNFNNQIKQNQ----------
A0A2A4YXP3      TTIH-LPKVDLKITLL-R-----------------KE----NYEILKEGN----------
A0A1F3R158      EKIQ-TNLAEFTVIFN-N-----------------YEEAKNAQSDIKNTL----------
A0A2M8ADX2      QDIK-LSKVDFKISID-G-----------------YEELKKSQSDIKGTS----------
A0A1J5B2H0      EKIV-FQDVDLDVKVT-N-----------------PEVVFNKSGILNSDN----------
A0A1V5N756      DTLK-TEYFDMFVTLK-D-----------------PG-YFKNISFIDKDD----------
A0A651GU15      DYVR-TRFFEGRIDLAPP-----------------LEENSDKGSYNE-------------
A0A3Q9FR88      QRFS-LGGRPIIIRSK---------------------------SPNVDNNK---------
A0A553GEX3      QRFS-LGGQPIIIRSK---------------------------SPNVDNNR---------
A0A150ADJ9      KPLF-FEGADIIIEPN---------------------------SKSTINNT---------
A0A1B1FWQ4      ESII-LGGQSLIITPK---------------------------NKILETNK---------
A0A1S1Z228      EQII-LGGQPLIVTPK---------------------------NKILETNK---------
A1ZKR2          QPIV-TSYYSFKVI---K-----------------TSFYKPAFRQIP-------------
A0A1Q3GX01      QTIN-HSGLSFKVI---K-----------------TPFYKKRFHNIP-------------
A0A349DQI4      QTVK-YPGFSFKVI---K-----------------TPFYKKRFHNIP-------------
A0A4P5TMD1      QKTI-TPHFNFIAKLT-------------------AHDFKNNPNVYLSSN----------
A0A2N3IIZ0      EWLK-NKDVELLITQKMP-----------------LSTYSEN------------------
A0A7K3WUF2      KSVS-NKYFDFKLLII-D-----------------ANHYKRVDSGEIE------------
A0A1F3SJM1      EHFV-NDDMDVVIKST-N-----------------KQLFISTSQNDD-------------
A0A2G2EB96      ERIK-NEDFDVVVKAT-D-----------------PHSFYQVSKENE-------------
A0A2G6PRA9      EHIQ-NSDFDIVVKAA-D-----------------PDNFHKVSKEND-------------
A0A497D5Z2      TPVG-TDNFSFTVYADGN-----------------ANYDLNNYDE---------------
A0A662B170      TPVV-TDNFSFTVYADGN-----------------ANYDLNNYDE---------------
A0A2A5FYT6      EIII-LPHVNLRIKDV-D-----------------FIQITTSKKQLKQND----------
A0A2E6SYP1      TWTD-FEGLALKINIS-N-----------------INQNKLSDQNLK-------------
A0A2E5RLE8      KWVS-IDGLELKINIS-N-----------------RKLNELNNSGKK-------------
A0A2E7TQF6      KWVS-IDGLELKINIS-N-----------------RKLNELNNSGKK-------------
A0A2E6GVY9      KWIS-INGLELKINIS-N-----------------RNLNDLNDSGKR-------------
A0A350JJ90      DTIQ-TPHFSFTIV---R-----------------LDEAQAQSSGLTEDR----------
A0A3M1CDV2      TWTK-HEWLDFFIRLN-E-----------------KRDTTSIRKDLYNNQR---------
A0A6C1QGZ7      GPNS-LPEMDIIINVH-N-----------------FNMIREEQSLFSRNH----------
A0A4P5U6G4      KKIR-TPHFDFTANT--D-----------------QEVLKSNIESLKTGQ----------
A0A2E2TFD1      GDIE-LPFVTLSIKIL-D-----------------FDIIKNDQETGTRND----------
A0A2E4ELE6      WE-D-LGFVELKFIII-D-----------------FDIIKSEQTDLSNND----------
A0A522EYA6      TAVS-APEMNFTITVL-N-----------------FPEIQSQQNAVKGNS----------
A0A2E3XZI5      KFFS-SKYISGILKIDWE-----------------LEEFKKNLEKSN-------------
A0A6I7QXV0      RFFE-NNYFILKASLT-E-----------------SAAEQIHSHVGEP------------
A0A2M7NLQ9      TRIK-NQYFKLIISLS-D-----------------TFDKLKSTSDS--------------
I4AFR0          TRIK-NQYFTLIISLN-N-----------------TFDKLQSPSSN--------------
A0A2N2Y3E5      EWLN-FYGSWLRIEIR-D-----------------TAALLEYENMLKKDG----------
A0A2D9D7T6      KPIK-TKSFEIIVKAK-N-----------------KFGITEINKNNR-------------
A0A1F3PPL5      KWEN-INGIDVKVTIT-N-----------------YKGIEELHKSLNHES----------
A0A357QK06      KWEN-INGIDVKVTIT-N-----------------YKGIEELHKSLNHES----------
A0A662AEA4      TWNL-ICGGEIKLNIN-N-----------------YKRIELQQSNLKKTA----------
A0A0S2HYK8      KWTD-LGILSCKAEIL-R-----------------YNVIKSMYESAKQNS----------
A0A2N5ZWN6      EWNE-LGYFKIFVTIN-N-----------------FAAIQSMYEKESQNS----------
A0A2E0FJ09      ESFS-TEHFICSIQIS-D-----------------LNRFYAQQNDGE-------------
A0A1F3FZ62      ETVK-LPEMEFVLKLN-P-----------------KSSIKTDLNADE-------------
A0A1F3K211      ETVK-LPEMEFVLKLN-P-----------------KSSIKTDLNADE-------------
A0A1V6I2U9      ELQT-IYGMDIYVHFP-S-----------------KKDLEQELDPQNKSQ----------
A0A2H0B957      AWTD-IGGFEIILNIT-D-----------------LAAIREQSNKIKTDS----------
A0A1F3CFW6      KWTD-INGLEIKIEVT-D-----------------IDAIRTQINKIKNDS----------
A0A2M7E2T8      QWTD-INGLEIKIEVT-D-----------------IDAIRTQINKIKNDS----------
A0A2M7NC69      QWTD-INGLEIKIEVT-D-----------------IDAIRTQINKIKNDS----------
A0A1F3KLL5      RWNK-INKTEIKININ-N-----------------IDDLLADKQNLKQNS----------
A0A359D1M1      RWNK-INKTEIKININ-N-----------------IDDLLADKQNLKQNS----------
A0A0F2NS19      VPIE-LKEVTLRIVFD-N-----------------YNEFGADKNNS--------------
A0A2A5H8X6      VPIE-LKEVTLRIVFD-N-----------------YNEFGADKNNS--------------
A0A2H0GAU8      TPIK-LKQVDLKIQID-E-----------------YESLKDVKNNK--------------
A0A2M8FTK1      TPIK-LKQVDLKIQID-E-----------------YESLKDVKNNK--------------
A0A2A5B3B0      ETIN-HPKVELKISLL-D-----------------KDLYVTPQGGD--------------
A0A5C6RXM7      ELIV-IDKIDFKIKIL-K-----------------EKV-TDFIGAV--------------
A0A1F3C1M2      EWID-LDLIEFKLTVN-N-----------------YNAILEEHDELTKNN----------
A0A1F3DS87      EWID-LSLVELKLTVS-N-----------------YTAILEEHDELKKNN----------
A0A6A0R6K9      ELPF-AHLVISINNYE-H-----------------IKNETTAVKPIS-------------
A0A2E7CT70      DFFS-SNYISGKLIID-D-----------------IPTFSESLDKFN-------------
A0A2D5V560      KFFS-SEFISGKLKFS-S------------------NNWKDNLNSMSTNER---------
A0A2D7K5A8      KFFS-SKFISGKLSFS-N------------------GNWKDLLSSLSSNER---------
A0A2E1XQ82      KFFS-SKFLSGKLSFS-N------------------EDWKDFLSSLSSNER---------
A0A5C8A5B4      VDQV-VPMDSMFVGDR-------------------LSFRIKFPEDRMYDKN---------
A0A7C1LGX3      ALKT-SPFRILMIDTL-------------------QNLNLIGQE----------------
A0A4Y9ITE2      DTPY-GDFVFQKKDAF-------------------Y----------EEGKP---------
A0A5M8NYX7      ADFQ-KTFKIDEEINS-------------------PWGTLTFEKNPFGTGE---------
A0A0E3V905      ETPY-GRLKIVTKKQT-------------------F------------DSE---------
A0A553ETH6      EYKT-GEL---VSTPQ-------------------LNFTLELTEHYDENGE---------
A0A640Q161      ANIV-EALPFLPQDDP-------------------K-------------EL---------
A0A640QU49      AQLT-EWLPFLPQEEV-------------------K-------------TL---------
A0A1Q3PII2      NIYK-GTFGIPMALPH-------------------G-LSIIDTTRFKPASH---------
A0A351BXT2      DEDK-KKFYYILNHGE-------------------N------------------------
A0A2K8Z965      ETPY-GRLKIVSRKAT-------------------A-------------RI---------
A0A418M8U8      KTPQ-GRFLIKTRRSV-------------------G------------DTT---------
I2GTA4          KTPQ-GRFLIKTRRAV-------------------G------------DTT---------
A0A2K8ZAJ2      KTPY-GQLRIFVRKPL-------------------S------------SKL---------
A0A368JPA3      NTPF-GRLQIFIKQPV-------------------V------------YTN---------
A0A5N1JI29      NTPF-GRLQIFIKQPV-------------------V------------YTN---------
A0A7K0EGC9      NTPF-GRLQIFVKQPV-------------------V------------YTN---------
A0A3P1BT12      NTPF-GRMQIFIKQPV-------------------V------------YSN---------
A0A3P1CI15      NTPF-GRLKIFIKQPV-------------------V------------YSN---------
A0A4R8CUK1      TTPF-GRLRMLVNEPV-------------------D------------YAN---------
A0A3D0MYJ7      DGLR-KRLEGMASITA-------------------P------------------------
A0A662AH13      ---------KPLKSVP-------------------AIAKMLEDTKIEQK-----------
A0A5C7QA01      VLLQ-AQLNKKVKIHN-------------------RMGLWTVEINSKDIQS---------
A0A3D3LS70      DELT-ELLGGIVSISQ-------------------K------------------------
A0A1G1TM36      TLTR-HAFGRPISDSL-------------------GTWQLNATASLRGFEG---------
A0A1G7ZF38      HYYK-GSFGKKLSLPH-------------------G-AAIMDTTRFKPSSH---------
C6VS52          SRFR-GRFSSPLALPQ-------------------GVAVIVDTTRFKPSAL---------
A0A2A4G4B1      KEIG-YENVRFRIIPL-------------------LDIN------ALKGQS---------
A0A0P7X1V8      ------PEDSSIVTAD-------------------TVFA---------------------
A0A6P1P355      TWVN-TPYGELMFLPN-------------------DNKR------DTPSLP---------
A0A5C8KAD6      EWVD-TPYGEMKFSKN-------------------KNML------FAATNP---------
A0A5N1J695      EWVR-TPYGIMLFQRN-------------------EKQS------AAPIGP---------
A0A3N2M1H3      ESVK-TPIGIVKVTPN-------------------PEY---DGLPITESIE---------
A0A4S2G8T2      ESVK-TPIGIVKVTPN-------------------PEY---DGLPITESIE---------
A0A212K7W5      ESVN-TPLGSIRINPT-------------------AFYS--KVY---YNQQ---------
F5IU11          EPVN-TPLGNITIHPT-------------------AFYS--KGY---YDQK---------
A0A7C1QWC7      QTVT-TPYFKFSVTRD-------------------LNTT---GSNKGGGLP---------
A0A352Z1R7      ------------MQAK-------------------GFSLLLNDLKGEKGDN---------
A0A0A2F501      DTIS-APIGKLVIVRS-------------------ESYL--ADKSKTRPSQ---------
R5B7P0          DTLQ-TPVGRIIVQKT-------------------KDYS--GEA---MKKP---------
R5B0L5          DTIR-TQSGNLVVSLT-------------------GRGN--P-----SGMT---------
A0A6I1TEC0      KLVQ-TPLGKVKLEAA-------------------PSYA--AFIKGSDAPA---------
A0A3R5XWG1      KLVQ-TPLGKVKLEAA-------------------PSYA--AFIKGGDAPA---------
A0A5P0Y910      KLVQ-TPLGKVKLEAA-------------------PSYA--AFIKGGDAPA---------
A0A414YFM3      KLVQ-TPLGKVKLEAA-------------------PSYA--AFIKGGDAPA---------
A0A6A7UIA7      KLVQ-TPLGKVKLEAA-------------------PSYA--AFIKGGDAPA---------
A0A6A7VPS3      KLVQ-TPLGKVKLEAA-------------------PSYA--AFIKGSDAPA---------
A0A374THP7      QIIH-TPLGKIKVDKA-------------------PSYS--QFVKNGDAPV---------
A0A6G1VND1      QIIH-TPLGKIKVDKA-------------------PSYT--QFVKNGDAPV---------
A0A0A2EVS5      DSIP-TPMGIVRVGLN-------------------SAYS--DEKSIQTPMT---------
A0A1T4NAJ7      DSIP-TPMGIVRVGLN-------------------SAYS--DEMSIQTPMT---------
A0A255T941      KVVM-TPIGQMTVHGT-------------------KTAR--EDF---IGEK---------
A0A4P7VSV0      DTIM-TAVGPMVVVAA-------------------EGYK--PG----EAVE---------
A0A7J0AX49      DTIM-TAVGPMVVVAA-------------------EGYK--PG----EAVE---------
A0A3N2KCL3      DTIM-TAVGPMVVVAA-------------------EGYK--PG----EAVE---------
A0A2V1IJY1      DTLM-TVVGPMVVVAA-------------------EGYK--PG----EAVE---------
A0A4P7VXK7      DTLM-TVVGPMVVVAA-------------------EGYK--PG----EAVE---------
A0A1Y4CHN5      DTIE-TPVGRIVVSTT-------------------PYYS--GTF----DSD---------
A0A1M6I2S6      DSIR-MEVGTFVINPT-------------------KYWN--DSF---VGTS---------
A0A1Y3V692      DSIR-MEVGTFVINPT-------------------KYWN--DSF---VGTS---------
F3PXM2          DTLR-TSVGTLLIDAT-------------------PYAT--DDF---MGTS---------
A0A174AHH7      DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A174JCE8      DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A3E4JMC4      DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A412SND6      DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A414IEQ9      DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A7K0HNT3      DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A0M1W8D8      DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A3R6GKX5      DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
A7V4S1          DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
B0NU19          DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
D4V601          DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
A0A4Q0U3M9      DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
A0A7J5G2G2      DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
A0A7J5HH13      DSIQ-TSAGTLAISLT-------------------SQYE--IFF---TGST---------
A0A397WLT5      DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
A0A6A2J529      DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
A0A6N8DDD8      DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
A0A015XH67      DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
A0A078RZN2      DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
A0A6M4L7F4      DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
A6L0K5          DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
A7ACT5          DSIQ-TSAGTLAISLT-------------------SQYE--NFF---TGST---------
A6KY94          DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A173UQR8      DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A3R6HK75      DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A412B7D1      DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A412VNY9      DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A414LTU9      DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
I9Q4U4          DSIQ-TSAGTLAISLT-------------------SQYE--NSF---TGST---------
A0A373ISF0      DSIQ-TVAGTLFISPT-------------------KFYS--DAC---IGTS---------
U6RF62          DSIQ-TAAGTLFISPT-------------------KFYS--DAC---IGTS---------
A0A662ZZD5      DSIR-TEIGTLVINFT-------------------KYWN--DSF---VGTS---------
A0A3A5TI83      DSIR-TEIGTLVINFT-------------------KYWN--DSF---VGTS---------
A0A415NEB6      DSIR-TEIGTLVINFT-------------------KYWN--DSF---VGTS---------
A7AJ60          DSIR-TEIGTLVINFT-------------------KYWN--DSF---VGTS---------
A0A7J5MKN5      DSIR-TEIGTLVINFT-------------------KYWN--DSF---VGTS---------
A0A6A2JF01      DSIR-TEIGTLVINFT-------------------KYWN--DSF---VGTS---------
A0A7J4Y8G3      DSIR-TEIGTLVINFT-------------------KYWN--DSF---VGTS---------
A0A015UXN7      DSIR-TEIGTLVINFT-------------------KYWN--DSF---VGTS---------
A0A6I2NTL0      DSIR-TEIGTLVINFT-------------------KYWN--DSF---VGTS---------
A0A6I2Q447      DSIR-TEIGTLVINFT-------------------KYWN--DSF---VGTS---------
A0A016E4F9      DSIR-MEIGTFVINLT-------------------KYWN--DSF---VGTS---------
A0A6N3HG44      DSIR-MEIGTFVINPT-------------------KYWN--DSF---VGTS---------
A0A7K0HSP7      DSIR-MEIGTFVINPT-------------------KYWN--DSF---VGTS---------
A0A7K1HEJ5      DSIR-MEIGTFVINPT-------------------KYWN--DSF---VGTS---------
A0A6H9P0U9      DSIQ-TSAGIMIVSPT-------------------QEFT--DAF---IGTS---------
A0A108TH71      DSIQ-TSAGIMIVSPT-------------------QEFT--DVF---IGTS---------
I8VXH0          DSIQ-TSAGIMIVSPT-------------------QEFT--DVF---IGTS---------
A0A412S0N6      DSIQ-TSAGIMIVSPT-------------------QEFT--DVF---IGTS---------
A0A412IIJ0      DSIQ-TSAGIMIVSPT-------------------QEFT--DAF---IGTS---------
A0A0P0FM97      DSIQ-TSAGIMIVSPT-------------------QEFT--DAF---IGTS---------
R6KTP3          DSIQ-TSAGIMIVSPT-------------------QEFT--DAF---IGTS---------
A0A139LU87      DSIQ-TSAGIMIVSPT-------------------QEFT--DAF---IGTS---------
A0A1C6B3Y5      DSIQ-TSAGIMIVSPT-------------------QEFT--DAF---IGTS---------
A0A6L3KCD1      DSIQ-TSAGIMIVSPT-------------------QEFT--DAF---IGTS---------
E2NMQ4          DSIQ-TSAGIMIVSPT-------------------QEFT--DAF---IGTS---------
A0A412YDB9      DSIR-TSAGTMILHPA-------------------QKNA--NAF---IDTP---------
R7DY01          DSIR-TSAGTMILHPA-------------------QKNA--NAF---IDTP---------
A0A414LGK8      DSIR-TSAGTMILHPA-------------------QKNA--DAF---INTP---------
A0A415IPQ4      DSIR-TSAGIIIISPT-------------------EKFT--DAF---TGTS---------
A0A3E5BRW7      DSIH-TSVGTMIISLT-------------------QEFT--DAL---TDTP---------
K9DXS6          DSIH-TSVGTMIISLT-------------------QEFT--DAL---TDTP---------
A0A1M6KFV3      DSIH-TPAGTMIISPT-------------------QAPS--DAF---MGVP---------
A0A1Q6G7L3      DSIH-TPAGTMIISST-------------------QASS--DAF---MGVP---------
A0A413H235      DSIH-TPAGTMIISST-------------------QASS--DAF---MGVP---------
A0A1M5B2J8      DTIQ-SPFGKMAVTAT-------------------AHYR--KG----QETE---------
A0A255RCT5      DTVQ-SPFGKMSVTAT-------------------AHYR--KG----QEAD---------
A0A1Y4GLF5      DTIA-TPLGRMVVNAT-------------------ANYV--DA-----PCT---------
A0A1H3XSC0      DTIT-TPLGILKIETT-------------------PYYK--SK----EPYT---------
A6LE40          DSIP-TPLGKIIIHTT-------------------PNYV--KG----EAYI---------
A0A4Y1VPX5      DSIT-TPLGKIIIHTT-------------------PNYV--KG----EAYT---------
A0A6N2XMM4      DSIT-TPLGKIIIHTT-------------------PNYV--KG----EAYT---------
B3JI46          DSIT-TPLGKIIIHTT-------------------PNYV--KG----EAYT---------
A0A358R8U0      DTLT-TPLGRVEITPT-------------------PYYD--ID----RGCQ---------
R6WSB6          DTLT-TPLGRVEITPT-------------------PYYD--ID----RGCQ---------
A0A401LPX7      DSIQ-SPLGPIVVIPS-------------------AAYS--GK----TEST---------
A0A6G0GNY9      DSIQ-SPLGPIVITPS-------------------ATYS--DK----TEEV---------
A0A6I1BFM0      DSIQ-SPLGPIVITPS-------------------ATYS--DK----TEEV---------
A0A3A5Z900      DSIQ-SPLGPIVVIPS-------------------AAYS--GK----IEST---------
A0A7K0GW19      DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
A0A285TGL6      DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
A0A3A5RFX4      DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
A0A1Q6IUW9      DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
A0A413XDP6      DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
A0A6N8CVT6      DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
K6AP24          DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
A0A6I2NHV3      DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
A0A078RYI7      DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
A0A7I0QD01      DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
C7XEQ8          DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
D7INX6          DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
K5ZG55          DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
A0A662ZYI7      DSIQ-SPLGPIVVIPS-------------------AAYS--DK----TVST---------
A0A3N2N9B8      DTIS-TPAGLVVINPS-------------------AYYL--P----KQPIA---------
A0A3N2NMI0      DSIA-TPVGIVIVNPS-------------------PAYT--P----GTAIE---------
A0A359I8H7      GPIE-TPVGKVSIIAN-------------------GNYTAPKGKKNKPVTK---------
A0A3N2KA63      GPIE-TPVGKVSITAN-------------------GNYTAPKGKKNKPVTE---------
A0A4Q0IMT7      GPIE-TPVGKVSITAN-------------------GNYTAPKGKKNKPVTE---------
A0A7J0B660      GPIE-TPVGKVSITAN-------------------GNYTAPKGKKNKPVTE---------
A0A3B9FAU3      TIIG-TPVGNVLVTPT-------------------QYYG--SFVT-HTKDP---------
A0A3C1E5L7      TIIG-TPVGNVLVTPT-------------------QYYG--SFVT-HTKDP---------
A0A4Q0UAV1      RTYK-TPVGPFRINTT-------------------EYFT--KEYINEPVTF---------
A0A354SN68      DTLL-TPIGKIFLQKS-------------------NSFD--K---AFITST---------
A0A6L5XFL0      TITK-TPVGNVIVNPT-------------------SYYV--G----KYNSP---------
A0A3N2N595      DTIK-TDAGPIVILPT-------------------DYYK--P----GDLID---------
A0A7J0ACS3      DTVA-TPVGKMIVSPS-------------------GNYQ--N----GTEVS---------
A0A0A2DUD9      KATE-TPLGKVLVNKN-------------------QGDD--L----DLVNG---------
A0A3P1ZBJ5      QVVK-TPVGDILVTPT-------------------KNFE--L-----LKKS---------
R5FHS9          QTVH-TPIGRVTIKPS-------------------HYYN--S-WPGGLYAN---------
A0A413TW79      QTVR-TVMGYVCVDQA-------------------PGYS--AFVNGYESRK---------
A0A7K0AAG2      QTVR-TAMGYVCVDQA-------------------PGYS--AFINGYESRI---------
A0A7K0ASF1      QTVR-TAMGYVCVDQA-------------------SGYS--AFVNGHESRK---------
A0A3E5E9M7      QTVR-TAMGYVCVDQA-------------------PGYS--AFVNGHESRK---------
A0A3E4SK73      QTVR-TAMGYVCVDQA-------------------PGYS--AFVNGHESRK---------
A0A415GGC6      QTVR-TAMGYVCVDQA-------------------PGYS--AFVNGYESRK---------
A0A413DBH9      QTVR-TAMGYVCVDQA-------------------PGYS--AFINGHESRK---------
A0A495WI87      DTIM-TPVGKVTVCPT-------------------PYYT--S----QFSQP---------
A0A354M4S6      DTIM-TPVGKVTVCPT-------------------PYYT--S----QFSQP---------
R7DH52          DTIM-TPVGKVTICPT-------------------PYYT--S----QFSQP---------
A0A7J5IAE7      DSIP-TPLGKVIIHTT-------------------PNYV--K----GEAYT---------
A0A016CWA4      DSIT-TPLGKIVVHTT-------------------PNYV--E----GEAYT---------
A0A4P8LP09      DSIT-TPLGKIVVHTT-------------------PNYV--E----GEAYT---------
A0A0M1W0V2      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A139KA16      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A174VQ92      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A1Q6HCG0      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A1Y4JYM9      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A3A5QW67      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A3A5RQE6      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A3A6BP07      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A3E5E153      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A3Q9IP20      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A412WV15      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A413ICP6      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A414KYB9      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A5B3FWR2      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A7J5QHB9      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
E5WX00          DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
K0X3P3          DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A1C6H117      DSIT-TPLGKIIIHAT-------------------PNYV--K----GETYT---------
A0A6I1AQV4      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A5C6L2P1      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A412MJT7      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A3E4WKT5      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A3A5YY33      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A1E9CFZ7      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A373FYU5      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A3A5TZ72      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A3A5XBP2      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A3A6MEG9      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A3E4JP35      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A3E4KP40      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A3E4NX82      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A3E4XFU8      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A412RG70      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A412TD37      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A413GAA4      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A414M7I4      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A496BTA0      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A496D2V6      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A5C6KCA6      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A5M5AHM5      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A6I0Y5K7      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A6I1BFB8      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A6I2P5W5      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A6N8DC51      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A7J5HGP0      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A7J5HVL8      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A7J5JHD3      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
E5UZA2          DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A069SMG6      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
C3RFN5          DSIP-TPLGKIIINTT-------------------PNYV--K----GKAYT---------
A0A3A5Z014      DSIP-TPLGKIIINTT-------------------PNYV--K----GESYI---------
A0A7J5GD93      DSIP-TPLGKIIINTT-------------------PNYV--K----GKAYT---------
A0A7K0HGR5      DSIP-TPLGKIIINTT-------------------PNYV--K----GKAYT---------
A0A078S3Q8      DSIP-TPLGKIIINTT-------------------PNYV--K----GKAYT---------
A0A069SJV7      DSIP-TPLGKIIINTT-------------------PNYV--K----GKAYT---------
A0A3E5DXI5      DSIP-TPLGKIIINTT-------------------PNYV--K----GKAYT---------
A0A3E5EM98      DSIP-TPLGKIIINTT-------------------PNYV--K----GKAYT---------
A0A6N2YYD4      DSIP-TPLGKIIINTT-------------------PNYV--K----GKAYT---------
I9T3G6          DSIP-TPLGKIIINTT-------------------PNYV--K----GKAYT---------
A0A3E4SYU0      DSIP-TPLGKIIINTT-------------------PNYV--K----GESYT---------
A6LGY1          DSIP-TPLGKIIIHTT-------------------PNYV--K----GKAYT---------
K5ZSH4          DSIP-TPLGKIIINTT-------------------PNYV--K----GKAYT---------
A0A6A2RTB3      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A7J5PEN4      DSIT-TPLGKIIIHTT-------------------PNYV--K----GEAYT---------
A0A1M4YZ07      DSIP-TPLGKIIIHTT-------------------PNYV--K----GKAYT---------
A0A7J5I238      DSIT-TPLGKIIIHIT-------------------PNYV--K----GEAYT---------
A0A0P0FQW1      DSIT-TPLGKIIIHIT-------------------PNYV--K----GEAYT---------
A0A7K0I229      DSIT-TPLGKIIIHIT-------------------PNYV--K----GEAYT---------
A0A5M5C0W6      DSIT-TPLGKIIIHIT-------------------PNYV--K----GEAYT---------
A0A642NJ89      DSIT-TPLGKIIIHIT-------------------PNYV--K----GEAYT---------
A0A6L3JTQ2      DSIT-TPLGKIIIHIT-------------------PNYV--K----GEAYT---------
A0A7J5FQU6      DSIT-TPLGKIIIHIT-------------------PNYV--K----GEAYT---------
A0A7J4YLH7      DSIT-TPLGKIIIHIT-------------------PNYV--K----GEAYT---------
A0A6N3AEV2      DSIT-TPLGKIIIHIT-------------------PNYV--K----GEAYT---------
A0A6G0G4T5      DSIT-TPLGKIIIHIT-------------------PNYV--K----GEAYT---------
A0A6L3KG29      DSIT-TPLGKIIIHIT-------------------PNYV--K----GEAYT---------
A0A1Y4PQK7      CTLN-TPLGKVTLETT-------------------SGYV--R----GTEYK---------
A0A1Y4IH41      GTLN-TPLGKVTLEAT-------------------SGYV--R----GTEYK---------
A0A3A6AAP4      GTLN-TPLGKVTLEAT-------------------SGYV--R----GTEYK---------
A0A6I0ZRD2      GTLN-TPLGKVTLEAT-------------------SGYV--R----GTEYK---------
A0A7L4SP06      GTLN-TPLGKVTLEAT-------------------SGYV--R----GTEYK---------
A0A1Y4DYA7      DTIS-TPVGRLLIKPT-------------------HGIK--D----FKET----------
A0A1Y3X4I9      DTVS-TPVGRLLVKPM-------------------AGAE--T----WKEA----------
A0A1Y4FNK8      DTAD-TPIGKLSIKAM-------------------NDTV--T----YQEP----------
A0A355FD59      TIVD-TPLGKLSVMPT-------------------SHYT--N----ETSPL---------
A0A359CEZ9      TIVD-TPLGKLSVMPT-------------------SHYT--N----ETSPL---------
A0A353Q7B4      TIVD-TPLGKLSVMPT-------------------SHYT--N----ETSPL---------
F8X3A5          DTID-TPLGKIIVFPT-------------------SYYT--K----TEMPL---------
A0A1M3KVR9      DTID-TPLGKIIVVPT-------------------SYYT--K----NEMPL---------
A0A4Y9IJS3      DTID-TPLGKIIVVPT-------------------SYYT--K----NEMPL---------
A0A1H4ADG3      VPVV-LPIGQLTLEKN-------------------ELT-----NDWDGSQN---------
A0A5B8VUR8      EPIQ-LPIGKVTLVKN-------------------QAM-----SSWDPARS---------
A0A0D3L8Q3      QRVN-VGFGEFTIVSD-------------------SR------LIRNGM-T---------
A0A7G7G5F9      QEII-KPYATFTVNAN-------------------PAA-----PASDVK-Y---------
A0A2N3U785      QKIV-LPYATFTVTAA-------------------PGF-----STTNYS-E---------
A0A5B6TJH8      KRIQ-KPYATFTVLAT-------------------YKLN--STPTSNLN-Q---------
A0A519U664      QQIK-KPYGSFTIVAS-------------------SI------KNAVSD-K---------
A0A519MA34      QQIE-KPYGSFTIVAA-------------------ST------KNAVSD-K---------
A0A519UCX0      QEIK-MPYGSFTIVAS-------------------AT------KSAVSD-K---------
A0A0E3ZG78      QQIQ-KPYGVFTVVPD-------------------SGLT--ASSKSIGS-K---------
A0A1I6BRK6      QKIH-KAFGSFTVITA-------------------GG------QYNVGT-K---------
A0A243WAB1      QQIA-KPYGLFTIIAA-------------------SG------GNTADR-K---------
A0A6G8C8X6      QQIT-KPYGKFTVVAA-------------------TV------KDLGEN-K---------
A0A416GA42      DTVQ-TAVGQLVVVPT-------------------GFYQ----KFDREL-E---------
A0A1T3IYP5      QLVE-TPVGKVFVTPS-------------------KNYK----D-YYGT-D---------
A0A1T5K9D4      DKVK-IGDGSFTIDKT-------------------RNLG----KHWFGE-A---------
A0A077ENE7      KLTS-TPVGKILITPS-------------------KYYK----KDYYGV-E---------
A0A7H1Z2Z7      KLTS-TPVGKILITPS-------------------KYYK----KDYYGV-E---------
A0A6I5UW06      KLTS-TPVGKILITPS-------------------KYYK----KDYYGV-E---------
T0NN57          QSVK-TPFGEVLIVPS-------------------KFYG----TDFYGK-D---------
X5K347          QSVK-TPFGEVLIVPS-------------------KFYG----TDFYGK-D---------
A0A060RD97      DTVL-IRNVLIEIKPT-------------------I-SA----EKFVGK-E---------
A0A3C1ITV0      QPFK-TPVGTVVLKAT-------------------KEYG----KNFEQ--A---------
R7HN19          QPFK-TPVGTVVLKAT-------------------KEYG----KNFEQ--A---------
A0A350IHV0      EELQ-TPVGKIKIVPT-------------------MHID----KWHD---P---------
R5RVP0          DTIS-TPVGKIVIVPT-------------------EFID----K--WKK-P---------
R6A0L2          QMTQ-TPYGPLCVVRG-------------------PGF-----GRWTDE-T---------
R7LG80          QTVK-TPAGRLSVVRS-------------------KMF-----NKWEDE-E---------
A0A2L2WX98      ETKK-TPLGNLHLIAD-------------------TYID----KMPTGE-T---------
G5GD56          VMVK-TPIGDLAINKT-------------------TFFS----RFPVGK-T---------
R5KD55          QTVN-TPLGRLTIERQ-------------------PHYP----SAVADNDE---------
A0A174QNT3      DTLF-TPVGRIIVTPK-------------------AEYV----RLYIGK-D---------
A0A4S2FGS1      DTLS-TPAGRILVLPH-------------------VESI----PHYQGK-E---------
A0A7K3KG59      DTLS-TPAGRILVLPH-------------------AESI----PHYQGK-E---------
R9I0H0          DTLS-TPAGRILVLPH-------------------AESI----PHYQGK-E---------
K5BUT9          DTIR-TEAGRIVVQLR-------------------PENL----SAYLSQ-P---------
A0A174FPA3      DTIR-TEAGRIVVQLR-------------------PENL----SAYLSQ-P---------
R6S9Y6          DTIR-TEAGRIVVQLR-------------------PENL----SAYLSQ-P---------
A0A7J4YSB2      DTIR-TEAGRIVVQLR-------------------PENL----SAYLSQ-P---------
C9KX15          DTIR-TEAGRIVVQLR-------------------PENL----SAYLSQ-P---------
A0A6H0KRK1      DTIQ-TEAGRIVVNLK-------------------PENL----SAYIGK-P---------
R6DAG6          DTIQ-TEAGRIVVNLK-------------------PENL----SVYIGK-P---------
A0A3L8AAP1      DTVQ-TEAGRIVVNLK-------------------PENL----SAYIGK-P---------
A0A4S2AYX2      DTVQ-TEAGRIVVNLK-------------------PENL----SAYIGK-P---------
A0A7J0A2L4      DTVQ-TEAGRIVVNLK-------------------PENL----SAYIGK-P---------
A0A7K3MN31      DTVQ-TEAGRIVVNLK-------------------PENL----SAYIGK-P---------
A0A0E2M2Y7      RPIA-TPVGELQIDKT-------------------IFFA----DSWKGG-I---------
A0A0K2J6Z0      RPIA-TPVGELQIDKT-------------------IFFA----DSWKGG-I---------
B2RKZ8          RPIA-TPVGELQIDKT-------------------IFFA----DSWKGG-I---------
A0A212GC82      RPIA-TPVGELQIDKT-------------------IFFA----DSWKGG-I---------
A0A254MU12      RPIA-TPVGELQIDKT-------------------IFFA----DSWKGG-I---------
R6CQ93          DTLS-IGGEKILVTST-------------------DHWS----KSWVGR-D---------
A0A3D1NQW3      DTIS-TPVGQMIIRPT-------------------LYMS----PDYYEKAP---------
B0MT10          DTIS-TPVGQMIIRPT-------------------LYMS----PDYYEKAP---------
R7JGW9          DTIS-TPVGQMIIRPT-------------------LYMS----PDYYEKAP---------
A0A3D2BF46      DTIT-TPCGLLVVTPT-------------------LYMS----DDYFGD-P---------
A0A358R538      DTAA-TPVGKVVVERT-------------------PYLT----PAYEGV-P---------
A0A1Y4AAB8      DTVS-TPLGRMIIRKT-------------------LYLS----PADEGT-A---------
A0A1Y3WWY9      DTIP-TPIGEIVVHKT-------------------LYMN----PKFNGV-P---------
A0A1Y4U5L4      DTIP-TPIGEIVVHKT-------------------LYMN----PEFNGV-P---------
A0A1Y3VCJ1      DTVA-SPIGQIIVRKT-------------------LYME----PSYRET-P---------
A0A1Y3QTW7      DTIP-TPLGQMVVHKT-------------------PFMD----STYVDR-P---------
R6XWY7          DTIP-TPLGQMVVHKT-------------------PFMD----STYVDR-P---------
A0A4Y1X9Y9      DTIP-TPLGQMVVHKT-------------------PFMD----STYVDR-P---------
A0A4Y1WM66      DTIP-TPLGQMVVHKT-------------------PFMD----STYVDR-P---------
A0A6N4GYT3      DTIP-TPLGQMVVHKT-------------------PFMD----STYVDR-P---------
A0A174AVF1      DTIP-TPLGQMVVHKT-------------------PFMD----STYVDR-P---------
A0A656Q4F4      DTIP-TPLGQMVVHKT-------------------PFMD----STYVDR-P---------
A0A1Q6EIY0      DTVA-TPVGQVVVHKT-------------------LFMD----STYLKK-P---------
A0A5B5VN71      DTVA-TPVGQVVVHKT-------------------LFMD----STYLKK-P---------
E4M8L3          DTVA-TPVGQVVVHKT-------------------LFMD----STYLKK-P---------
I3YQ50          DTVA-TPVGQVVVHKT-------------------LFMD----STYLKK-P---------
R5UEY8          DTVA-TPVGQVVVHKT-------------------LFMD----STYLKK-P---------
A0A1H4D866      DTIP-TPVGQVIVRKS-------------------LYMK----PEYTGV-P---------
A0A5B3G4Y7      DTIP-TPVGQVVVQKS-------------------LYMA----PDYIGV-P---------
A0A374A9J5      DTIP-TPVGQVVVQKS-------------------LYMA----PDYIGV-P---------
A0A5B3GQN5      DTIP-TPVGQVVVQKS-------------------LYMA----PDYIGV-P---------
A0A1Q6E9S3      DTIP-TPVGQVVVQKS-------------------LYMA----PDYIGV-P---------
D4IJ36          DTIP-TPVGQVVVQKS-------------------LYMA----PDYIGV-P---------
A0A414Q925      DTVN-TPVGKMVVAST-------------------LFTD----ENSIGK-T---------
A0A415PUS9      DTVN-TPVGKMVVAST-------------------LFTD----ENSIGK-T---------
A0A108TCU0      DTVN-TPVGKMVVAST-------------------LFTD----ENSIGK-T---------
A0A413BA42      DTVN-TPVGKMVVAST-------------------LFTD----ENSIGK-T---------
S3Y344          DTVN-TPVGKMVVAST-------------------LFTD----ENSIGK-T---------
A0A7J5LEW3      DTVN-TPVGKMVVAST-------------------LFTD----ENSIGK-T---------
A0A412TGL3      DTVN-TPVGKMVVAST-------------------LFTD----ENSIGK-T---------
A0A413VJ33      DTVN-TPVGKMVVAST-------------------LFMD----ENSIGK-T---------
A0A414L0W6      DTVN-TPVGKMVVAST-------------------LFTD----ENSIGK-T---------
A0A412DP39      DTVN-TPVGKMVVAST-------------------LFTD----ENSIGK-T---------
A0A413ZSE8      DTVN-TPVGKMVVAST-------------------LFTD----ENSIGK-T---------
B0NP84          DTVN-TPVGKMVVAST-------------------LFTD----ENSIGK-T---------
R6AK43          DTVN-TPVGKMVVAST-------------------LFTD----ENSIGK-T---------
A0A412N2D9      DTVS-TPVGKIAVQPT-------------------LFTN----ESYIGK-S---------
A0A1Y4JYS9      DTVN-TPVGKIAVQPT-------------------LFTN----ESYIGK-S---------
R6LHA4          DTVS-TPVGKIAVQPT-------------------LFTN----ESYIGK-S---------
A0A3E5HPT8      DTVD-TPLGKLIVFAA-------------------ENYS----ESYFDR-P---------
C6IJ48          DTVD-TPLGKLIVFTA-------------------ENYS----ESYFDR-P---------
Q8A3U2          DTVD-TPLGKLIVFTA-------------------ENYS----ESYFDR-P---------
A0A3R6S1H6      DTVE-TPVGKVVVTPT-------------------LYYS----KMYYSV-P---------
A0A3R6SD81      DTVE-TPVGKVVVTPT-------------------LYYS----KMYYSV-P---------
A0A354WXN6      DSVD-TPVGPLKIEAS-------------------LDYS----ERYWNK-D---------
A0A7G1HW11      DTVS-TPVGVLVVNNT-------------------GIPL----TKFKKK-V---------
R5IP14          DTVS-TPVGVLVVNNT-------------------GIPL----TKFKKK-V---------
A0A316SZX7      DTIS-TPIGKLVIKPT-------------------PYFD----S--WKN-E---------
A0A1Y4AIY1      DTVT-TPVGRIVVQPS-------------------LYYT----DTYYNK-E---------
A0A0J6CIR2      DTVS-TPVGKLVVTPT-------------------LYYA----DKYFGK-A---------
A0A3D8HG59      DTVQ-TPVGRVVVTPT-------------------LFYT----TAYFGT-P---------
A0A3R6S408      DTVQ-TPVGRVVVTPT-------------------LFYT----TAYFGT-P---------
F3ZRU7          DTVD-SPLG-LLLVKT-------------------TGLG----KAYEGE-T---------
A0A1C5Q1F3      DTVA-TPVGKLVVTPT-------------------LYYT----QDYYQV-P---------
R7A239          DTVA-TPVGKLVVTPT-------------------LYYT----QDYYQV-P---------
A0A3R6HIK7      DTVQ-TPVGRVVVVPS-------------------LYYA----DNYYNI-P---------
K5ZVW7          DTVQ-TPVGRVVVVPS-------------------LYYA----DNYYNV-P---------
A0A1Y4D5Z0      DTVT-TPVGKLVVVPS-------------------LYYT----DLCYGK-S---------
A0A413VXJ7      DTIQ-TPVGAMVVMPT-------------------LYYS----DNFYEK-P---------
I9RSN9          DTIQ-TPVGAMVVMPT-------------------LYYS----DNFYEK-P---------
U6RJK5          DTIQ-TPVGAMVVMPT-------------------LYYS----DNFYEK-P---------
A0A1Q6GA32      DTIQ-TPVGAMVVMPT-------------------LYYS----DNFYEK-P---------
I9RPU6          DTVS-TPIGPMVITPT-------------------LYYT----DAFYGK-P---------
I8YFS5          DTIS-TPVGTMVVTPT-------------------LYYT----DTYYGN-P---------
A0A7J4XCM0      DTIL-TPVGTMVVTPT-------------------LYYT----DTYYGK-P---------
I8Y597          DTIS-TPVGTMVVTPT-------------------LYYT----DTYYGK-P---------
A0A1Q6GBF5      DTVS-TPIGTMVVTPT-------------------LYYT----DVFYDK-P---------
I8YFZ3          DTVS-TPIGPMVITPT-------------------LYYT----DVFYGR-S---------
A0A7J4XFW0      DTVS-TPIGPMIITPT-------------------LYYT----DVFYGK-P---------
A0A1Q6GDH2      DTVS-TPIGPMVITPT-------------------LYYT----DAFYGK-P---------
U6RSB0          DTVS-TPIGPMVVTPT-------------------LYYT----DVFYGK-P---------
I9GXM2          DTVS-TPIGPMVITPT-------------------LYYT----DVFYGK-P---------
I9SIK1          DTVS-TPIGPMVITPT-------------------LYYT----DVFYGK-P---------
A0A7J4XIJ5      DTVS-TPIGPMVITPT-------------------LYYT----DVFYGK-P---------
I9TP59          DTVS-TPIGPMVITPT-------------------LYYT----DVFYGK-P---------
R5S343          DTVD-TPSGRAVVAPT-------------------GYYN----KNDLNR-T---------
A0A1M6K7I9      DTIK-TAIGNIVVTPT-------------------LYYT----NEYYGD-K---------
A0A5M6A8C8      DTIK-TALGNIVVTPT-------------------LYYT----NEYYGD-K---------
A0A7J4XCJ1      DTVS-TPVGTVVITPS-------------------LYYT----DAFYAK-P---------
A0A7J4XNQ7      DTVS-TPIGTVVVTPT-------------------LYYT----DTFYDN-P---------
A0A3R5ZMK1      DTVT-TPVGRVVVVPS-------------------LYYG----DKYFNT-V---------
A0A7K1HMX0      DTVT-TPVGRVVVVPS-------------------LYYG----DKYFNT-T---------
A0A1Y3ZIA4      DTVT-TPIGRVVVVPS-------------------LYYG----DKYFNT-T---------
K5Y1A4          DTVT-TPIGRVVVVPS-------------------LYYG----DKYFNT-T---------
A0A7K1HDC0      DTVT-TPVGRVVVVPS-------------------LYYG----DKYFNT-V---------
A0A3R6K8X4      DTVT-TPVGRVVVVPS-------------------LYYG----DKYFNT-V---------
A0A6N8D6C8      DTVT-TPVGRVVVVPS-------------------LYYG----DKYFNT-V---------
A0A3R6BKI7      DTVT-TPVGRVVVVPS-------------------LYYG----DKYFNT-V---------
A0A412M2W1      DTVT-TPVGRVVVVPS-------------------LYYG----DKYFNT-V---------
K5ZX55          DTVT-TPVGRVVVVPS-------------------LYYG----DKYFNT-V---------
A0A415BDM7      DTVT-TPVGRVVVVPS-------------------LYYG----DKYFNT-V---------
A0A1Q6I3T6      DTVT-TPVGRVVVVPS-------------------LYYG----DKYFNT-V---------
A0A414XX40      DTVT-TPVGRVVVVPS-------------------LYYG----DKYFNT-V---------
A7AEU7          DTVT-TPVGRVVVVPS-------------------LYYG----DKYFNT-V---------
A0A5F0U645      DTVS-TPIGKVVVTPS-------------------LYYT----DLYYGS-E---------
K5ZBN2          DTVS-TPIGKVVVTPS-------------------LYYT----DLYYGS-E---------
A0A0J6CKW3      DTVS-TPIGKVVVTPS-------------------LYYT----DLYYGS-E---------
A0A0F5IQM7      DTVS-TPIGKVVVTPS-------------------LYYT----DLYYGS-E---------
A0A496CDT3      DTVS-TPIGKVVVTPS-------------------LYYT----DLYYGS-E---------
A0A6G1ZKM3      DTVS-TPIGKVVVTPS-------------------LYYT----DLYYGS-E---------
S0GLB0          DTVS-TPIGKVVVTPS-------------------LYYT----DLYYGS-E---------
A0A3R6NLC1      DTVS-TPIGKVVVTPS-------------------LYYT----DLYYGS-E---------
A0A416WYC9      DTVS-TPIGKVVVTPS-------------------LYYT----DLYYGS-E---------
A0A0F5IT40      DTVS-TPVGKLVVTPT-------------------LYYA----DKYFGK-A---------
A0A496CX20      DTVS-TPVGKLVVTPT-------------------LYYA----DKYFGK-A---------
A0A5F0UBI0      DTVS-TPVGKLVVTPT-------------------LYYA----DKYFGK-A---------
A0A6G1ZHG0      DTVS-TPVGKLVVTPT-------------------LYYA----DKYFGK-A---------
S0GSI7          DTVS-TPVGKLVVTPT-------------------LYYA----DKYFGK-A---------
K5YB65          DTVS-TPVGKLVVTPT-------------------LYYA----DKYFGK-A---------
A0A0F5IWP9      DTVI-TSIGKLVVTPT-------------------LYYS----DKYFGK-P---------
A0A0F5IZT8      DTVI-TSIGKLVVTPT-------------------LYYS----DKYFGK-P---------
A0A417LKQ2      DTVT-TPVGKLVVTPT-------------------LYYS----DKYFGK-P---------
A0A416TME1      DTVA-TPAGKLVVTPT-------------------LYYS----DKYFGK-S---------
A0A416XPE8      DTVA-TPAGKLVVTPT-------------------LYYS----DKYFGK-S---------
A0A3B0C2S4      --VG-LAEKDTVPIQL-------------------PFNITFLENAQPIAYE---------
L8JI02          --KP-FRTHSLA--------------------------FTIRPNELYAPKE---------
A0A4Q5WS95      --AA-YPLDQLVATPY-------------------GS-LTFSPNPRYKAGS---------
A0A501VZX6      --DE-YSTGKWVQTPY-------------------GI-IRFSLNTRKEGIA---------
A0A399SH26      --KS-YPLNKSIRMPY-------------------GV-IKFIPNDHQSSQA---------
A0A501W1A9      --KP-YNLNTWAKTPY-------------------GE-LQFIENPQFSWAA---------
A0A0E3ZGV6      --KK-YSIGTWEKTPY-------------------GV-MLFSENEKQTSTT---------
A0A1I2N4S1      --KE-YPLSTWVVTPY-------------------GE-MLFEKNLLQNGSA---------
A0A2T5YE44      --KE-YPLSTWVVTPY-------------------GE-MLFEKNLLQNGSA---------
A0A1M5BA90      --KM-YSLNKWISTPF-------------------GV-ARITRNLNLKTAS---------
A0A512B879      --KS-YPLDQWVTTSF-------------------GT-AKFNINRYFKTAT---------
A0A559PPI3      --RI-YPLNEWVDSPF-------------------GK-IMFYPNKNKVQQA---------
A0A1T5CS78      --KE-YSLNKWFEISN-------------------GQTIMFVKNDNVNKKA---------
A0A0Q9Z8F1      --KE-YSLNEWFEFSA-------------------GQTIMFVKNDHVNKKA---------
A0A2N0U0M7      --KE-YSLNEWFEFSA-------------------GQTIMFVKNDNVNKNA---------
A0A1V9FHD0      --KA-YPMNTWCNTPY-------------------GV-LKFEKNARQTTDS---------
A0A4V4H170      --KI-YPIKKWVSTPW-------------------GE-LKFEHNDRQLSMA---------
A0A1V9F098      --KV-FPINQWVSTKY-------------------GE-LKFEKNERQTEAP---------
A0A4R2VU64      --KT-YPVNQWVTTPY-------------------GE-LKFVENQKQADTP---------
A0A4S8HY23      --NA-YPINTWCATPY-------------------GE-LKFENNNRQSDTV---------
A0A1V9F383      --RK-YPLRVWCNTRW-------------------GE-LKFIPNDRQTTAP---------
G8TRZ6          --KK-YPLREWCQTRW-------------------GV-VKFMPNERQTSKP---------
A0A4R5DL69      --TV-KANDQFTLTDK-------------------VHTWNQSFGDTFLLPTGEATLRKTI
A0A1M4YED3      --KS-YPMNKFVTTPF-------------------GVLKFTKNDKANA-AP---------
A0A2H3NSN0      --TT-DT--PFQLFA----------------------------------AV---------
A0A2P6C324      --TT-QGV-QFTLLA----------------------------------PV---------
A0A7C2DZI7      --AA-GTRDRFPILA----------------------------------PD---------
A0A1M6XHU0      --TA-GAKERFPILA----------------------------------PT---------
G2SF81          --TA-GAKDRFPILA----------------------------------PT---------
A0A5S9EYW1      --TA-GAKDRFPILA----------------------------------PT---------
D0MHQ9          --TA-GAKDRFPILA----------------------------------PA---------
A0A126PFG0      RPVS-DSIGTWQLTPV-------------------PAFAL---------PA---------
A0A3M1N7Z3      --VS-GKIGQWMALPG-------------------ASSAQLRIDCDPNCPS---------
                                                                            

A0A1T5MMH4      --------LFFIINSPDALLGYL-----ISGLSVE-PLN-------YAAQTIRIAFQDNN
A0A2W4R1L8      --------CFFVINSPEVLMNYL-----MRNLTVE-PIN-------FNANTIRISFKDHN
A0A2E5CV79      -----------------PYSDAI-----GEKFSQN-VMNGISIKRRNATGVLEITFQSVF
A0A2D4ZVH1      --------------SIDTVAMRY-----RELIRFS-EPD-------PEADIVSISFESPL
A0A0K8QSK7      --------YAIEFNTVQQTGKLY-----ASRLTVA-QSN-------RQTSILTLTVQDHN
A0A1V6CN82      --------FFFRFHTPDELINAY-----RSRMTVS-LRD-------WETSIVDIDLKDYH
A0A1M4XZ45      --------YKFRFNTKKSLVDKY-----RKSLEVT-LSG-------KETSILNLTLRDYN
A0A399D319      --------YKFRFNSKKALLKRY-----REQLDVT-LND-------KETSILNLTLRDFN
A0A1V5IPN7      ----------------------------LRRIQIS-SK--------RDTDILNLSFESTN
A0A1M6GR99      --------FAFKLSTIKQLVSHY-----EQKLEFN-IPD-------RLGTFIEISMKTNS
A6EBM4          --------YLFRFNTPEDFLDRI-----REGLRIG-EAG-------KNSNILSLQQTDVN
A0A7C5M4P4      --------FYFRINSHDALINYL-----EKNLRVE-PVN-------LDANIFRISFRDHN
A0A1M6TTV4      --------FYFIINSEDALINYF-----QKNIVVE-PIN-------FNANTIKIALSDPN
A0A4Q8RX32      --------YFFDVKGKTQLVGEL-----KEQLTIE-PAN-------VDGTVVNVLLKSNN
K0X1U5          --------FVAHVNGYDGEAEIL-----EKRLDID-LSD-------KKANGISLKIRESN
R5EXK3          --------FVAHVNGYDGEAEIL-----EKRLDID-LSD-------KKANCISLKIRESN
A0A401UAP7      --------YSFMLNDAQALRAYF-----TERLMVT-PKN-------YNANTIRISFKEFS
A0A1W2GF52      --------FYFVLNSKESLINYL-----ESHVTVE-PIN-------FNANTIKISLSDFN
A0A2G5L7B8      --------FYFVINSREALIDYF-----QQNIIVE-PIN-------FNANTIKIALADPN
A0A523GAC0      --------YSFKINSQNSLLLYL-----ENNITVE-PLN-------LTANTIRISFRDHN
L8JW09          --------FFFIINSKAAQIKYL-----GSNLTVE-PLN-------LNANTIRIAFKDYN
A0A364XUP5      --------FFFIINSRDVLMNYL-----IANLTVE-PLN-------FYAKTIRVAFKDNN
A0A1M5RLA9      --------YFFVLNTRDALLGYL-----LRSLTAE-PLN-------YNAHTLRISFKDNN
A0A385SFR9      --------YFFVLNTRDALLGYL-----LRNLTAE-PLN-------FNANTLRISFKDNN
A0A5M4A9J4      --------YRFRFNTHGALVDYF-----RHSLTVA-TVN-------KDATLLNLKMESAT
A0A5M4B1C7      --------YRFSFHNHNGLVNVF-----RKNLTIE-TVN-------KDATLLKLSMLSPT
A0A0D3LFR6      --------YYFIINSDQSLIDYL-----STNLTVT-ILN-------PNAKTIKISLTDYN
M7N6D4          --------YYFIINSDNALINYF-----RQNLSVS-ILN-------PSAKTIKISLSDHN
A0A4D7K1D4      --------YSFKINNKESQINFI-----QQNLKVE-AQS-------LAANTIKITFTDND
A0A5C7MX19      --------FYVRKYDKSFVIADV-----INKVSIE-PLD-------FKTKSFKISYKDKS
A0A1Q3ZMZ7      --------LYFIIQDPGLLTRQM-----MSSLKII-PLN-------PEAQTIEIKFESHN
A0A2D8JJW3      --------YTFKDGDIRAAVERL-----QESLNIN-HV--------KETSHLVITVESLD
A0A2W2AFF7      --------YRVDVQSTDEAVEDY-----RKALTAN-VVN-------KQVTLINLSLQSNI
R7PCR1          --------ISITRISVKDAAKIY-----VKRISAT-PVD-------KQSSLIQLVCQDVN
A0A2N5YXE2      --------YFFTINNTKTVLTNI-----ASNLEIQ-VLN-------ENAGTILITYNDYN
A0A1G9E2A9      --------YYFVINSRGALISYL-----AENLTVN-VVN-------ANASTIRIAFKDYT
A0A098LL25      --------YFFTMNSKEALVKNL-----MDNVSVS-ILN-------LDANTILLSYKNHN
A0A6J4H627      --------YYFVINSIDALNNYL-----ASNLRVD-VLN-------PSANIIGIFFKDKN
A0A6C0GJI1      --------YYFRINSAGALINYL-----ASNIRVD-VLN-------QMANSLGISFKDHS
A0A2T2YJE8      --------YYFIVNSNAAIRQYL-----TSNVAVN-IVN-------LDASTVEISFTDHN
A0A7L7LEW0      --------YFFTINSNSAIRQYL-----TSNVAVN-IVN-------LDASTVEISFTDHN
A0A127B287      --------FYFIVHSSGALKRYL-----NDNLSVA-VLN-------PEAKTISISFKEFN
A0A6P1P2P6      --------FYFIVHSNGALKRYL-----NENLTVA-VLN-------PEAKTISISFKEFN
A0A3M9N829      --------YYFIVHSSQRLKRYI-----DENLSTA-ILN-------PESKTIQISFKDFN
A0A0P0CSF9      --------YYFIVNSDQRLKGYI-----DTNLTTA-ILN-------PESKTIQIAFKDFN
A0A5M8QQB8      --------YYFVINSDQRLKGYI-----DGNLTTA-ILN-------PESKTIQISFKDFN
A0A3M9MNC3      --------YYFIVHSNQSLKGYI-----DNNLTTA-ILN-------PESKTIQISFKDFN
A0A5B6TAX2      --------YYFIVHSNQALKGYI-----DNNLTTA-ILN-------PESKTIQISFKDFN
A0A7L5A132      --------YYFVINDDGAMARYF-----DENLVVE-IVN-------PEANTIGISFKDNN
A0A512AYT3      --------YFFVINSDGALNSYF-----NQNLSVE-IVN-------PDAHTIGIFFTDFN
A0A5M6CYN7      --------YYFVINSDGALNAYF-----NQNLSVE-IVN-------PDAHTVGIFFTDFN
A0A369QP10      --------YYFTINSTGAIRQYL-----TSNVAVN-IVN-------LDASTVDISFTDHN
A0A7G7G7M4      --------YYFVINSTSAIRQYL-----TSNVAVN-IIN-------LDASTVEISFTDHN
A0A126PDF2      --------YHFTIQDQGTVNAYL-----EKNLAVD-ISS-------ADANTIQISFTDFN
A0A2Z3GKA1      --------YHFTVQDEGTVNAYL-----EKNLAVD-ISS-------ADANTIQISFTDFN
A0A502GZP7      --------YHFTIQDEGTVNGYL-----EKNLAVD-ISS-------ADANTIQISFTDFN
A0A519SBU8      --------YFFVILDDGALNAYL-----DRNLDVA-VVN-------PSANTIQISFTDNN
A0A4Q3JNZ3      --------YHFVVLSDGDISGYL-----NRNLDVT-VVN-------PSANTIQISFTDNN
A0A519Q9V3      --------YHFVILDDGAVSDYL-----DTNLDVA-VVN-------PSANTIQISFTDNN
A0A0M3RW20      --------YHFVVKDNGAINQYI-----DQNLTVE-IIN-------PEANTIGISFADHN
A0A495VFX4      --------YHFVVNDKSSINQYI-----DQNLIVE-IIN-------PEANTIGISFSDHN
A0A418R9X5      --------YSFIINDQNAINGYL-----NQNLSVD-IIN-------PDASTISISFTDYN
A0A428JSJ3      --------YSFVIQDGGTVNAYL-----TQNLAVD-IVN-------PDASTISISFADHN
A0A428KI59      --------YSFVINDDGTVNGYL-----NQNLAVE-IVN-------PDASTISIAFTDHN
W8F1I6          --------YSFVINDDGTVNGYL-----NQNLAVE-IVN-------PDASTISIAFTDHN
A0A246FQC0      --------YSFRINSNSALNEYF-----DTNLLVD-IVN-------LDANTISISFTDHN
A0A372E5P8      --------YSFVINSAGALGNYF-----NTNLLVD-IVN-------LDANTISISFTDHN
A0A1H3EMW1      --------YSFMINSPGALSNYF-----NTNLLVD-IVN-------VDANTISISFTDHN
A0A1H9ZSN3      --------YSFMVNSPGALSNYF-----NSNLLVD-IVN-------VDANTISISFTDHN
A0A1S9B3W0      --------YYFIIKDPGSINGYL-----GSNLGVS-VIN-------PDASTIGISFTDNN
A0A1W1VRL3      --------FYFVILDEGTLNTYL-----NTNLSVQ-IVN-------PDANTVQISFKDFN
A0A7G6YQJ9      --------YHFVINDNSAINNYL-----NANLSVA-IEN-------PDASTINISFTDNT
A0A1M6R305      --------YHFTINDEGTINSYL-----DRNLLVE-IVN-------PDANTIQISFQDFT
A0A7G7W8X3      --------FHFIINDEGAINSYL-----DRNLLVE-IVN-------PDANTIQISFQDFT
A0A4Z0PHK3      --------YHFVINDEGAVNNYL-----NTNLSVD-IVN-------PDANTIQIGFTDFN
A0A2M9B9H9      --------YHFVINDDGAVNNYL-----NTNLSVD-IVN-------PDANTIQIAFTDFN
A0A4Z0QCY9      --------YHFVINDDGAVNAYL-----NTNLSVD-IVN-------PDANTIQISFTDFN
A0A5N1J2M4      --------YYFTINSPAAVLNYI-----GSNLSAQ-VVN-------FDAQTIKISFTDHN
A0A519S476      --------YHFVILNDGAINAYL-----DKNLDVK-VIN-------PNANTIQISFTDNN
A0A4Q3JRW8      --------YHFVILNDGAVSGYL-----DRNLDVA-VVN-------PNANTIQISFTDNN
A0A519M923      --------YYFTILNDGAVNAYL-----DKNLDVA-VVN-------PSANTIQISFTDNN
A0A4Z0ENW1      --------YYFIILDDNTINSYL-----DRNLKAE-VLN-------PSASTLQISFLDNN
A0A519UDB4      --------YHFVLLEDNAITAYL-----DRNLTAE-VLN-------PSANTIQISFQDNN
A0A3S0QKV1      --------YYFTINDAAAINGYL-----SANLTVS-VIN-------PEASTIGISFSDNT
A0A328BL48      --------FFFVINTPEAINGYL-----AQNLTVS-VIN-------PDANTIGISFTDYN
A0A5R8WLY4      --------YFFVVNTPEAINSYL-----AQNLAVS-IIN-------PDANTIGISFTDYT
A0A1I5WSL8      --------YHFTILSDGAVNQYL-----DKNLAVE-IVN-------PEANTIQISFNDFN
A0A0U3JVM7      --------YHFTILDDRTVNEYL-----DKNLTVE-IVN-------PEASTIQISFNDFN
A0A1G1SSV2      --------YHFTIQDDRSVNAYL-----DKNLTVE-IVN-------PEANTIQIAFNDFN
A0A1G1SXV7      --------YHFTIQDDYTVNAYL-----DKNLTVE-IIN-------PEASTIQIAFNDFN
A0A6G8CBJ6      --------FYFIILDDGSVNGYL-----NKNISVE-IVN-------PEAHTVEISFADFN
A0A0W8EDI5      --------YYFIIHDNSSVWSYI-----DQGLTVE-IIN-------PEANTIAISFKDHN
A0A3B7RBP8      --------YYFVIHDDATVWGYI-----GENLTVE-IIN-------PEANTIGISFKDHN
A0A3R9P8H7      --------YFFTINSNGALNAYF-----NKNLLVD-IVN-------VDANTISISFTDHN
A0A238WIA7      --------LFFIIHDEGTINGYL-----SQNLQVQ-VVN-------PDANTISIGFTDYN
A0A212UCJ7      --------FYFVIRDEGFINQYL-----SSNLQVQ-IIN-------PDANTISISFTDNN
A0A4Z0MQE1      --------FYFIIRDEGFINGYL-----SSNLQAQ-IVN-------PDANTISIAFTDHN
A0A4Z0PCF4      --------FYFIIRDDAFINGYL-----SSNLQVQ-VVN-------PDANTISISFTDHN
A0A6M6BED0      --------FYFIIRDDGFINGYL-----SSNLQVQ-VVN-------PDANTISISFTDHN
A0A5D6VDG1      --------FQFVIRDDASINRYF-----DENLTVE-IVN-------PEASTISISFKDHN
A0A243WHR7      --------YFFVINDDGTISNYL-----NKGLNVQ-VVN-------PDANTIQISFTDFN
A0A5B8A0P6      --------YYFIINDEGTLNSYF-----EKNISVD-IIN-------PNANTIQISFQDFN
A0A076HRT9      --------YFFTINDEAAINAYL-----DRNLLVE-IVN-------PDANTIQISFQDFS
A0A4Z0PVM7      --------YHFVINDDGAVNAYL-----NTNLSVD-IVN-------PDANTIQISFTDFN
A0A1M6DHW8      --------YHFVINDEGTLNAYL-----SSNLSVD-IIN-------ADANTIQIAFTDFN
A0A4Q5LC61      --------YHFVINDDGGLNAYL-----SNNLSVE-IVN-------ADANTIQIAFTDFN
K0XJ09          --------VEVSRIDLNTAANIY-----HSFISTS-LAG-------ERTTLVQINCVDSN
R5EUZ0          --------VEVSRIDLNTAANIY-----HSFISTS-LAG-------ERTTLVQINCVDSN
W0EQS0          --------VEVSRISLDAASGMY-----HA--SAS-LAG-------ERTTLVQINCVDSN
A0A1Y3WE15      --------IEVSRMDLNTAANIY-----HSLISAA-LAG-------ERTTLVQINCIDSN
A0A1Y4GUK3      --------VEVSRMDLNTAADIY-----HSLISAA-LAG-------ERTTLVQINCVDSN
A0A2U1FKU2      --------VYVVKEDMRKVVERY-----NQELQVA-LAD-------KKSTIVRLSLNNTD
A0A0A2F954      --------LYVKKENTRKVAERY-----NQDLQVS-LAD-------KKATIVNLSLKNED
A0A0A2FW91      --------LYVTKENTRKVVERY-----NQDLQVS-LAD-------KKATIVNLSLKNED
A0A2D2N2N1      --------LYVTKENTRKVVERY-----NQDLQVS-LAD-------KKATIVNLSLKNED
Q7MWZ2          --------LYVTKENTRKVVERY-----NQDLQVS-LAD-------KKATIVNLSLKNED
T2NDT6          --------LYVTKENTRKVVERY-----NQDLQVS-LAD-------KKATIVNLSLKNED
W1R7P9          --------LYVTKENTRKVVERY-----NQDLQVS-LAD-------KKATIVNLSLKNED
A0A1R4AFZ0      --------LYVTKENTRKVVERY-----NQDLQVS-LAD-------KKATIVNLSLKNED
A0A1R4DVZ7      --------LYVTKENTRKVVERY-----NQDLQVS-LAD-------KKATIVNLSLKNED
A0A7C0WKI7      --------FYVEKAKGPVNYRVLGVARIRRNLSIS-PV--------RDTDIIKIKMKAPS
A0A2A8CVM9      ---------------TNEVMSHM-----MQRVSFV-PM--------QSQSMIQFTVESGV
A0A5M4B212      --------YRIAFHSLDQLTNEY-----MEKLTVA-PVS-------KEGTMIKLSTTCEN
A0A3D1KEX9      --------IHVTRIKKEDAITKF-----NKAVTAS-EVN-------KEASLISLTCKDNN
A0A358Y7S2      --------VYFEFIQREKLIEEI-----KEKLTVI-AVN-------PEAKTIEITYENSN
A0A1X7J248      --------LTFTISTPESLMSYV-----ESNLSVA-PEN-------LNANTIKITFEDYN
E4TQD2          --------LFFTISTPESLINYV-----ESNLSVA-PEN-------LNANTIKITFEDYN
A0A2J6HHN3      --------FIVVFNNIDNLVYKY-----SRKINIS-VVS-------DAAKTIRISLRDIN
A0A1Y3WMT8      --------FVAHINGYDTQTELL-----EKRLEID-LSD-------KKANGISLKIKDSN
A0A1Y4GQU1      --------FVAHINGYDVQTELL-----SKRLEID-LSD-------KKANGISLKIEDSN
A0A6A0R272      --------YVIKVVDKVKLAQEF-----AKQLTVT-QVE-------EKVALLSIVYQSSN
A0A1V5W8T5      --------FYFRILDDKGAFAEH-----ITGLDVS-ILN-------FDAKTIRIYYTSNN
A0A2T8HKA9      --------ITVTKIPRETMVSYF-----LSRMKIV-QIE-------DDAGLLQLTLEDHS
A0A2I0QZ80      --------LYFVFNDLNTVSSRF-----HDDLSIR-PID-------QKAKTVEISYRSHS
A0A3E1F1A3      --------YYIVLNEDKVLANNL-----HSGLSVS-LVD-------NNAKTVEVAYRSSS
A0A2U2XBJ3      --------LYFELNDKSTMSRRL-----RPGLTVT-PVD-------ANARTVQISFRSHS
A0A4Q4KU94      --------LYFVLNEKKSIARQL-----RSGLTVT-PVD-------PNARTVELSFRSHS
A0A3B8INU3      --------MYFVINSNGALLNYI-----GAHLAVT-PLN-------LNANTIRVSFQEYN
A0A2W1NDY9      --------LFFKINNYKTLTNVL-----IHSLIVN-IEN-------ADANTIKVSFRSNN
A0A5C8AQR5      --------LYFVFNERKALIDRL-----LPGLIIV-PIN-------LEAKTIEISYQAYN
A0A1G0CI31      --------LYFTFNNKKTLVTRL-----LPNLEIT-PAD-------IEAKTILIRYQGYN
A0A556N0M0      --------LYFTFNNQKTLASRL-----ITNLEVN-PID-------INAKTIELRYSGNN
F2IKD6          --------LYFTFNNQKNLAARL-----ISNLEVN-PVD-------ANAKTIELRYTGNN
A0A1I7BM74      --------LYFVFNNTQSLMARL-----HGDLTIA-PLD-------VKAKSILISYRSNN
A0A2G2FJ17      --------LYFHFNSEDNLASKY-----LSGLAVS-PVD-------IQAKTIEISYRNTN
A0A2E3R1D0      -------------LTVQEVAFRL----QRGSIKST-MET-------GGADAIRVNAVSTD
A0A2T2USC0      --------------TVSEIAGDLVSQGGKATMSAS-AAGGNLAGQYESADAINISVKGVS
A0A2T2V0F3      --------------TVGEIAGDLVAQGGKATMSAA-AAGENLGNQYESADAIRISVRGVS
A0A2T2S682      --------------SRAVLAGLL-----RRRVRAQ-SAG-------REVDAIRITAQGPV
D5H561          --------VDTTQLSPASVAPAL-----AGRVRFS-RAG-------AETNVIQIVAQDET
A0A2H3NWA9      --------------SAQQLAGRL-----MGRVQAS-PGG-------EEIDAIRLSATSTD
A0A2A8CVB6      --------------SQNQIAHRV-----RGSIRAG-TYG-------EQFDAIRIVATGRD
A0A2P6C1S6      --------------SISAVAGQV-----QNMISAQ-PSG-------EETDALYISASSHH
A0A2T2UTM4      --------------STAEVANQV-----KGMISAQ-PSG-------EKTDALYISAKSHH
A0A414ZBF2      --------VYVKKGNRKNVSDNY-----NANLQVE-VVD-------K-SSLINLTIEDEN
A0A1Q3Q573      --------YFVKFNDKQTIINDI-----NSKITIE-PIE-------AGNNTLAITYADQN
A0A662BAY3      --------YKFRFNIRSDLLKQY-----KNDLSVN-MLS-------QETSIIELSLKTLN
A0A4U3L369      --------FFFQITSYDNATAAY-----QKNLVIT-VPD-------DKANVIDLSMTSKV
A0A357YNR3      --------VEIDIYRPADVANMY-----LGNLTVE-LTS-------KTSSVADVSLICSN
A0A5E8AX52      --------YYFTINSESALISFF-----QSNVTVQ-PLN-------FSAKTIKISLRDFN
F4KK08          --------LKVQKDNFNAVVRNY-----MKALQVS-LQQ-------KDASVIKLTIQAGN
A0A6B5PK86      --------IYFTFNSTQSLSERF-----IRNLYVL-PID-------ERARTVSIAFKGDN
A0A2G2F510      --------LYFTFNSIESVTERL-----RKGLKVV-PVE-------VGAKTISISYRGYT
A0A316JZ08      --------LYFTFNSRQGLVERL-----HGGLDVI-PMD-------PNARTIQVSFKGHN
A0A496LCF9      --------VNFQFRTRQSLISEF-----FAKLQIR-LIE-------N-TSVLDVSVNSDN
A0A5P2G2A9      --------YTFVINPIKSEVQGI-----LQNLSAE-IPN-------KQVSAINLTLPVEI
A0A3C0ZQC7      ------------LLTASEIAKRL-----MTAVEFE-PIR-------D-SDVIKVTARSVQ
A0A3N2N6F7      --------IRFSYWPMPTAISKY-----QAKLTET-LSN-------EDASVIDFAIKDDN
A0A419VXB7      --------YYFEFNDLEKLTLSY-----LRQLQVS-TVN-------KDADVISLQLTGQN
A0A0B0BTJ4      --------LRIYVRPVRNAAEAY-----AKALHVA-QAQ-------KFSNIVNVSISDHN
A0A3B9CNN6      --------LRIYVRPVRNAAEAY-----AKALHVA-QAQ-------KFSNIVNVSISDHN
R5X290          --------LRIYVRPVRNAAEAY-----AKALHVA-QAQ-------KFSNIVNVSISDHN
A0A1Q6E6I7      --------LRIYVRPVRNAAEAY-----AKALHVA-QAQ-------KFSNIVNVSISDHN
C3J7R8          --------LEVEKNTRERSIRSF-----SHIFNVS-SAS-------KQGSIITLTMQHQN
A0A1G8BVM8      --------IIISKINKMNLAKSL-----VAKFNIE-SVD-------KQSSLVQLSIIDTH
A0A1I1FXP9      --------YFFTINSRNKLLMQM-----FFNTSAY-ILN-------QSANTIRIIIKDHH
A0A4P7VVU7      --------FRYSISDA---IEAY-----KARLSEN-LAD-------DNSTVIDFTIKDVS
A0A2V1ILM4      --------FRYSISDA---IEAY-----KARLSEN-LAD-------DNSTVIDFTFKDVS
A0A3N2L0E8      --------FRYSISDA---IEAY-----KARLSEN-LAD-------DNSTVIDFTIKDVS
A0A3N2LFC5      --------FRYSISDA---IEAY-----KARLSEN-LAD-------DNSTVIDFTIKDVS
A0A7K3KWJ8      --------FRYSISDA---IEAY-----KARLSEN-LAD-------DNSTVIDFTIKDVS
A0A3N4H5N3      --------FVLNFVNPVLITEQF-----SKSLTLE-QPS-------IKSSTIYLTMLNTS
A0A2P8EAX2      --------FVVRLENPIVKTERY-----AKALNFE-QSS-------VKSSTLFIRLLDSS
A0A4V2F6N9      --------FVVILENPIVKTERY-----AKALKFE-QSS-------VKSSTLFIRLLDSS
A0A3B9FXJ0      --------YELIIRNKLTVAKAM-----EKRIRID-AEN-------TYGGKIVIEYTDVN
R5GSU5          --------F--------TATEMY-----RSKLSCG-EID-------KESSLIVLTFQDTN
A0A2A3UE91      --------FYFIVHDVDAVTAQL-----QAKVELK-LLN-------ELAKTILIRVKDVN
A0A0A2G557      --------IEIIVNSKEKTVADL-----SKKLTIS-QSG-------KQSSVIDLRFKDEN
A0A2N2WFW8      --------FLIVFNSVKDLANSY-----SQKINIA-VLN-------DVAKTIRISIRDMN
A0A1F3IU95      --------FIVQFNNLTDIAAQY-----SQQVNIA-VIN-------DVAKTIRISLKDYN
A0A3D0VUF6      --------FIVQFNNLTDIAAQY-----SQQVNIA-VIN-------DVAKTIRISLKDYN
A0A1T4PT95      --------IKITISSREEIISDL-----AKRLTIA-QSS-------KGSSIIDLRFRDEN
A0A6I6JYY3      --------FKFVFNKKSALVKKY-----TKALTVN-LAD-------KETSIVGLTLRDLN
A0A2A4PYG9      --------YFFIVNNTAAEIDKY-----YHLIDVR-ILN-------QAAKTIQVTVRENN
A0A1F3K695      --------FYFIIKNPNNVYLDH-----FSRLEVA-VQN-------QLAQTIEIAFSDNN
A0A353KZR1      --------FYFIIKNPNNVYLDH-----FSRLEVA-VQN-------QLAQTIEIAFSDNN
A0A2N2WYB5      --------YYFIINNPQTLVDLH-----LQTLQVA-LQN-------RSAQTIQITYSGYN
A0A1F3K4G0      --------FYFVISNPKNIVENH-----LQNLDIF-LLN-------RSAQTIQISYSGYN
A0A356H8Y3      --------FYFVISNPKNIVENH-----LQNLDIF-LLN-------RSAQTIQISYSGYN
A0A351HSA6      --------FYFVISNPKNIVENH-----LQNLDIF-LLN-------RSAQTIQISYSGYN
A0A1F3Q014      --------YYFTLNDLDAIVNES-----YPKVEVK-LLN-------DQAKTILVSYKGFN
A0A2D5KD44      --------YHFVLNNPQSLVKGI-----LSRLEIV-ILN-------PNAKTLQVGISDNN
A0A6N9NIX1      --------LFFKINNKEAIANAF-----AQKLTVT-VLN-------QAAKTIQISFIDEN
A0A2A4YXP3      --------LYFRINSYEEMTNAW-----DYKLSVF-PLN-------NAAKTINISFEDHN
A0A1F3R158      --------LFFTINDIESLTNSY-----ISSLNVF-PLN-------PLAKTISLSFQDNN
A0A2M8ADX2      --------IFFTINDIENLTNNY-----ISKLNVF-PLN-------PMAKTISISFQDNN
A0A1J5B2H0      --------YYFIINNPSTNLSNY-----VRPLNIS-IIN-------EAAKTVSITFRDEN
A0A1V5N756      --------YFFVLKKPSDILSSY-----IPNLSVF-VVN-------ENSQSIMVMYSDRN
A0A651GU15      --------LYFVINNPNSLVSRF-----RSNMEVR-VMN-------NIAQTIQISCKNHN
A0A3Q9FR88      --------YSFQFNSKSSITNFI-----RKNISVL-IFD-------PKANTIQISFKAAN
A0A553GEX3      --------YSFQFNSKSSITKFI-----KKNISVL-IFD-------PKANTIQISFKAAN
A0A150ADJ9      --------FSFVVNSRPSLVKFL-----KKNISVQ-VFN-------PKANTIQISFTAGN
A0A1B1FWQ4      --------YSFTFNSKASIIGFL-----KRNLSVM-IYD-------PKAKTIQISFTARN
A0A1S1Z228      --------YSFTFNSKSRIIGFL-----KANLSVM-IYD-------PRAKTIQISFTARN
A1ZKR2          --------FYFKINSRQALISYL-----NNNLQVG-ILN-------KSARIIGINFRDHH
A0A1Q3GX01      --------FYFKLNSRQTLIDYL-----NKNLQVG-ILN-------RSARIIGVNFRDYN
A0A349DQI4      --------FYFKLNSRESLIRYL-----NTNLQVG-ILN-------RSARIIGVNFRDFN
A0A4P5TMD1      --------YYFVINSRDNLSKDI-----RTKIRIE-LYP-------P---TIQFSLQDPV
A0A2N3IIZ0      --------IYFVLNSKGKSMNYL-----ANNLEAF-ILN-------PQAKIIAISFKDHN
A0A7K3WUF2      --------FYFKLNRAGTLASSY-----IRQMGIK-ILN-------STAQTIEISLKDNN
A0A1F3SJM1      --------LYFIFNSVQSVAERM-----RNGVTIT-PID-------VAAKTISISFRGHN
A0A2G2EB96      --------LFFIFNGREQLSNRL-----IQDLSVS-SID-------PYAKTISISFRGYN
A0A2G6PRA9      --------LFFIFNGREQLSNRL-----IKDLSVA-AID-------PNAKTISISFRGHN
A0A497D5Z2      --------YFFRFRTNESLADQY-----KKNLTIE-NVP-------KESSILEISLLEEN
A0A662B170      --------YFFRFRTNESLADQY-----KKNLTIE-NVP-------KESSILEISLLEEN
A0A2A5FYT6      --------YFFIINDVNQITEQY-----HHRLRVE-LLN-------AAAKTIKISFTDHS
A0A2E6SYP1      --------FLFMINNEKQIVNHF-----SKGLDVS-IFN-------VRAKTIKIGYSGDH
A0A2E5RLE8      --------FLVKIVDKNQLISKY-----SKGLQVN-IEN-------TRANTIKISYTGNH
A0A2E7TQF6      --------FLVKIVDKNQLISKY-----SKGLQVN-IEN-------TRANTIKISYTGNH
A0A2E6GVY9      --------FLVKIVDKSQLINNY-----SKGLSVN-IEN-------SRANTIKISYTGNH
A0A350JJ90      --------KYFILNSAPTLVQKL-----SKNYSVR-IQS-------AAAKTVQIVVTDNN
A0A3M1CDV2      --------TFIIIQSKDAVASYL-----QKKLEVK-PLN-------DLAQTISISIKDVN
A0A6C1QGZ7      --------FFFVLNNPETLASVY-----SRDIKIN-VLN-------PAAKTIQINYQGTN
A0A4P5U6G4      --------FYFVINNRQTVAKRI-----RDVIRI----N-------PYTPSILISFQDKN
A0A2E2TFD1      --------VFFTLNNNASIVNRY-----SKSLDLK-VLS-------QSAKSISISFTDPN
A0A2E4ELE6      --------FYFRLNSDAEIISKY-----SKSLKVK-LLN-------QAANSVEISFSDYN
A0A522EYA6      --------QYFVVNNIDALANEY-----FSRLSVK-LLS-------DAAKTIQISFQDNN
A0A2E3XZI5      --------FYFIIPTIKQIKKEL-----LGGLEVN-IID-------RSAHTINIIHKHSN
A0A6I7QXV0      --------YFFILENREQLISRV-----SRNIQVS-AIN-------PRTKTLQIKYSDNH
A0A2M7NLQ9      --------YFFTLNSPEYQIAYI-----ASSLRAN-VLN-------PKAYTIQVSFTDNN
I4AFR0          --------YFFTLNSHEYQINYI-----ASSIKAN-VVN-------PKAYTIQISFTDNN
A0A2N2Y3E5      --------LFFIVNNPETQLNKI-----IQNLVVG-VLN-------FEAQTIQITYTDFN
A0A2D9D7T6      --------LYFVFNKKYDVMRSL-----KKNLTVS-AID-------PSAKTIQITFDHYN
A0A1F3PPL5      --------FFFILKNPTTLLNEH-----ISKLEIK-LQN-------PEANTIEISYVDNN
A0A357QK06      --------FFFILKNPTTLLNEH-----ISKLEIK-LQN-------PEANTIEISYVDNN
A0A662AEA4      --------YSFIINNPDNIYLKH-----IDEIEIR-LLN-------KYANTIEISCTSNN
A0A0S2HYK8      --------YYFVIYNDEQIFTEH-----SKKLNIK-LLS-------SSSNSIEISYQSHN
A0A2N5ZWN6      --------YYFIISNMDQIYSEH-----SAKLTIR-LLN-------SSSNSIEITYESNN
A0A2E0FJ09      --------FYFLYSDLEKLASEF-----SAMLEVS-IAN-------SNANTIGLSFTHPN
A0A1F3FZ62      --------YYFIINNPDLIVNEH-----INQIDVS-ILN-------VLAQTVLINVTNQN
A0A1F3K211      --------YYFIINNPDLIVNEH-----INQIDVS-ILN-------VLAQTVLINVTNQN
A0A1V6I2U9      --------YFFTINNPNTTLKNL-----SKRLNVQ-ILN-------ETAGTIKITYQDFN
A0A2H0B957      --------YYFTLNDSETVYQKY-----SSRLEVS-LLN-------QEANTISISITDNN
A0A1F3CFW6      --------YYFIINDTESVYKKY-----SSQLEVS-LLN-------QEANTIQISFKDNN
A0A2M7E2T8      --------YYFIINDTESVYKKY-----SSQLEVS-LLN-------QEANTIQISFKDNN
A0A2M7NC69      --------YYFIINDTESVYKKY-----SSQLEVS-LLN-------QEANTIQISFKDNN
A0A1F3KLL5      --------FYFIINNPTYLLQAY-----KANLLVE-VLS-------DEAKTISIKYSDYN
A0A359D1M1      --------FYFIINNPTYLLQAY-----KANLLVE-VLS-------DEAKTISIKYSDYN
A0A0F2NS19      --------MFFAINDLEALTNKY-----IQQLGVF-PLN-------PSAKTISISFNDNN
A0A2A5H8X6      --------MFFAINDLEALTNKY-----IQQLGVF-PLN-------PSAKTISISFNDNN
A0A2H0GAU8      --------MLFVINNIDDLTSRY-----ISQLNIF-PLN-------PSAKTINISFQDNN
A0A2M8FTK1      --------MLFVINNIDDLTSRY-----ISQLNIF-PLN-------PSAKTINISFQDNN
A0A2A5B3B0      --------LFFKINDYDKLTFAY-----IGKLAVF-PLN-------NAAKTINISFQDNN
A0A5C6RXM7      --------IYFKLNDNASLANNY-----ISKLSVF-PIN-------ISAKTINISFKDYN
A0A1F3C1M2      --------YFFIINNPINIIKDN-----LLKLKVN-ILN-------PSAQTVDISFTDNN
A0A1F3DS87      --------YFFIIKNPANIIKEN-----LDKLKIS-ILN-------PSAQTVDISFIDNN
A0A6A0R6K9      --------YFFIINDLQTLVKDV-----LSRLKIF-VVN-------INAKTVSIAYDDIN
A0A2E7CT70      --------YFFKIPFFQEKRNEI-----INDLEIS-IID-------PAANTIGITYSHTN
A0A2D5V560      --------LFFRIPSXNELKNSI-----LNGLTIN-IKN-------QSAHSXQISHQHTN
A0A2D7K5A8      --------LFFKIPTKKEVINIL-----KNSLTIT-IQD-------QSAHSIKISHLHTN
A0A2E1XQ82      --------LLFKIPNKKEVINII-----KNSLTIT-IQD-------QSAHSIKISHQHTN
A0A5C8A5B4      ------TKYHFEIYSLKDLVRVY-----RAMTMAV-PLS-------DESNVVNLSIQVEV
A0A7C1LGX3      --------YEVVISPIKNTVLGL-----INKMEIQ-TTT-------KDSDVLAISLSGNY
A0A4Y9ITE2      ------LNITIVVNNYNQATENL-----QDDIKCS-IPN-------KKARVITISLNSTN
A0A5M8NYX7      ------YPIVVVVRHPK-----Y-----IPYIQVN-PLN-------KMTTVVDVTTKTEV
A0A0E3V905      ------NPYSIQVTKRATSVKNY-----LTNLHAI-PTG-------KGSTVILLSLEDAV
A0A553ETH6      ------SDYFFTINSRAQLISYF-----ERNLVVE-PLN-------LNANTIKIALQDFN
A0A640Q161      ------TEEQLLAAKKRKATSLL-----MNALTVE-MV--------DNTQLMRITVTTES
A0A640QU49      ------TPEEILAAKKRKATSLL-----MKALNIE-MV--------DNTQVMRITVTTES
A0A1Q3PII2      ------YLYSFKISTEESVLDLY-----TRVLNIY-APN-------KTASLVNLSWQDVL
A0A351BXT2      --------EDVTALISVSSLADI-----LSQIVKI-DQK-------RGLDVVDIIVESPA
A0A2K8Z965      ------KKMIVQVSKQTSAAKSY-----LSNLHVI-PTG-------KGSTVILISLEDGV
A0A418M8U8      ------NQVLVQAMKRPAAVNGY-----LRTLQAE-PTS-------KASTVVVLTLEDAV
I2GTA4          ------NQVLVQAMKRPAAVNGY-----LKTLQAE-PTS-------KASTVVVLTLEDAV
A0A2K8ZAJ2      ------KPIFATVSLHNDAVEGY-----LGNLKIG-STT-------MLSTVLVMNLQEAV
A0A368JPA3      ------EPLVVQVMSPAQTIRYY-----QSKLTVA-PSG-------KESTVLVLTIEDAV
A0A5N1JI29      ------EPLVVQVMPQAQTIRYY-----QSKLTVA-PSG-------KESTVLVLTIEDAV
A0A7K0EGC9      ------DPLVVQVMTDPETIRYY-----LSKLKVE-PSS-------KSSTVLVLSIEDAV
A0A3P1BT12      ------EPLIVQVMEHPQAIRYY-----LSKLNVE-PSS-------KTSTVLVLTIEDAV
A0A3P1CI15      ------EPILVQVMTDPQAIRYY-----LSKLTVE-PSS-------STSSVLVLTIEDAV
A0A4R8CUK1      ------EPVSVQVMPDLEAIEYY-----LGKLQVE-PSS-------DASTVLLLTFEDAV
A0A3D0MYJ7      ----------------------------------------------KNLNIIDISVKSTS
A0A662AH13      ----------------------------------------------RGLDIVTISYESHS
A0A5C7QA01      ------GLYNIRKQSLPNAIKSL-----SANYAVA-ERG-------KLTGVLGLNYQGAD
A0A3D3LS70      ----------------------------------------------RGLDIISIDVDSPS
A0A1G1TM36      ------GEVRIRTSSPEAVVQAY-----QKLLDIE-LIN-------KVAPAIRLQIKDQV
A0A1G7ZF38      ------YQYSFKISATETILDHY-----DRVLRIQ-APN-------KAASLVNLSIQDVL
C6VS52          ------YQYSFRTLAKETVVDHY-----ARTLSIQ-APN-------KIASMVNLSIQDVL
A0A2A4G4B1      --------YQIYCTPISKTVNQI-----INNLQIN-PLS-------DKTHGLTLTMEVEQ
A0A0P7X1V8      ---------------------RL-----YGNLTFT-RAD-------RNSNLLRVSYRSPS
A0A6P1P355      --------LFFAIMHPKKVTDNI-----ISNLSIQ-AEN-------KLSTAVNLNFTDAS
A0A5C8KAD6      --------LYFTLQDPRKVTDQL-----VAKLTIV-PSG-------KLSTVVDIRLRDEV
A0A5N1J695      --------LYFSLIPTRQVTDGL-----LANLKIE-PAN-------KLSTVINITLEDPV
A0A3N2M1H3      --------LKVVKKPMQTTVENY-----GEKLNGD-LVN-------QDAEIIGLTIRDVS
A0A4S2G8T2      --------LKVVKKPMQTTVENY-----GEKLNGD-LVN-------QDAEIIGLTIRDVS
A0A212K7W5      --------ILFVKSNLRSIVNHY-----TNALNVG-LSN-------EDATIIDISLNDVS
F5IU11          --------ILFTKFNLRGIVNNY-----TNALNVG-LSN-------ENATIINISLNDVS
A0A7C1QWC7      --------TFFRLHHVDNITSQY-----LKRLVVE-PVS-------TRSTLINVFFQGEN
A0A352Z1R7      --------FRLKLLPLQNIAVSL-----KGGFKAT-EVG-------NRTNIVRISYSSTD
A0A0A2F501      --------IYVSYQNLYNVQELY-----SSGLKAS-INN-------DKASIIDIAYQDRS
R5B7P0          --------VNVRKSGQRGVTQSY-----LNRLQVN-LAD-------KNADVISLSIKDVS
R5B0L5          --------IYVTKMPLQTAASIF-----SGRLTVA-LKE-------KLGNTINLSVMDYS
A0A6I1TEC0      --------LYVSHTDLYSMTNRI-----LGSLTVG-LNE-------EKTTIVNLTYTDVQ
A0A3R5XWG1      --------LYVSHTDLYSMTNRI-----LGSLTVG-LNE-------EKTTIVNLTYTDVQ
A0A5P0Y910      --------LYVSHTDLYSMTNRI-----LGSLTVG-LNE-------EKTTIVNLTYTDVQ
A0A414YFM3      --------LYVSHTDLYSMTNRI-----LGSLTVG-LNE-------EKTTIVNLTYTDVQ
A0A6A7UIA7      --------LYVSHTDLYSMTNRI-----LGSLTVG-LNE-------EKTTIVNLTYTDVQ
A0A6A7VPS3      --------LYVSHTDLYSMTNRI-----LGSLTVG-LNE-------EKTTIVNLTYTDVQ
A0A374THP7      --------LYVSRSNIYAMTDRI-----KGSLAAS-LSE-------EKSTVIDLTYKDVL
A0A6G1VND1      --------LYVSRSNIYAMTDRI-----KGSLAAS-LSE-------EKSTVIDLTYKDVL
A0A0A2EVS5      --------IHVSRSNLSTTMAEC-----QKRLQVG-LIN-------DKTSILELSYTDVS
A0A1T4NAJ7      --------IHVSRSNLSTTMAEC-----QKRLQVG-LIN-------DKTSILELSYTDVS
A0A255T941      --------ITYSKQNIDDLADAL-----STKLVAE-LDN-------KEGTVITLTTEATS
A0A4P7VSV0      --------LEVVKAPVSATAGGY-----GSRMVIA-MSG-------DKSSVINLTVTDQS
A0A7J0AX49      --------LEVVKAPVSATAGGY-----GSRMVIA-MSG-------DKSSVINLTVTDQS
A0A3N2KCL3      --------LEVVKAPVSATAGGY-----GSRMVIA-MSG-------DKSSVINLTVTDQS
A0A2V1IJY1      --------LNVVKAPVSATAGGY-----ESRMVIA-MSG-------DKSSVINLTVTDQS
A0A4P7VXK7      --------LNVVKAPVSATAGGY-----ESRMVIA-MSG-------DKSSVINLTVTDQS
A0A1Y4CHN5      --------VYVSRSTIYGAVQSY-----SQRLSVG-LAN-------EDATIINLSITDVC
A0A1M6I2S6      --------IRYNKGSVRAVTDYY-----ATALRAD-LGN-------EDATIINLSIDDVS
A0A1Y3V692      --------IRYNKGSVRAVTDYY-----ATALRAD-LGN-------EDATIINLSIDDVS
F3PXM2          --------IHYGKQSVQAVTDYY-----TGALRAE-LGN-------EDATIINLSIDDSS
A0A174AHH7      --------IQYSKEPADAVADSY-----TQKLRAD-LGN-------ENATIINLSIDDAS
A0A174JCE8      --------IQYSKEPADAVADSY-----TQKLRAD-LGN-------ENATIINLSIDDAS
A0A3E4JMC4      --------IQYSKEPADAVADSY-----TQKLRAD-LGN-------ENATIINLSIDDAS
A0A412SND6      --------IQYSKEPADAVADSY-----TQKLRAD-LGN-------ENATIINLSIDDAS
A0A414IEQ9      --------IQYSKEPADAVADSY-----TQKLRAD-LGN-------ENATIINLSIDDAS
A0A7K0HNT3      --------IQYSKEPADAVADSY-----TQKLRAD-LGN-------ENATIINLSIDDAS
A0A0M1W8D8      --------IQYSKEPADAVADSY-----TQKLRAD-LGN-------ENATIINLSIDDAS
A0A3R6GKX5      --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A7V4S1          --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
B0NU19          --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
D4V601          --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A0A4Q0U3M9      --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A0A7J5G2G2      --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A0A7J5HH13      --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A0A397WLT5      --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A0A6A2J529      --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A0A6N8DDD8      --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A0A015XH67      --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A0A078RZN2      --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A0A6M4L7F4      --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A6L0K5          --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A7ACT5          --------IQYSKEPADMVADSY-----TQKLWAE-LGN-------EDATIINLSIDDAS
A6KY94          --------IRYSKESADMMADSY-----TQKLRAE-LGN-------EDATIINLSIDDAS
A0A173UQR8      --------IRYSKESADMMADSY-----TQKLRAE-LGN-------EDATIINLSIDDAS
A0A3R6HK75      --------IRYSKESADMMADSY-----TQKLRAE-LGN-------EDATIINLSIDDAS
A0A412B7D1      --------IRYSKESADMMADSY-----TQKLRAE-LGN-------EDATIINLSIDDAS
A0A412VNY9      --------IRYSKESADMMADSY-----TQKLRAE-LGN-------EDATIINLSIDDAS
A0A414LTU9      --------IRYSKESADMMADSY-----TQKLRAE-LGN-------EDATIINLSIDDAS
I9Q4U4          --------IRYSKESADMMADSY-----TQKLRAE-LGN-------EDATIINLSIDDAS
A0A373ISF0      --------IRYAIGKADGAADRY-----LNALRVE-LGS-------KEATIINLSINDTS
U6RF62          --------IRYAIGKADGAADRY-----LNALRVE-LGS-------KEATIINLSINDTS
A0A662ZZD5      --------IRYRKGNVCAVTDYY-----TAALHAE-LGN-------EDATIINLSINDAS
A0A3A5TI83      --------IRYRKGNVCAVTDYY-----TAALHAE-LGN-------EDATIINLSINDAS
A0A415NEB6      --------IRYRKGNVCAVTDYY-----TAALHAE-LGN-------EDATIINLSINDAS
A7AJ60          --------IRYRKGNVCAVTDYY-----TAALHAE-LGN-------EDATIINLSINDAS
A0A7J5MKN5      --------IRYRKGNVCAVTDYY-----TAALHAE-LGN-------EDATIINLSINDAS
A0A6A2JF01      --------IRYRKGNVCAVTDYY-----TAALHAE-LGN-------EDATIINLSINDAS
A0A7J4Y8G3      --------IRYRKGNVCAVTDYY-----TAALHAE-LGN-------EDATIINLSINDAS
A0A015UXN7      --------IRYRKGNVCAVTDYY-----TAALHAE-LGN-------EDATIINLSINDAS
A0A6I2NTL0      --------IRYRKGNVCAVTDYY-----TAALHAE-LGN-------EDATIINLSINDAS
A0A6I2Q447      --------IRYRKGNVCAVTDYY-----TAALHAE-LGN-------EDATIINLSINDAS
A0A016E4F9      --------IHYNKGSVNAVTDYY-----TQNLRAE-LGN-------EDATIINLSIDDAS
A0A6N3HG44      --------IRYNKGSVRAVTDYY-----ATGLRAD-LGN-------EDATIINLSIDDAS
A0A7K0HSP7      --------IRYNKGSVRAVTDYY-----ATGLRAD-LGN-------EDATIINLSIDDAS
A0A7K1HEJ5      --------IRYNKGSVRAVTDYY-----ATGLRAD-LGN-------EDATIINLSIDDAS
A0A6H9P0U9      --------IRYVRGSVRAAVDTY-----SNALVAE-LGN-------EDATIINLSINDTS
A0A108TH71      --------IRYVRGSVRAAVDTY-----SNALVAE-LGN-------EDATIINLSINDTS
I8VXH0          --------IRYVRGSVRAAVDTY-----SNALVAE-LGN-------EDATIINLSINDTS
A0A412S0N6      --------IRYVRGSVRAAVDTY-----SNALVAE-LGN-------EDATIINLSINDTS
A0A412IIJ0      --------IRYVRGSMRAAVDTY-----SNALVAE-LGN-------EDATIINLSINDTS
A0A0P0FM97      --------IRYVRGSVRAAVDTY-----SNALVAE-LGN-------EDATIINLSINDTS
R6KTP3          --------IRYVRGSVRAAVDTY-----SNALVAE-LGN-------EDATIINLSINDTS
A0A139LU87      --------IRYVRGSVRAAVDTY-----SNALVAE-LGN-------EDATIINLSINDTS
A0A1C6B3Y5      --------IRYVRGSVRAAVDTY-----SNALVAE-LGN-------EDATIINLSINDTS
A0A6L3KCD1      --------IRYVRGSVRAAVDTY-----SNALVAE-LGN-------EDATIINLSINDTS
E2NMQ4          --------IRYVRGSVRAAVDTY-----SNALVAE-LGN-------EDATIINLSINDTS
A0A412YDB9      --------IQYVRGSVSAAADTY-----ANTLVAE-LGS-------DDATIINLSISDAS
R7DY01          --------IQYVRGSVSAAADTY-----ANTLVAE-LGS-------DDATIINLSISDAS
A0A414LGK8      --------IQYVRGSVSATADTY-----ANALVAE-LGS-------DDATIINLSISDAS
A0A415IPQ4      --------ILYSRGSVRAAADTY-----ANALVAE-LGN-------EDATIINLSINDAS
A0A3E5BRW7      --------VRYARRSVRDVADAY-----TRELVAE-LGN-------EDATIINLSISDAS
K9DXS6          --------VRYARRSVRDVADAY-----TRELVAE-LGN-------EDATIINLSISDAS
A0A1M6KFV3      --------IRYVRRNVRSVSDAY-----AKELVAE-LGN-------EDATIINLSINDAS
A0A1Q6G7L3      --------IRYVRRSVRSVSDAY-----AKELVAE-LGN-------EDATIINLSINDAS
A0A413H235      --------IRYVRRSVRSVSDAY-----AKELVAE-LGN-------EDATIINLSINDAS
A0A1M5B2J8      --------IEVIRSTIKGAVGDA-----SSRLSVV-QND-------EKSNIISLSFQDVS
A0A255RCT5      --------VEVLRSTLKEAVAGA-----SSRLTVS-QDD-------EKSNIISLSFQDVS
A0A1Y4GLF5      --------LYVDRSTLYSAVNAY-----SANLSVS-LNN-------EKASVIDLSFKDLS
A0A1H3XSC0      --------LYVFRSSLHGTVGQY-----SSNLSVA-LSS-------EKTSIVNLTFRDHS
A6LE40          --------LYISKSSLYNAVNSY-----SSNLSIS-LNN-------EKASVIDLSLKDNS
A0A4Y1VPX5      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A6N2XMM4      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
B3JI46          --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A358R8U0      --------LKVSRTGLYGAVGSY-----SGNLTVT-LSD-------KKASAIDLTFRDVS
R6WSB6          --------LKVSRTGLYGAVGSY-----SGNLTVT-LSD-------KKASAIDLTFRDVS
A0A401LPX7      --------IYVTRQSLSAASAGC-----SANLTIS-QND-------EKSNIITLSFQDVS
A0A6G0GNY9      --------IYVSRQSLAATSANC-----SARLNIS-QND-------EKSNIITLSFQDVS
A0A6I1BFM0      --------IYVSRQSLAATSANC-----SARLNIS-QND-------EKSNIITLSFQDVS
A0A3A5Z900      --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVC
A0A7K0GW19      --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
A0A285TGL6      --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
A0A3A5RFX4      --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
A0A1Q6IUW9      --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
A0A413XDP6      --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
A0A6N8CVT6      --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
K6AP24          --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
A0A6I2NHV3      --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
A0A078RYI7      --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
A0A7I0QD01      --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
C7XEQ8          --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
D7INX6          --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
K5ZG55          --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
A0A662ZYI7      --------IYVTRQSLSAASAGC-----SARLNIS-QND-------EKSNIITLSFQDVS
A0A3N2N9B8      --------LKVNRLPLDAARASY-----SSRLSVT-QGS-------DNSSLIRLTLSDRS
A0A3N2NMI0      --------LEVNKIPVKTAQAIY-----SSHLGVS-QSG-------ENSSVIRLTLSDRS
A0A359I8H7      --------IIVERDGMQSTVETY-----GGLVKAD-LAD-------KDADVIDLSMKDVS
A0A3N2KA63      --------IIVERDGMQSTVETY-----SGLVKAD-LAD-------KDADVIDLSMKDVS
A0A4Q0IMT7      --------IIVERDGMQSTVETY-----SGLVKAD-LAD-------KDADVIDLSMKDVS
A0A7J0B660      --------IIVERDGMQSTVETY-----SGLVKAD-LAD-------KDADVIDLSMKDVS
A0A3B9FAU3      --------ILVTRTDLYTKTEGV-----QRNLSVE-LTD-------KMSTLVRISYKDKE
A0A3C1E5L7      --------ILVTRTDLYTKTEGV-----QRNLSME-LAD-------KMSTLVRISYKDKE
A0A4Q0UAV1      --------IHNTPEAL---AASF-----SGNITFE-LKE-------FSTSIINLIMTDES
A0A354SN68      --------ICVRKCNITSATERV-----QRMYLAT-GRE-------DGSSVVNITCNGEH
A0A6L5XFL0      --------IEVSHRSVKAVAGAL-----DHGLKVE-LND-------DNSSVVDLTLNDEN
A0A3N2N595      --------LEIDKKPLGWAVATY-----LGNLMVS-LNN-------KEGTVIDLTLNDRS
A0A7J0ACS3      --------LIVTKMPLSAARDSY-----NGRLAVA-MSN-------DKGTVLRLTFADQS
A0A0A2DUD9      --------LIIKRSSLYDAVENL-----GKNLTVN-LAD-------EKSTILSLSLLDRS
A0A3P1ZBJ5      --------IQVVKYPLSDVVD-Y-----FGRINVE-LKE-------KESTMVDISINDVS
R5FHS9          --------LYVTHVPMMSAMSSY-----QKGLSVS-LAD-------NKAAVINLEMQDVN
A0A413TW79      --------LHVTRTNLYAMTDHI-----KASLSAS-ISE-------EKATVIDLTYKDQL
A0A7K0AAG2      --------LHVTRTNLYAMTDHI-----KASLSAS-ISE-------EKATVINLTYKDQL
A0A7K0ASF1      --------LHVTRTNLYAMTDHI-----KASLSAS-ISE-------EKATVIDLTYKDQL
A0A3E5E9M7      --------LHVTRTNLYAMTDHI-----KASLSAS-ISE-------EKATVIDLTYKDQL
A0A3E4SK73      --------LHVTRTNLYAMTDHI-----KASLSAS-ISE-------EKATVIDLTYKDQL
A0A415GGC6      --------LHVTRTNLYAMTDHI-----KASLSAS-ISE-------EKATVIDLTYKDQL
A0A413DBH9      --------LHVTRTNLYAMTNHI-----KASLSAS-ISE-------EKATVIDLTYKDQL
A0A495WI87      --------IYVSCSSLYSAVRRY-----APNLSVV-LND-------EKSTVVDLSFKDVS
A0A354M4S6      --------IYVSRSGLYSAVRRY-----APNLSVV-LND-------EKSTVVDLSFKDVS
R7DH52          --------IYVSRSGLYSAVRRY-----APNLSVV-LND-------EKSTVVDLSFKDVS
A0A7J5IAE7      --------LYVGKSSLYSAVNNC-----SSNLSVS-LNN-------EKASVIDLSYKDNS
A0A016CWA4      --------LYVDKSGLYNAVNSC-----SSNLSVS-LNN-------EKASVVDLSFRDNS
A0A4P8LP09      --------LYVDKSGLYNAVNSC-----SSNLSVS-LNN-------EKASVVDLSFRDNS
A0A0M1W0V2      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A139KA16      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A174VQ92      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A1Q6HCG0      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A1Y4JYM9      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A3A5QW67      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A3A5RQE6      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A3A6BP07      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A3E5E153      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A3Q9IP20      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A412WV15      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A413ICP6      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A414KYB9      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A5B3FWR2      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A7J5QHB9      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
E5WX00          --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
K0X3P3          --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A1C6H117      --------LYVGKSSLYDAVNSC-----SSNLSVS-LNN-------EKASVIDLSFRDNS
A0A6I1AQV4      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A5C6L2P1      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A412MJT7      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A3E4WKT5      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVINLSFKDNS
A0A3A5YY33      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A1E9CFZ7      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A373FYU5      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A3A5TZ72      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A3A5XBP2      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A3A6MEG9      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A3E4JP35      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A3E4KP40      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A3E4NX82      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A3E4XFU8      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A412RG70      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A412TD37      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A413GAA4      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A414M7I4      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A496BTA0      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A496D2V6      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A5C6KCA6      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A5M5AHM5      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A6I0Y5K7      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A6I1BFB8      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A6I2P5W5      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A6N8DC51      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A7J5HGP0      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A7J5HVL8      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A7J5JHD3      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
E5UZA2          --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A069SMG6      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
C3RFN5          --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A3A5Z014      --------LYIDKSSLYNAVNSC-----SSNLSVS-LNN-------EKSSVIDLAFKDNS
A0A7J5GD93      --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLAFKDNS
A0A7K0HGR5      --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLAFKDNS
A0A078S3Q8      --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLAFKDNS
A0A069SJV7      --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLAFKDNS
A0A3E5DXI5      --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLAFKDNS
A0A3E5EM98      --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLAFKDNS
A0A6N2YYD4      --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLAFKDNS
I9T3G6          --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLAFKDNS
A0A3E4SYU0      --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLAFKDNS
A6LGY1          --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLSFKDNS
K5ZSH4          --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A6A2RTB3      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A7J5PEN4      --------LYVGKSSLYNAVNSC-----SSNLSVS-LNS-------EKASVIDLSFKDNS
A0A1M4YZ07      --------LYVGKSNLYNAVNSC-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A7J5I238      --------LYIGKSSLYNAVNSY-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A0P0FQW1      --------LYIGKSSLYNAVNSY-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A7K0I229      --------LYIGKSSLYNAVNSY-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A5M5C0W6      --------LYIGKSSLYNAVNSY-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A642NJ89      --------LYIGKSSLYNAVNSY-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A6L3JTQ2      --------LYIGKSSLYNAVNSY-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A7J5FQU6      --------LYIGKSSLYNAVNSY-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A7J4YLH7      --------LYIGKSSLYNAVNSY-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A6N3AEV2      --------LYIGKSSLYNAVNSY-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A6G0G4T5      --------LYIGKSSLYNAVNSY-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A6L3KG29      --------LYIGKSSLYNAVNSY-----SSNLSVS-LNN-------EKASVIDLSFKDNS
A0A1Y4PQK7      --------VRVVRSGLYGAVRTC-----SSRLSVA-LND-------EESTVLSLSYRDVS
A0A1Y4IH41      --------VHVVRSGLYGAVGTC-----SSRLSVA-LND-------EESTVLSLSYRDVS
A0A3A6AAP4      --------VHVVRSGLYGAVGTC-----SSRLSVA-LND-------EESTVLSLSYRDVS
A0A6I0ZRD2      --------VHVVRSGLYGAVGTC-----SSRLSVA-LND-------EESTVLSLSYRDVS
A0A7L4SP06      --------VHVVRSGLYGAVGTC-----SSRLSVA-LND-------EESTVLSLSYRDVS
A0A1Y4DYA7      --------VYISHSGLQATTSVY-----SGKLTVA-LKD-------EKSTVINLSIEDVC
A0A1Y3X4I9      --------VYVSRSGLQSTAAAY-----SDKLNVA-LND-------EKSTVINLSLEDVC
A0A1Y4FNK8      --------VYVTRISYQAATSAY-----ASNLSVA-LND-------EKSTVVNLTFTDVC
A0A355FD59      --------IYVSRTNLYSATNAC-----KEALTIS-LSD-------EKVTVIDLSYNDVS
A0A359CEZ9      --------IYVSRTNLYSATNAC-----KEALTIS-LSD-------EKVTVIDLSYNDVS
A0A353Q7B4      --------IYVSRTNLYSATNAC-----KEALTIS-LSD-------EKVTVIDLSYNDVS
F8X3A5          --------IYISRTNLYSATDLF-----KQNLTAS-LSE-------EKATVIDLSYKDVS
A0A1M3KVR9      --------IYISRTNLYSATDLF-----KQNLTAS-LSE-------EKATVIDLSYKDVS
A0A4Y9IJS3      --------IYISRTNLYSATDLF-----KQNLTAS-LSE-------EKATVIDLSYKDVS
A0A1H4ADG3      --------IKMDVSSINAVADGF-----KENINAE-ISD-------KQTSIINLSLNTTI
A0A5B8VUR8      --------IKMAVASINAVADSY-----KENINAD-ISD-------KQTGIINLSLNTTI
A0A0D3L8Q3      --------VRVHFNNIQRLASNY-----SDRLVVEKDKL-------AWSSALILSLVDPV
A0A7G7G5F9      --------IEVKFNNLTKLANSY-----NSKLEVAPITK-------E-TNVLSITLTDAV
A0A2N3U785      --------VLVEFKDYRRVANYY-----RNALSIYPINK-------E-TKVIAIELTEPV
A0A5B6TJH8      --------VKVQFQNIQEVASRY-----HNAIEVMQAGK-------TWTNVIKLELTDSK
A0A519U664      --------IIVRFNDIHQVAAHY-----SQAIGIQPVGK-------S-SNVLTLSLVDPI
A0A519MA34      --------IIVRFNDIHQIAAHY-----SQAIGIQPVGK-------S-SNVLALSLVDPI
A0A519UCX0      --------IIVQFNDIHQVAVHY-----SQAISVQSVGK-------S-SNVLNLTLIDPI
A0A0E3ZG78      --------LTVKFKNVQQLAEHY-----SQAIQIGPVNK-------S-ASVLWVGLTDPI
A0A1I6BRK6      --------IIVYFQDIYQVANHY-----SQAINIKPVGK-------T-TNVLNISLIDPM
A0A243WAB1      --------VIVSFQDIHQVADHY-----NKAIAVQPVGK-------S-ASVLSLSLVDPI
A0A6G8C8X6      --------IIVHFQDIKQVAAHY-----NKAIVVQPVSD-------G-ASVLSLSIVDPI
A0A416GA42      --------IEVLKSTVRNTGNAL-----VARLGVA-KAS-------KESSMIQLNITDPV
A0A1T3IYP5      --------VFVAKYPREVIMSQF-----VANLKIK-QME-------EDASLLQVSMEDQS
A0A1T5K9D4      --------IYIQKIPVSQAAAAY-----SSALSIS-QNN-------SAETVLNLSIQDFS
A0A077ENE7      --------IQVAKSPREAVMSNF-----VGNLSIK-QME-------EEASLMQVTMTDDS
A0A7H1Z2Z7      --------IQVAKSPREAVMSNF-----VGNLSIK-QME-------EEASLMQVTMTDDS
A0A6I5UW06      --------IQVAKSPREAVMSNF-----VGNLSIK-QME-------EEASLMQVTMTDDS
T0NN57          --------IQVTKYPREAMMENF-----KGKMKIA-QMD-------EDASLLQITMEDQS
X5K347          --------IQVTKYPREAMMENF-----KGKMKIA-QMD-------EDASLLQITMEDQS
A0A060RD97      --------VNVAVTSVAKAQLDF-----SSRLTVA-RAD-------KVSSVVNLSFIDQS
A0A3C1ITV0      --------VIVGYERPELTAKSC-----QARLTAE-LAD-------KLATVINFSYTDAS
R7HN19          --------VIVGYERPELTAKSC-----QARLTAE-LAD-------KLATVINFSYTDAS
A0A350IHV0      --------IVVSWVNAKRLAKAY-----CKKLNVS-LSG-------KESTVLVLSLEDTF
R5RVP0          --------MRVSWVNSAKLAKAY-----CKGVTVA-LSG-------KESTVIVLTMKDRF
R6A0L2          --------IEVDRLSKEKAAARF-----LKMLSAS-EYD-------KETSLIVLNCNDTN
R7LG80          --------ITVNRNSVSATADAL-----RKRMDVA-QIE-------KEASLIGLTFQDIN
A0A2L2WX98      --------VTVTRLPKKMAAASY-----CKQFSAGEYDK-------KESSLIILGCEDIN
G5GD56          --------IQIHHLPIEMAAKIY-----QEKIKAS-AYD-------KETSLVVLSAQDIN
R5KD55          --------IDVRKSDNASATGRF-----LGGLSVE-IGD-------KKSTILDLSYNDVS
A0A174QNT3      --------VLVTRSDLETVTNSM-----MERIQTS-AMD-------QKSTLVNIVYQDVN
A0A4S2FGS1      --------IRVTRSDLESATNAV-----MGRIQTS-AMD-------TKSTLVNIVCQDVN
A0A7K3KG59      --------IRVTRSDLESATNAV-----MARIQTS-ALA-------SQSTLVNIICQDVN
R9I0H0          --------IRVTRSDLESATNAV-----MARIQTS-ALA-------SQSTLVNIICQDVN
K5BUT9          --------ISVSRISPEIATNIY-----QSKIATS-LAG-------ERTTLVQITCSDTN
A0A174FPA3      --------ISVSRISPEIATNIY-----QSKIATS-LAG-------ERTTLVQITCSDTN
R6S9Y6          --------ISVSRISPEIATNIY-----QSKIATS-LAG-------ERTTLVQITCSDTN
A0A7J4YSB2      --------ISVSRISPEIATNIY-----QSKIATS-LAG-------ERTTLVQITCSDTN
C9KX15          --------ISVSRISPEIATNIY-----QSKIATS-LAG-------ERTTLVQITCSDTN
A0A6H0KRK1      --------VSVTRISPETAAAIY-----KGGISTS-LAG-------KGTTMVQITCTGDN
R6DAG6          --------VSVTRISPETAAAIY-----KGGISTS-LAG-------KGTTMVQITCTGDN
A0A3L8AAP1      --------VSVTRISPETAAAIY-----KGGISTS-LAG-------KGTTMVQITCTGDN
A0A4S2AYX2      --------VSVTRISPETAAAIY-----KGGISTS-LAG-------KGTTMVQITCTGDN
A0A7J0A2L4      --------VSVTRISPETAAAIY-----KGGISTS-LAG-------KGTTMVQITCTGDN
A0A7K3MN31      --------VSVTRISPETAAAIY-----KGGISTS-LAG-------KGTTMVQITCTGDN
A0A0E2M2Y7      --------LYVTKENIRKVIQRY-----NKDLQIS-LAD-------KNATIVNLSMKNED
A0A0K2J6Z0      --------LYVTKENIRKVIQRY-----NKDLQIS-LAD-------KNATIVNLSMKNED
B2RKZ8          --------LYVTKENIRKVIQRY-----NKDLQIS-LAD-------KNATIVNLSMKNED
A0A212GC82      --------LYVTKENIRKVIQRY-----NKDLQIS-LAD-------KNATIVNLSMKNED
A0A254MU12      --------LYVTKENIRKVIQRY-----NKDLQIS-LAD-------KNATIVNLSMKNED
R6CQ93          --------IHVSKIPLNAAAGRF-----LGSMGIR-QEE-------DESSILVLSLKDDS
A0A3D1NQW3      --------IRVTKGNLGVVTQFY-----QHEVKSF-VAN-------KQASIITISMKSSV
B0MT10          --------IRVTKGNLGVVTQFY-----QHEVKSF-VAN-------KQASIITISMKSSV
R7JGW9          --------IRVTKGNLGVVTQFY-----QHEVKSF-VAN-------KQASIITISMKSSV
A0A3D2BF46      --------ISVSKQIVSSVASGY-----NKRIAIE-LVE-------KQANAISISLDDNI
A0A358R538      --------VRVRKRSLGSATSAY-----RNAVKCD-VAN-------KQASVVTVTMSNTV
A0A1Y4AAB8      --------IQVAKSSLEAATSAY-----RAAVKCA-VED-------KQTSVVGIAMNDAV
A0A1Y3WWY9      --------IRVGKSSLKALTDTY-----RGAIKCD-VA--------KQGSVVTISMSNSV
A0A1Y4U5L4      --------IRVGKSSLKALTDAY-----RGAIKCD-VA--------KQGSVVTISMSNSV
A0A1Y3VCJ1      --------IRVSKGDLKTIANMY-----RGAVKCE-VTN-------QQASVVTLSMNNAI
A0A1Y3QTW7      --------ITVTKSSPMVTTNAY-----RATVKSD-VAN-------KQASIVTISMNSSV
R6XWY7          --------ITVTKSSPMVTTNAY-----RATVKSD-VAN-------KQASIVTISMNSSV
A0A4Y1X9Y9      --------ITVTKSSPMVTTNAY-----RATVKSD-VAN-------KQASIVTISMNSSV
A0A4Y1WM66      --------ITVTKSSPMVTTNAY-----RATVKSD-VAN-------KQASIVTISMNSSV
A0A6N4GYT3      --------ITVTKSSPMVTTNAY-----RATVKSD-VAN-------KQASIVTISMNSSV
A0A174AVF1      --------ITVTKSSPMVTTNAY-----RATVKSD-VAN-------KQASIVTISMNSSV
A0A656Q4F4      --------ITVTKSSPMVTTNAY-----RATVKSD-VAN-------KQASIVTISMNSSV
A0A1Q6EIY0      --------ITVIKNSLAATTNAY-----RAAVKSD-VAN-------KQASIVTISMNNSV
A0A5B5VN71      --------ITVIKNSLAATTNAY-----RAAVKSD-VAN-------KQASIVTISMNNSV
E4M8L3          --------ITVIKNSLAATTNAY-----RAAVKSD-VAN-------KQASIVTISMNNSV
I3YQ50          --------ITVIKNSLAATTNAY-----RAAVKSD-VAN-------KQASIVTISMNNSV
R5UEY8          --------ITVIKNSLAATTNAY-----RAAVKSD-VAN-------KQASIVTISMNNSV
A0A1H4D866      --------IRVVKNSLSRTTNAY-----RNAVKSD-VAN-------KQASVVTISMNNSV
A0A5B3G4Y7      --------IRVTKSSLGRTTNAY-----RAAVKSD-VAN-------KQASVVTISMNNTV
A0A374A9J5      --------IRVTKSSLGRTTNAY-----RAAVKSD-VAN-------KQASVVTISMNNTV
A0A5B3GQN5      --------IRVTKSSLGRTTNAY-----RAAVKSD-VAN-------KQASVVTISMNNTV
A0A1Q6E9S3      --------IRVTKSSLGRTTNAY-----RAAVKSD-VAN-------KQASVVTISMNNTV
D4IJ36          --------IRVTKSSLGRTTNAY-----RAAVKSD-VAN-------KQASVVTISMNNTV
A0A414Q925      --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
A0A415PUS9      --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
A0A108TCU0      --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
A0A413BA42      --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
S3Y344          --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
A0A7J5LEW3      --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
A0A412TGL3      --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
A0A413VJ33      --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
A0A414L0W6      --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
A0A412DP39      --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
A0A413ZSE8      --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
B0NP84          --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
R6AK43          --------VYVTKGNMKEVAESY-----NKALNVG-VAN-------KQSSLIALSIEDEN
A0A412N2D9      --------VYVAKGNLKEVAEEY-----NKALNAG-VTN-------KQSSLIALSIEDEN
A0A1Y4JYS9      --------VYVAKGNLKEVAEEY-----NKALNAG-VTN-------KQSSLIALSIEDEN
R6LHA4          --------VYVAKGNLKEVAEEY-----NKALNAG-VTN-------KQSSLIALSIEDEN
A0A3E5HPT8      --------IKVTSKSREGMVAFW-----LSNLTIR-QMS-------GDAALLSMTMNDLS
C6IJ48          --------IKVTSKSREGMVAFW-----LSNLTIR-QMS-------GDAALLSMTMNDLS
Q8A3U2          --------IKVTSKSREGMVAFW-----LSNLTIR-QMS-------GDAALLSMTMNDLS
A0A3R6S1H6      --------VTVTKYNLLQVAKAC-----NAGLRAY-LAD-------KKASIINLAIEDVS
A0A3R6SD81      --------VTVTKYNLLQVAKAC-----NAGLRAY-LAD-------KKASIINLAIEDVS
A0A354WXN6      --------ISINKRAASAVTNAY-----QAALNAS-LAS-------KTSTIINLTLQDRS
A0A7G1HW11      --------ITVNKRRLKDATTRY-----RRAVSVS-LES-------KNGGALNITMNDTD
R5IP14          --------ITVNKRRLKDATTRY-----RRAVSVS-LES-------KNGGALNITMNDTD
A0A316SZX7      --------IKISKNPVKAVAASY-----KGRMNVS-LIG-------KTTSSVSITLQDPN
A0A1Y4AIY1      --------VHVRKSNLKGIATGY-----QNALVSE-LVA-------EYATIIKLSLSDVS
A0A0J6CIR2      --------VTISKRNREEIALTY-----SNSLQVA-LAS-------KTATIINLTLQDVS
A0A3D8HG59      --------VRVTKSDLDETVLHF-----NRILQVA-LAS-------KTATIINLTLQDES
A0A3R6S408      --------VRVTKSDLDETVLHF-----NRILQVA-LAS-------KTATIINLTLQDES
F3ZRU7          --------IQIHHRGLKNVTLGY-----GNAIQIA-LAD-------KKATIINLSLRDEV
A0A1C5Q1F3      --------VTVNKMNLEKVGMAY-----NAALQSM-VAS-------KTSSIIHLSISDVS
R7A239          --------VTVNKMNLEKVGMAY-----NAALQSM-VAS-------KTSSIIHLSISDVS
A0A3R6HIK7      --------IQVTKSRLKSVAKRY-----QSALQST-LAD-------KMSTIINLSLSDVS
K5ZVW7          --------IQVTKSRLKSVAKRY-----QSALQST-LAD-------KMSTIINLSLSDVS
A0A1Y4D5Z0      --------ITVRKSNLSNVARAY-----LNKLQST-VAS-------KTATIINLSLSDVS
A0A413VXJ7      --------ISVTKSNMERVVDAY-----QSSMEVS-LAS-------KTATIINLTLKDVS
I9RSN9          --------ISVTKSNMERVVDAY-----QSSMEVS-LAS-------KTATIINLTLKDVS
U6RJK5          --------ISVTKSNMERVVDAY-----QSSMEVS-LAS-------KTATIINLTLKDVS
A0A1Q6GA32      --------ISVTKSNMERVVDAY-----QSSMEVS-LAS-------KTATIINLTLKDVS
I9RPU6          --------VNVVKSNLESVIEGY-----RGRLKVS-LAS-------KTATIINLVLDDVS
I8YFS5          --------VFVTKANMEKVVEGY-----QSKMKIS-LAS-------KTATIINLVLDDVS
A0A7J4XCM0      --------VYITKSNMEKVVEGY-----LRRINIS-LAS-------KTATIINLVLDDVS
I8Y597          --------VYITKSNMEKVVEGY-----LRRINIS-LAS-------KTATIINLVLDDVS
A0A1Q6GBF5      --------VHVTKSNMESVVENY-----RNRLKVS-LAS-------KTATIINLVLDDVS
I8YFZ3          --------VNVVKFNMESVVESY-----RNKLKVS-LAS-------KTATIINLVLDDVS
A0A7J4XFW0      --------VSVVKSNLESVIEGY-----RTRLKVS-LAS-------KTATIINLVLDDVS
A0A1Q6GDH2      --------VNVVKSNLESVIEGY-----RGRLKVS-LAS-------KTATIINLVLDDVS
U6RSB0          --------VNVIKSNLESVIEGY-----RARLKVS-LAS-------KTATIINLVLDDVS
I9GXM2          --------VNVVKSNLESVIEGY-----RGRLKVS-LAG-------KTTTIINLVLDDVS
I9SIK1          --------VNVVKSNLEGVIEGY-----RGRLKVS-LAG-------KTTTIINLVLDDVS
A0A7J4XIJ5      --------VNVVKSNLEGVIEGY-----RGRLKVS-LAG-------KTTTIINLVLEDVS
I9TP59          --------VNVVKSNLEGVIEGY-----RGKLKVS-LAG-------KTTTIINLVLEDVS
R5S343          --------VMIEKNIVSDVVDAY-----RERMRIE-LAD-------KSTTIIYLTLQDVS
A0A1M6K7I9      --------ILVQKFVTERVVDDC-----MATLSVS-LAS-------KMATIIDLEYKDES
A0A5M6A8C8      --------IQVQKSVTERVVDDC-----MTTLSVS-LAS-------KMATIIDLEYKDES
A0A7J4XCJ1      --------IYVVKSNMEKVVEGY-----QNRIKIS-LAS-------KTATIINLVLDDVS
A0A7J4XNQ7      --------IYVTKSNMEKVVEKY-----LNEINIS-LAS-------KTATIINLVLKDVS
A0A3R5ZMK1      --------VQVTKSPLQDVALRF-----QGGLQAT-LAS-------KTATIINLTLQDVS
A0A7K1HMX0      --------VQVTKSPLQNVAIGF-----QANLQAT-LAS-------KTATIINLTLQDVS
A0A1Y3ZIA4      --------VQVTKSPLQNVALRF-----QSGLQAT-LAS-------KTATIINLTLQDVS
K5Y1A4          --------VQVTKSPLQNVALRF-----QSGLQAT-LAS-------KTATIINLTLQDVS
A0A7K1HDC0      --------VQVTKSPLQDVALRF-----QGGLQAT-LAS-------KTATIINLTLQDVS
A0A3R6K8X4      --------VQVTKSPLQDVALRF-----QGGLQAT-LAN-------KASTIINLTLQDVS
A0A6N8D6C8      --------VQVTKSPLQDVALRF-----QGGLQAT-LAN-------KASTIINLTLQDVS
A0A3R6BKI7      --------VQVTKSPLQDVALRF-----QGGLQAT-LAN-------KASTIINLTLQDVS
A0A412M2W1      --------VQVTKSPLQDVALRF-----QGGLQAT-LAS-------KTATIINLTLQDVS
K5ZX55          --------VQVTKSPLQDVALRF-----QGGLQAT-LAS-------KTATIINLTLQDVS
A0A415BDM7      --------VQVTKSPLQDVALRF-----QGGLQAT-LAN-------KASTIINLTLQDVS
A0A1Q6I3T6      --------VQVTKSPLQDVALRF-----QGGLQAT-LAN-------KASTIINLTLQDVS
A0A414XX40      --------VQVTKSPLQDVALRF-----QGGLQAT-LAN-------KASTIINLTLQDVS
A7AEU7          --------VQVTKSPLQDVALRF-----QGGLQAT-LAN-------KASTIINLTLQDVS
A0A5F0U645      --------ITVSKSNQDRVALDY-----NESLQVV-LAS-------KTATILNLSLQDVS
K5ZBN2          --------ITVSKSNQDRVALDY-----NESLQVV-LAS-------KTATILNLSLQDVS
A0A0J6CKW3      --------ITVSKSNQDRVALDY-----NESLQVV-LAS-------KTATILNLSLQDVS
A0A0F5IQM7      --------ITVSKSNQDRVALDY-----NESLQVV-LAS-------KTATILNLSLQDVS
A0A496CDT3      --------ITVSKSNQDRVALDY-----NESLQVV-LAS-------KTATILNLSLQDVS
A0A6G1ZKM3      --------ITVSKSNQDRVALDY-----NESLQVV-LAS-------KTATILNLSLQDVS
S0GLB0          --------ITVSKSNQDRVALDY-----NESLQVV-LAS-------KTATILNLSLQDVS
A0A3R6NLC1      --------ITVTKSSRDWVALNY-----NEALQVA-LAS-------KTATILNLSLQDAS
A0A416WYC9      --------ITVTKSSRDRVALNY-----NEALQVA-LAS-------KTATILNLSLQDAS
A0A0F5IT40      --------VTISKRNREEIALTY-----SNSLQVA-LAS-------KTATIINLTLQDVS
A0A496CX20      --------VTISKRNREEIALTY-----SNSLQVA-LAS-------KTATIINLTLQDVS
A0A5F0UBI0      --------VTISKRNREEIALTY-----SNSLQVA-LAS-------KTATIINLTLQDVS
A0A6G1ZHG0      --------VTISKRNREEIALTY-----SNSLQVA-LAS-------KTATIINLTLQDVS
S0GSI7          --------VTISKRNREEIALTY-----SNSLQVA-LAS-------KTATIINLTLQDVS
K5YB65          --------VTISKRNREEIALTY-----SNSLQVA-LAS-------KTATIINLTLQDVS
A0A0F5IWP9      --------VAVVKKNRVDVALGY-----SNTLQVA-LAS-------KTATIINLTLQDVS
A0A0F5IZT8      --------VAVVKKNRVDVALGY-----SNTLQVA-LAS-------KTAAIINLTLQDVS
A0A417LKQ2      --------VAVGKKNREDVTLSY-----SNALQVA-LAS-------KTATIINLTLQDVS
A0A416TME1      --------VVVGKKNREDVALNY-----SNALQVV-LAS-------KTATIINLTLQDVS
A0A416XPE8      --------VVVGKKNREDVALNY-----SNALQVV-LAS-------KTATIINLTLQDVS
A0A3B0C2S4      -----GIQFRVVLKSVKDAVFAL-----SEKLQVQ-PTD-------KRSEVLSLSIKGQS
L8JI02          -----NTRYYFVIHDLSEVIETY-----QTELEVY-PIS-------RESNIVELSMRGSV
A0A4Q5WS95      -----QGPFYFRLIDPKSVAAGL-----QKKLDVA-PAG-------KLSSIVRLKYNDEV
A0A501VZX6      -----KHPLYFSLIRPKKIVESL-----EKNIKIE-AEN-------KLSTVVNFTLYDQI
A0A399SH26      -----KEQLYFQLLPLKAVTASL-----LNNLQVN-AAN-------KLSTVVNLQLKDAV
A0A501W1A9      -----TGRLFFSIKDPRKAARQL-----ASSIQIE-TPG-------KLSSVVNLYIEDQT
A0A0E3ZGV6      -----TNPLYFSIISPTRAANQL-----SGSIFIE-SAG-------KLSSVVNLYLEDKV
A0A1I2N4S1      -----QHPLFFSINNPKAVAKQL-----ISRIYVE-SPG-------KASSVVNLYIEDNV
A0A2T5YE44      -----QNPLFFSINNPKAVAKQL-----ISRIYVE-SPG-------KASSVVNLYIEDNV
A0A1M5BA90      -----TNPLYFSLNNPKMVLNSL-----VTNLRVI-AAS-------KLSTVIDLAIMDEV
A0A512B879      -----TNNLYFSLVPPKQALNSL-----ILNLNVS-PIN-------KLSSVIHLTIKDEV
A0A559PPI3      -----KKPLYFILINPRSVTQSL-----LKSLEVA-PPE-------KLSTVINLYLQDAV
A0A1T5CS78      -----SNPLFFYLLNPKIISTSL-----LDELDIS-TSN-------KLSSVVNLSIKDEV
A0A0Q9Z8F1      -----SNPLFFYLLNPKMISSEL-----IDELDIS-TSN-------KLSSVVNLTIRDAV
A0A2N0U0M7      -----SDPLFFYLLNPKMISSEL-----IDELDIS-TSN-------KLSSVVNLTIRDAV
A0A1V9FHD0      -----TGQLYFDLYKTKNLAPTI-----SLNLVVT-SEN-------KLSSTMDLTYSDAV
A0A4V4H170      -----EGPLFFRLYKPKNIAPGF-----ISNLGVK-SAS-------KLSTTINLTFRDEV
A0A1V9F098      -----GGPLFFRLSKPKNVAPGY-----IASLEVK-SSS-------KLSSTINLTFRDEV
A0A4R2VU64      -----GGQLYFQLIKPKNVAPGI-----IASLDAK-PAS-------KLSSTINLTFRDEV
A0A4S8HY23      -----VAPLFFRLYKPKNRAPAI-----ISNLQVK-SSS-------KLSTTINLTLRDEV
A0A1V9F383      -----VGPLFFELNKPKDVAPGI-----LLNLQVN-SPN-------KLSTTIDLTLRDPI
G8TRZ6          -----VGPLFFNLNKTKDVVPGL-----LLNLLVV-SPN-------KLSSTIDLTLRDEI
A0A4R5DL69      YKPDPENTYSIKISGFESTVSEY-----SRRLSIS-ATN-------KQVSIISLRLTDIL
A0A1M4YED3      -----QGALKLFLYNPESLASSY-----ANRVSIP-PNP-------KSSTVLTLYFQDES
A0A2H3NSN0      -----DD-EQPTDSE---AMIRL-----FDMVDF--AAE-------ADQGLIRIVARSQY
A0A2P6C324      -----SEEEPYTQYA---AILRL-----QEMVSF--VPD-------QQQGLINIRVESQD
A0A7C2DZI7      -----RDGHEPSIRE---IALRL-----QMQVRF--QPL-------SDQDMIVITAESTT
A0A1M6XHU0      -----EDGREPSIRE---IAFRL-----RERVRF--RPL-------SDQDMIVITAESTT
G2SF81          -----EDGREPSIRE---IAFRL-----RERVRF--SPL-------SDQDMIVITAESTT
A0A5S9EYW1      -----EDGREPTIRE---IALRL-----RERVHF--QPL-------SDQDMIVITAESTT
D0MHQ9          -----EDGREPSIRE---IAFRL-----RERVRF--SPL-------SDQDMIVITAESTT
A0A126PFG0      -----GSRLRIVARDPDLVVTAY-----QKALEVD-LIN-------KISPAISLQIKDEV
A0A3M1N7Z3      -----EGQYEVVVFAPQATTFAW-----QRRVSV--IPK-------RGTTILQVSVTDIS
                                                                     .      

A0A1T5MMH4      PLKAHAIVDAINKTYLHYSYEQKKLTTKQKIDWLNNELQQIELKMEGFEDYFERFTL-KN
A0A2W4R1L8      PLKAQTVVNKIDSLYLIFSNEQKTLANRQKITWLTNELKQIEEKMSQYENYFEDFIL-AN
A0A2E5CV79      ADEARRISDGIAQVYKNLEKTIGNEDATLRVEFMDDLVNQQEGKLLLAEDSLKQFKI-EN
A0A2D4ZVH1      PTEASSIINMTMDTYSALSTEQNRTMAVSALEFLRTERTKLESELVSTEDSLQNFMN-RT
A0A0K8QSK7      SAKGNDFLNKLVEVYQRDNLNQKNEVANRTINFIHSQLGEISDSLSISETEMLQFQS-DN
A0A1V6CN82      PQKAVDFLNKLVEVYRIDNVEKKNQYADQTINFIEYLLEGVSDSLAVAEGELLSFQS-RN
A0A1M4XZ45      VSKGVAFLNKLTEVYQLDNLEKKNENANRTIHFISSQLQSISDSLSVSENRMETFQS-EN
A0A399D319      VKKGVDFLNKLTEVYQLDNLEKKNENANRTIQFISSQLQSISDSLSISESRMETFQS-EH
A0A1V5IPN7      RGEAMAAVNAIADAVQQQNTQMARLEFTTIREFLGEQLDLISRRLQISEDDLRAFKN-EN
A0A1M6GR99      VQLGEDIINELIQVYSESNLEKKNHLANMTLEYIDEQLDEVSASLNLTENNLQKFMS-QN
A6EBM4          PRFAADILNAILQEYLDYDKLQKTQSATQMIGFINEQLKHLSSAVSGAEKSLETYKQ-QS
A0A7C5M4P4      QGKAQALVSAIDTLYYKYSLEEKNRANRNKIEYLESQLIETEKKLDEYEKYFEDVTI-TN
A0A1M6TTV4      KYKAKSLLQAIDTIYLNFTKAAKNLAVEQKISFLDRQMKKTQVELEQYEDYFEKFTI-QN
A0A4Q8RX32      ARMGIDFLEQYVVTIIEDNLDRKNYIAHTTIDFIDNQLSQVFDSLNLAEKSLQEFRT-QK
K0X1U5          KQRGKDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVEEELHEAERIVERYKR-EN
R5EXK3          KQRGKDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVKEELHEAERIVERYKR-EN
A0A401UAP7      AEKAMDIVNKIVNIYLGFSNEQKNFANKHKIDWVNNELEQIEEKMSQYEDYFKDFTL-KN
A0A1W2GF52      QTKARNLLQAIDTIYLAFTKNAKNQAVEQKIRFLETQMAKTSKELVEYEDYFEKFTI-KN
A0A2G5L7B8      KYKARSLVQAIDTIYLNYTKAAKNQAVEQKISFLETQMYKSQIELEQFEDYFEKFTI-KN
A0A523GAC0      RYKARDLVSAIDTIYLTYTKEEKNKANQQKIDFLDDQLLLTQSKLQDYESYFESFTI-RN
L8JW09          PLKARDLVNAIDTLYLKYSEEEKNLENKQKIEWLNSELRQIETQLEGYEHYFENFTI-KN
A0A364XUP5      PSKARAILQVIDDVYLKYSHEQKNLANKQKIDWLNNELQQIEEKMEGYENYFKHFTL-QN
A0A1M5RLA9      PTKATAILNKIDSIYLHYSYEQKNLANKQKIDWVSNELVNIEHKMEDFENYFENFTL-QN
A0A385SFR9      PSKATAILNKIDSIYLHYSYEQKNLANKQKIDWVSNELVNIEHKMEDFENYFENFTL-QN
A0A5M4A9J4      PSKSISFLNKLMEVYQQQNLDKKNEMATRTIQFISSQLGSVSDSLTASERHREQFQS-RN
A0A5M4B1C7      PQKDIDFINQLMEVYQDQNLEKKNAMATRTIQFISSQLSSVSDSLVKSEQRRESFQS-KN
A0A0D3LFR6      PYKARVVVDAVSNMYLTYKEEEQIKANNQKIAFLNTLVEDAESKLEGYETYFEDFTI-SQ
M7N6D4          PFKAKVLVDVLSNMYLGYTEEEKIKSNSKRIAFLDEQVEETEAKLEDFESYFENFTI-DY
A0A4D7K1D4      KYKAYDVVNTIDSLYLEYSREQKMQANKQKIAFLEEQMGNTAQTLENYENYFESFTI-EN
A0A5C7MX19      AVKTRDITNMMVRVFVEYDMEKKREGFENVISFLNVQIGQFEEGNTAFEDSISALRV-QF
A0A1Q3ZMZ7      ANLSRDVVNVIIDEFFAFDEMLKKQSSENVLNFLNNQLDSLAIELNKSRDSIVFFQQ-KN
A0A2D8JJW3      SKEAANIVSCLIDSYVEEEKKHANQKTSDQIIFLKNQILSNSDSLLKMKDEIQKFQQ-AE
A0A2W2AFF7      PHQGEDALNKLINVYLQANVDDKNKIADSTMRFIDDRVALVGEELTGIEKKIEAFKK-EN
R7PCR1          KKRAEVLLSTLLDVYREDIIESKNRVAENTSKFIEERIGLIEQDLIKVEGSLARFKE-KY
A0A2N5YXE2      ARKSAEITNTIAEKFIEFDENKKKESANNIITYIDQQMENVFLQLTNTEQNLHDFKQ-QN
A0A1G9E2A9      PEKARDIVNKIDSIYLVQTIENKNLATEQTLKFLDDQLDSTAQKLAQQEESIEDFVR-EN
A0A098LL25      YSKATDIVNTIDSVYLEQTLENKSKSHEQTIKFLEASLLKTEENLAKAEKDLETFVR-NN
A0A6J4H627      IRKAHDIVNKIDSVYLSKTKELKNKANKQKIAFLEEQLQSTEDKLQEYESQLEHFVV-QN
A0A6C0GJI1      IAKARDIVNTIDSVYLTKTLEIKNTSNKKKIEFLEGQLLATEKNLEKYELEQEDFIV-KN
A0A2T2YJE8      PFKAHEIVNSIDSVYLEQKIALKDLATRQTLSFLDEQLKETNENLGNSEIQMENFVK-EN
A0A7L7LEW0      PYKAHEIVNSIDSVYLEQKIALKDLATRQTLSFLDEQLKETNENLGESEIQMENFVK-EN
A0A127B287      REKARDVVNKIDTVYLQQKLARSNQASQQTIDFLSNQLQETQDNLQKAEIDMEYFVK-QN
A0A6P1P2P6      REKARDVVNKIDTVYLQQKLSRTNQASQQTIEFLTNQLQETQDNLQKAEIDMEYFVK-QN
A0A3M9N829      RYKARDIVNNIDTVYLQHKLERSNQASRQTLNFLTEQLKETENSLKKVEDEIESFVR-QN
A0A0P0CSF9      RFKARDIVNNIDTVYLQYKLERSNQASKQTLNFLNEQLKETEDSLRKAENDIERFVR-QN
A0A5M8QQB8      RFKARDIVNNIDAVYLQHKLERSNQASKQTLSFLNEQLKETEDSLRKAENDIEQFVR-QN
A0A3M9MNC3      RYKAHDIVTNIDAVYLQHKIERSNQASRQTLTFLNDQLKETEDSLRKAENDIERFVR-QN
A0A5B6TAX2      RYKAHDIVNNIDAVYLQHKIERSNQASRQTLSFLNDQLKETEDSLRKAENDIERFVR-QT
A0A7L5A132      ALKAHDIVDKIDTLYLQEKLAKNSLASQQTLAFLEGQLDENSRKLQQAEVALQDFVR-RN
A0A512AYT3      PAKARDIVTEIDTAYLEQKIHQKNLASSQRQKFLDQLLKETETNLQNSEENMESFVR-QN
A0A5M6CYN7      PAKARDIVNKIDSAYLEQKIRQKNLATSQIEQFLNEQLKETQDNLANSEGKMENFVR-EN
A0A369QP10      PFKAHEIVNSIDSVYLEQKIALKDMATRQTLSFLDEQLKETNENLGNSEIQMENFVK-QN
A0A7G7G7M4      PYKAQEIVNSIDSVYLEQKIALKDMATRQTLSFLDEQLKETNENLGNSEIQMENFVK-QN
A0A126PDF2      PKKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERAENRYQGFVE-KT
A0A2Z3GKA1      PKKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERAENRYQGFVE-KT
A0A502GZP7      AKKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLDVNYDNLQRAENRYQGFVE-KT
A0A519SBU8      PSKAAHIINNIDTVYLKEKLDRKRQSSALTLSYINQVIADNDKLLRQAEDTQQEFVR-QN
A0A4Q3JNZ3      PEKAAHIINNIDTVYLQEKLERKTKNSELSLGFIDRVIAENDKKWQAAEEAQKEFVR-RN
A0A519Q9V3      PEKAAHIINNIDTVYLQEKLDRKKQSSALSLKFIDQVIADNDKRWRAAEEAQKEFVR-RN
A0A0M3RW20      PLKAKDIVNRIDTVYLVEKLAKNSQGQQQTLQYLDEQLDITRDSLQRAELALQRFVK-AN
A0A495VFX4      PLKAQDIVNRIDTVYLVEKLAKNSQGQQQTLEYLDEQLDVTRDSLQRAELALQRFVK-AN
A0A418R9X5      PSKASDIVNYVDSVYLVEKILRKQETMARATNYIDRQLGVNSDKLSQAEAKMQDFVR-KN
A0A428JSJ3      PVKASDIVNKIDTVYLVEKLLRKQETMARATSYIDQQLGINDNKLGQAESNMQDFVK-RN
A0A428KI59      SVKARDIVNKIDSVYLVEKLLRKQETMARATNYIDKQIDINDNKLGQAESNMQDFVK-RS
W8F1I6          PVKARDIVNKIDSVYLVEKLLRKQETMARATNYIDKQIDINDNKLGQAESNMQDFVR-RS
A0A246FQC0      PAKAQAIVNGIDSVYLVEKLVRKQEQATRAMGYINDQLGDNNQKLNQAEEAMQSFVK-RT
A0A372E5P8      PAKARDIVNAVDAVYLEEKLTRKREQAARALRYINEQLGSNNQSLSQAEENMEAFVK-RT
A0A1H3EMW1      PAKARDIVDAVDAVYLEEKLVRKREQSARALRYINEQLSNNNESLGQAEENMQSFVK-RT
A0A1H9ZSN3      PAKARDIVNAVDAVYLEEKLARKREQSARALRYINEQLGSNNQSLSQAEEAMEAFVK-RT
A0A1S9B3W0      PAKARDIVNKIDSVYLQVKLARTNQATQQTLTFLDGQLVENRDKLQNAEEALQNFVK-QN
A0A1W1VRL3      PAKAQDIVNKIDTVYLQEKLAQKKKASDQSLQFLSEQADAFNNKLQLAEDNLQSFAR-EN
A0A7G6YQJ9      PLKAQDIVNKVDTVYLIEKVLKKQEQAARTLQFIDSELDKSKAGLNKAEGDIQSFAE-RN
A0A1M6R305      PAKARAIVNKIDTVYLQEKIAQKQAATAQTLQFLQQQLAENRQNLAVAEENLQSFAR-QN
A0A7G7W8X3      PSKARAIVNKIDTVYLQEKIAQKQAATAQTLQFLDQQLTENRQNLAVAEENLQSFAR-QN
A0A4Z0PHK3      PAKARAIVNKIDTVYLQEKLAKKQEATAQTLQFLDKTLTENQQQLQGAEENLQAFVR-EN
A0A2M9B9H9      PAKARDIVNKIDTVYLQEKLAKKQEATAQTLQFLDKTLTENQQKLQSAEENLQAFVR-QN
A0A4Z0QCY9      PAKAREIVNKIDTVYLQEKLAKKQEATAQTLKFLDRTLAENQDKLQDAEANLQAFVQ-QN
A0A5N1J2M4      PKKAQDIVNRVDSVYLEHKRETKNQSNEQTISFLREQLDATKVSLQEAEANLEAFAK-KN
A0A519S476      PVKAAHIVNNIDTVYLQEKMARKKQGNDSTLSYLDKLIDETDKRFKAAQELQQQFVL-RN
A0A4Q3JRW8      PEKAAHIINNIDTVYLQEKLDRKKQSSALSLQFIDQVIADNDKRWRAAEEAQKEFVR-RN
A0A519M923      PEKAAHIINNIDTVYLQEKLARKKQQSELSLKFIDLVIADNDQRWRAAEEAQKEFVR-RN
A0A4Z0ENW1      RVKAQRIVNALDTVYRDVKLAHKQETTEKSLDYLDKQLQENGKNLANAEDNLKEFVQ-QN
A0A519UDB4      RLKAQRIVNALDSVYREAKVARKQEATEKTLAYLDQQLAANGINLAKAEDNLKTFVE-QN
A0A3S0QKV1      PQKAQAIVNKIDSVYLNVKLDRSSQATQQTLAFLQGQLLDNRAKLQDAEKALEEFVR-QS
A0A328BL48      PAKARDIVNKIDSVYQQVKLARNYQSTQQSMAFLDSQLNGNRDSLQKAENALQAAVK-RN
A0A5R8WLY4      PTKARDIVNKIDSVYQQVKLARNSQSTQQSMAFLDSQLNGNRDSLQKAENAFQAAVK-RN
A0A1I5WSL8      PTKAQDIVNKIDSLYLVEKVTRKNEATRNQLKFLDQILDENGQNLERAEDRLQSFVQ-KT
A0A0U3JVM7      PSKAQDIVNKIDSVYLAEKLAQKSETTTRKLRFLDQILDQNGQNLERAEDRLQNFVQ-QT
A0A1G1SSV2      ASKAQDIVNKIDSVYLEEKLAQKSESTISKLRFLDQILDQNGQNLEDAEDRLQKFVQ-KT
A0A1G1SXV7      PSKAQDIVNNIDAVYLEERLAQKQESTISKLRFLDQILDQNGQNLEDAEDRLQNFVQ-KT
A0A6G8CBJ6      PLKAQDIVNKIDTVYLQEKLAQKKEASEKSLRFLGEQTDVTNNKLQQAEDNLQSFAR-EN
A0A0W8EDI5      PKKARDIVNKIDTLYLQEKLAKNTQATQQALAFLEGQLDQNSQRLQGAEEALQEFVK-RN
A0A3B7RBP8      PGKARDIVNKIDTLYLQEKLAKNSLATQQTLAFLEGQLDENRNKLQGAEVALQEFVR-RN
A0A3R9P8H7      PTKARAIVNKIDSVYLVEKLLRKQEQAARAMSYINEQLGENNQKLGQAEENMQAFVK-RN
A0A238WIA7      PLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEENRRLLRQAEEQLQDFMK-RN
A0A212UCJ7      SLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLADQSNDNRQLLRQAEEQLQEFMK-QN
A0A4Z0MQE1      PLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEDNRQLLRQAEEQLQDYMK-QN
A0A4Z0PCF4      PLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSDENRQLLRQAEEQLQNYMK-QN
A0A6M6BED0      PLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEENRRLLRQAEEQLQDYMK-QN
A0A5D6VDG1      PRKARDIVNRIDTVYLVAKLTKNTQSQQQIMQYLDKQLELTRDSLQRAEIALQSFAK-RA
A0A243WHR7      PSKAQAIVNKIDTVYLQEKLAQKQEVTQRQLKFLETQIVENKDSLQGAEKNLEKFTD-RT
A0A5B8A0P6      PLKARDVVNKIDSVYLEEKLAQKQQATAQTLEFLDKTLTENKNKLEAAENNLQGFVR-RN
A0A076HRT9      PSKARAIVNKIDTVYLQEKIAQKQTATAQTLQFLDQQLTENRQSLAQAEENLQDFAR-QN
A0A4Z0PVM7      PAKARDIVNKIDTVYLQEKLAKKQEATAQTLQFLEKTLAENQQKLQGAEANLQAFVQ-QN
A0A1M6DHW8      PAKAQDIVNKIDTVYLQEKLTQKQQATAQTLQFLEKTLSENRKQLQLAEENLQSFVR-DN
A0A4Q5LC61      PAKAQDIVNKIDTVYLQEKLAKKQQATAQTLQFLEQTLAENRTQLQNAEENLQSFVR-NN
K0XJ09          ISRAEAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDVENELTDFKQ-KN
R5EUZ0          ISRAEAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDVENELTDFKQ-KN
W0EQS0          ISRADAILSTLIDVYRETIIEDKNRIATSTAKFINERVEIISRELGDVENELTDFKQ-KN
A0A1Y3WE15      TSRAEAILNTLIDVYRETIIEDKNRIATSTAQFINERVEIISRELGDVENELTNFKQ-QN
A0A1Y4GUK3      ISRAEAILMALIDVYRETIIEDKNRIATSTAKFINERVEIISRELGDVENELTDFKQ-KN
A0A2U1FKU2      LDRAKDFINTLISSYNDDVMNDKKSVAVSTATFIDERLAMIGGELGSVDTEIETFKK-QN
A0A0A2F954      LDRAKNFIDALIASYNDDVMNDKKSVAISTASFIDERLAMIGGELGSVDTEIETFKK-RN
A0A0A2FW91      LDRAKNFVNTLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGSVDTEIETFKK-SN
A0A2D2N2N1      LDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-RN
Q7MWZ2          LDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-RN
T2NDT6          LDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-RN
W1R7P9          LDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-RN
A0A1R4AFZ0      LDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-RN
A0A1R4DVZ7      LDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-RN
A0A7C0WKI7      GWEAAFLTNKIAHGYQVLDRNQSRGEISEVVNFLDKQLSQKSKDLKNSEEALRQFQQ-NT
A0A2A8CVM9      PEEASTVANLYSSQYEIFSREKARASVTAARDFLETQAEKRREEIRELEQQWETFAQ-NN
A0A5M4B212      PEKGIDFLNKMMQVYQTRNLDKKNVIATKTIFFITSQLASVSDSLSASQKVRERFQS-HN
A0A3D1KEX9      KDRAEAILTVLMDLYKRDIVESKNSVAANTAKFVDQRIDLIGSELNDVENKLAKFKQ-NN
A0A358Y7S2      AKLSYDITKTLIEQYLFFQEEMNIKNAKKTIDFIDYQLDSLSRVLEISKEDLANFQK-RE
A0A1X7J248      PYKVQEIVETVSELYTEYSKEQKNKANQLKIQFLNKQLKQTESELANYETYIEDFTI-EN
E4TQD2          PYKVQAIVEQVSELYTKYSKEQKNKANQLKIEFLNKQLKQTENELSNYETYIEEFTI-KN
A0A2J6HHN3      ASKATDIVNAITTEFELFEIEEQKQSSESILEFIDGQLGIVEENLTESEDSLYKVSV-AS
A0A1Y3WMT8      RKRGQDILDTLIECYNEDAVLNKNLKAQNMLSFIDDRLATVENELHEAERVIEQYKR-EN
A0A1Y4GQU1      RRRGQDILDTLIECYNEDAVLNKNLKAENMLAFIDDRLITVENELHEAERVIEQYKR-EN
A0A6A0R272      PLLCKDFVDALVSSYSNVEFELKALAASNTIRFIDERLDQLSSTMNEVEDQITQFKQ-DK
A0A1V5W8T5      AQKTSDLVNTISEDFLTYNIEKKQERAEKVLAFIEEQMSVVYNKLDESEKQLDQFKK-SN
A0A2T8HKA9      PKRATDLIKTLIEVYNEQTVEEKNRVAVSTADFIRERIAIIERDLGTVETDLERIKM-DN
A0A2I0QZ80      PTFAKDIITALTKSFFKYDEGLKKESAENVLGFIASQLDSLTRELSISKDSVMRFQR-NE
A0A3E1F1A3      PQLATDMVKSLVSNFFNYDEDLNKESADNILDFINQQLDSLTQELSVSKDSIMYYQR-RE
A0A2U2XBJ3      PLLAKEMIQSLTANFFKYDENIKKESADNVLEFIAVQLDSLTRELKMAKDSIMVYQR-ME
A0A4Q4KU94      PTLAMEIVQSLTANFFKYDENIKKESADNILDFIAVQLDSLTQELKVAKDSIMAYQR-QE
A0A3B8INU3      RQKAQDMVGAITSIYQTYTKDQKKQANQQKIEFLDDQLMQTEERLDRYDKYFENFTI-SN
A0A2W1NDY9      NVLAQDMVREVVETFFTYDLEKKSKSSESILSFIDEQLDTVYNSLKFSENSIQSFTN-IS
A0A5C8AQR5      PVLCNDIVSAITSAFFEYDESLKKQSSDNILQFIESQLDSLALELKLSKDSLTDYQR-SS
A0A1G0CI31      AELCHDITNAVAEAFFTYDEEVKRKSAENILQFINKQLDSISGELQISKDSLTLFQR-SA
A0A556N0M0      PDLCKDIIQSVATTFFNYDEEMKRKSADNILSFIQLQLDSISGELKDSKDSLTDFQR-KT
F2IKD6          PELCRDIIKSVSLTFFNYDEEMKRKGADNILAFIQIQLDSISGELKDSKDSLTDFQR-KS
A0A1I7BM74      AHLSQDICNAVGESFFDYDDHLQQESSEKILKFINAQLDSLNKELILSRNALTEFQR-RE
A0A2G2FJ17      ANLAQDITKAIGDAFFEYDERYTKESAENILSFISLQLDSLRKELSASKDSIMYFQR-KE
A0A2E3R1D0      PQEAALISNTYAEAFAQLTQDQSRSGASASREFLEDQVETQNDRLQETDAAVEQYML-RE
A0A2T2USC0      ASEAALIANLYAQEYINYNERKSKESARSTRKFLEQQSKKFRNRVNRAEQRLEKFMR-EE
A0A2T2V0F3      ASEAALIANLYSQAYIDYNQRKSQESARSTRKFLEQQASKFKNRVDRAEQELESFMQ-EE
A0A2T2S682      PAEAALIADQYAAAYLQRTREKSRESLRAKRDFLDQQSDKFATQVQQADRALAKYMQ-KE
D5H561          PAVARRLANLFTEAYIELTQKSSRERVKASRTFLEQRSQELERELETIEQRIQRFQR-SE
A0A2H3NWA9      PQEAALLVNLFSEEYVEFSRDRSRQSVQATYDFLKEQSESLRVDMEEAEQNLVDFMQ-RE
A0A2A8CVB6      AADVALVANIYADEYIRRTKEKARESLQASRDFLERQAEKLKAEVQAAEGEIENYMQ-RE
A0A2P6C1S6      PNEASLVANLYAEEYIQRTQERSREDLRASRQFLEEQADTLRQDVQAAEQKIEEYMQ-RE
A0A2T2UTM4      PYEVSLIVNLYAEEYIQRTKEKSREDLKASREFLEEQADTLRQEVQAAEQKIENYMQ-EE
A0A414ZBF2      IGRAEDVLNTLIEAYKNDAIEDKNKVVINTANFIKDRLTIIEADLGVIDTEIEDYKR-EN
A0A1Q3Q573      PEKAKDIANALATEFIDYDLNKKREGMGNILRFIDGQIDSFSREQQAIQDSVAQFKI-NN
A0A662BAY3      VAKGIDFLNTLVAVYQAYTLERKNENASRTINFISTQLQTVSDSLGISENAMQAFQS-KH
A0A4U3L369      PSKGEFILNYFIQRYLRSSLEQRNQIADSTLSFINERLGIVTGELGNVEKQIALYKG-NN
A0A357YNR3      VALGRDFLVKYIQTYNEKGIADQIELADKTSRLIDDQLSKLSGELSDVENQVQIYKQ-SQ
A0A5E8AX52      KYKARDFVTAIDTLYLKYTTEEKNQAIEQKLSFLDEQLGITERKIEEYEDYFENFTI-EN
F4KK08          PLLAEDFLSTLILVYTELERSDKVKIAESTQRFVDDRLAIISSELGQVDAEIEDFKQ-SQ
A0A6B5PK86      SKLCHDVTLAVANTFIDYSVKLKKKSSESILQFIEVQLDSLSTELKRSKDSLMDYQR-EV
A0A2G2F510      PQLCKDITLAISNSYISFDEDMQRKGSENILGFIDSQLDSLSNELKSSKDSLMIFQR-KS
A0A316JZ08      ARMCRDLSLAIAEAYQEYDEEINRKSSENVLSFINNQLDSLYFELQSSQDSLADFHS-KS
A0A496LCF9      PARDVDFLTQHAKSFLGDNLDKKNYEADKTIQFINSQLSIISDSLTQSESNLNSFKI-AN
A0A5P2G2A9      PSKGEDVLDTLIKEYIKSNKDQKNAYADSTISFINDRLGLVSGELTNAESGLADYKK-KN
A0A3C0ZQC7      PKEAALIANTFAEAYYDRNLFSSRSRSRAAREFLDTQLKVRKSSLDESEGTLQKYME-QK
A0A3N2N6F7      VQRGDDFLSALIDIYNEKWVEQKAQMAVATSEFINERLNVIEKELGHVDDNIATFKG-EH
A0A419VXB7      PDQKISYLNELSRVYIQYGLQQKNQISDNTIHFINQQLKDIVDTLKSTSNEFTKYRS-SN
A0A0B0BTJ4      PQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKS-DN
A0A3B9CNN6      PQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKS-DN
R5X290          PQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKS-DN
A0A1Q6E6I7      PQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKS-DN
C3J7R8          PEVAEDFLNTLVQIYNENSRMEKVRVAQKTEHFIDGRLAIIGGELGSVDTEIEQFKQ-NN
A0A1G8BVM8      PQRAEDIINTLVTVYEKNAIDNKNQVLSKTVDFITDKTTILENELRSIDSDIEQYKK-EK
A0A1I1FXP9      PQKAHDIMVTIDSVYLEQTLEQKNKVNEQTLAFLNSQLDTTAQKLAMSEKEVERFIQ-VN
A0A4P7VVU7      IQRADDFLNTLIDIYNEKWVDDKAK-AKSTSRFIAERLRVIEQELGNVDSDIADFKG-EH
A0A2V1ILM4      IQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADFKG-EH
A0A3N2L0E8      IQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADFKG-EH
A0A3N2LFC5      IQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADFKG-EH
A0A7K3KWJ8      IQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADFKG-EH
A0A3N4H5N3      PARGKDIMSSVINGYNFLNLNQKNEVALKTINFIDERLALAREELNQVERDAEQYKQ-RN
A0A2P8EAX2      PTRGKQILNSLIEGYNTSNQNQKNEVALKTIKFLDEKLFLAKKELDSLEMYVERFKQ-RN
A0A4V2F6N9      PTRGKQILNALIDGYNSSNQNQKNEVALKTIKFLDEKLLVAKKELDSLEMYVERFKQ-RN
A0A3B9FXJ0      DQRAKDVVNTIADAIVTNGLERKSVSANSIISFIQSQIDSLENELYIQENILKDFKK-DA
R5GSU5          KKRAEDFLNVLLDVYKEDIIDGKNRIAESTAIFIDSRIKIIGDELNDVEGSLARFKE-RN
A0A2A3UE91      AAKSSDIVNAITEEYLAFDVERKSESSRNIISFIDSQLGNVYDALKDTEGDLQKFKK-DK
A0A0A2G557      TDFAEDFLNTLISQHDATSRSEKLKIAHNTEAFINDRITIISKELGDVDQEIERFKQ-NN
A0A2N2WFW8      PRKAADLVNKVAEEFAAFEVEYQKESSNSILDFIDTQLGLVEDNLDQTEDSMRQGKN-MS
A0A1F3IU95      PRKAADVVNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQTKDSLQQSSA-PS
A0A3D0VUF6      PRKAADVVNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQTKDSLQQSSA-PS
A0A1T4PT95      PHLAEDFLNTLINEHDTTSRLEKLKIARSTEAFINDRITIISKELGDVDHEIERFKQ-NN
A0A6I6JYY3      QEKGIHFLNKLTEIYQLDNLGKKNDNANRTIQFINSQLQNISDSLNVSENRMASFQS-EN
A0A2A4PYG9      PQKAADIVNSMASEFVEYDVEKKAQSATKILEFIDSQLLQVYDKLRSSENKMQGFKR-EN
A0A1F3K695      PLKTAEIANVIAEEFLTYDVEKKKESANQILSFIEEQESTFVKNIDETEKALHDFKK-EN
A0A353KZR1      PLKTAEIANVIAEEFLTYDVEKKKESANQILSFIEEQESTFVKNIDETEKALHDFKK-EN
A0A2N2WYB5      PEKAADIVNTIAEEYLKYDVESKKESAESILAFIEERLKLVYQNLDETEKQLHEFKK-EN
A0A1F3K4G0      AEKASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFKR-EN
A0A356H8Y3      AEKASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFKR-EN
A0A351HSA6      AEKASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFKR-EN
A0A1F3Q014      PQKAADIVSKMTEEYSNFDIERKGESSLKVIEFIDHQIDIVYEQLKSSETSIQEFTK-NN
A0A2D5KD44      RLKAFDIVNGLIDEFKLYNVEKKKQSSKQILDFLNAQIESVYEKQKVYERQIQRFKR-EN
A0A6N9NIX1      PFKIRDFVSGLIKEFQVYDINRRKKSSSRILDFINEQLGAVYQRQQKSERTIQEFKR-DN
A0A2A4YXP3      PKKAVDIVTAVANEYIIYDIEERSRSSKNALQFIDEQLDRYYNKLRLSEDKIKDFHQ-GT
A0A1F3R158      AVKTADILTSLANEYIIYDIEERSKSSKNVIEFLDDQLDKYYNKVKLSENSIEEFQK-TN
A0A2M8ADX2      ATKTADIITALANEYIVYDIEERSKSSKKVIEFLDDQLDKYYNKVKLSENSIEEFQK-TN
A0A1J5B2H0      AQKTSDIVNTIAEEFVIYDIEKKAESTNKIIEFIDNQINRMYDTLAKSENQLERFKK-TN
A0A1V5N756      PVKAADIVDTIISEFNLYDVEKQAMSTDKILKFIDEQLEIFNQKLFETKNDIQEFKK-EN
A0A651GU15      ATLARDFVMAHAHQYLQYDQESRELSASNIIRFIDNQIEEVYNELRETEFELSMFMK-DN
A0A3Q9FR88      REKAVAVLKAINTAYSQLSRESKALVYERALTYLFKQIDTTKDSLALQEKKMRAISY-GK
A0A553GEX3      REKAVAVLKAINTAYSQLSRESKALVYERALTYLFKQIDTTKDSLALQEKKMRAISY-GK
A0A150ADJ9      REKAIAILQSINLAYSQLSREGKALVYERALDYLYNQADLTRDSLSLQEKKLREISY-NK
A0A1B1FWQ4      RKKAERVLEAINKAYSQLSREGKALVYERALEFLYSQIDITKDSLNNLETKMREMSF-NK
A0A1S1Z228      RKKAEAVLEAINKSYGQLSREGKALVYERALGFLYSQIDITKDSLNNLEKTMRELSF-NK
A1ZKR2          PQKARDIVHVIDTIYLHKTLENKKRANTQQKAYLNRRLGEIEDSMRTYEAKIQSFML-KF
A0A1Q3GX01      PLKASNIVHVIDTIYLQKTLENKKRANIQQKEYLNRRLNEIEDSMRNYEGKIQAFKL-KL
A0A349DQI4      PLKAKHIVHVIDTTYLQKTLENKKRANIQQKKYLNRRLNEIEDSMRNYEAKIQGFKL-KL
A0A4P5TMD1      PLKAVDIINTLQEEFIKYNKERKTESSSLIIDFIDTQIGLLNTELQAYENQLKAFKI-EH
A0A2N3IIZ0      ATKARDVLKSISEVYRVKSVEIKNRANRQKKEYLDAQIEKTEKELNAYEAEMERFII-QN
A0A7K3WUF2      PGIARDFVVAHSSEYIQFDLENREKSAKSILKFIDSQLDTVYQNLRDSELQLNVYKK-EN
A0A1F3SJM1      AQLCHDVTLAISKAFQEFDEESKRQGADNIIRFIDNQLDSLRKELKSSKDSLMFFQR-SA
A0A2G2EB96      AVLCRDVVNAVSKSFIEYDEEQKRKSSDNIISFIDDQLDSLSSEVRIAKDSLIRYQR-KS
A0A2G6PRA9      ATLCRDVVQAVSESFIEYDEEQKRQSSENIISFIDAQLDSLSSEVRIAKDSLIEYQR-RS
A0A497D5Z2      EQKGVAFLNKLAEVYEQYNLGKKNENASRTIKFITSQLASISDSLSISEDLMQDFQS-KN
A0A662B170      EQKGVAFLNKLAEVYEQYNLGKKNENASRTIKFITSQLASISDSLSISEDLMQDFQS-KN
A0A2A5FYT6      GKKAKDISEAIAEGFINIDVERKSQSAEKVLNFIDTQIESVYGRLRTSETSMQSFQK-DN
A0A2E6SYP1      PEKCADIVNSLASAFLISNISKKKESANQMIKFTDDQVVKINKRLEYYRKLLKPYKE-LG
A0A2E5RLE8      PKKCADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQPYKE-IQ
A0A2E7TQF6      PKKCADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQPYKE-IQ
A0A2E6GVY9      PKKCADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQPYKD-LQ
A0A350JJ90      PAKASAICEQIAQTYLVFDHERKSESANQVLEFINQQIEEVYSKLKISEDLMSEFSQ-RT
A0A3M1CDV2      PQKTTDIVNTIAEEYLIYDVERKSESSKNILNFINAQLSVVYEELKNSETKLNEFKK-QN
A0A6C1QGZ7      AAKASDIVNIIAEEFGMYDLEKKTESANNILAFIDQQLSLLGSTLTTAEIELENFRK-EH
A0A4P5U6G4      PYRAADIVNAMNDEFISYDKEKKTESATLILNFIESQINLINAELQAYENQIKAFKI-QN
A0A2E2TFD1      PRKAADLANAISTGFIDYDLTRKIYSSTQVIEFIDSQISEVYGRLKESEVSIQEFKL-SN
A0A2E4ELE6      PRKAADLSNAISGGFIDYDLQRQITSSNQILEFIDHQSSEVFTRLKSSEVSIQEFKI-DN
A0A522EYA6      AAKTTDIVNSMAEQFKEYDREKKGESEQKILSFLEDQLAIAFERLRTAETSIYSFKK-EN
A0A2E3XZI5      TFFSKDICNSLAEIYIDYDLERKQLSSEKIVKFINNRKDSVQKKLILNEKKIRDFKK-LN
A0A6I7QXV0      PQKAKEIVETLTKEYINYDLERKQESASQILNFLNNQIDVFSDDLAQFQDTIKKFRI-EN
A0A2M7NLQ9      PYKAAIVTNTVVDIYFEKTLENKNKVYRQTINYLEDQVRIVQDSLERIEKRIDNYKQ-EN
I4AFR0          PYKAAIITNTIVDIYFEKTLENKNKVYKQTIDYLDAQTTIVQDSLEQVEKRMDDYKL-EN
A0A2N2Y3E5      PQKTSEIVNTISEQFLKYDVEKKKESADKILDFIENQSDLIYDELDKIEEQLILFRK-QN
A0A2D9D7T6      PELTRDMTQAIMDVFFLYEEEISKKNTDKILAFVDTQLDSLSTLLQKSKDSITSFQK-KS
A0A1F3PPL5      ALKTSEVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSETERQIHSFKK-EN
A0A357QK06      ALKTSEVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSETERQIHSFKK-EN
A0A662AEA4      ANKTSEMVNTIAEEYMKYDIEKKKESAQNILSFIDLQLKSVYKNLDHTEKQLHEFKK-EN
A0A0S2HYK8      SQQAADLVNAVAREFQRFEVEKKKESIQNILAFIERQLKNVYKTLDTTESKLQEFKK-EN
A0A2N5ZWN6      SQQAADVVNKIAQEFQLFDVEKKKESVKNILDFIERQLKNVYQTLDNTENKLQQFKK-DN
A0A2E0FJ09      QVLTKDVLGALIENFDQFDSIKRSESSNRIVEFIAMQKDSVSKKLKESERMLKDFKD-TN
A0A1F3FZ62      ATKSADIANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKTESDLDMFKR-MN
A0A1F3K211      ATKSADIANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKTESDLDMFKR-MN
A0A1V6I2U9      ARKSTEITNTIAEKFIEFDEAKKKESATNIIKYIDQQMENVFTQLNATEKDLHNFRE-QN
A0A2H0B957      ARKTSEIVNAIAEQFIKYDVEKKKESSQKILDFIEVQNNLIYQQLDSIEQLLIKFSI-TH
A0A1F3CFW6      AQKTSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQFGI-TH
A0A2M7E2T8      AQKTSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQFGI-TH
A0A2M7NC69      AQKTSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQFGI-TH
A0A1F3KLL5      AQKTTDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDENEKKIHDFKK-SN
A0A359D1M1      AQKTTDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDENEKKIHDFKK-SN
A0A0F2NS19      ALKTSDVITSLANEYILYDIEERSKSSKKIIQFLDDQLDKYYNKVKLSENRIQDFQT-SK
A0A2A5H8X6      ALKTSDIITSLANEYILYDIEERSKSSKKIIQFLDNQLDKYYNKVKLSENRIQDFQT-SK
A0A2H0GAU8      STKAKDIVTSLANEYILYDLEERSKSSKKVIEFLDDQLDKYYNRVKLSENKIQDFQS-NN
A0A2M8FTK1      STKAKDIVTSLANEYILYDLEERSKSSKKVIEFLDDQLDKYYNRVKLSENKIQDFQS-NN
A0A2A5B3B0      GEKAKEIITAVANEYIDYDIEERSKSSKKALQFIDQQLDKYYNRVKGAENRIQEFQE-GT
A0A5C6RXM7      AAKARDMVTAIAEEYIDFDIEERSKSSKKILEFVDIQLDKYYNKLKLSENKIQKFQK-DN
A0A1F3C1M2      ATKTSDVVNTISEEFLKYDVEKKKESDQQILAFIEDQESLLLKNIDQTEREIHDFKQ-LN
A0A1F3DS87      ATKTSDVVNTIAEEFLKYDVEKKKESDQQILAFIEDQESLLLKNIDQTERELHDFKQ-VN
A0A6A0R6K9      RIKTKDIVSSVIREFKVYNVEKKKQSSKQILEFLNDQIYNVYEKQRVSEKEIQDFKR-EN
A0A2E7CT70      PKFAQDVCNTISKVYIDYDLKKKALSSINIVQYINAQKDSVDKRLKLSEQEIQIFKK-AN
A0A2D5V560      PHFSKDICNSIVKNYMDYEIDKKQKSTDNIVSFITRQKDSVRKRLIRNEKDLRIFKK-NN
A0A2D7K5A8      PHFSKDVCNSFVKIYMNYEINKKQKSTDKIVAFIKIQKDSVKNRLIKSEKDLRIFKK-NN
A0A2E1XQ82      PHFSKDICNSIVEIYMNYEINKKQKSTDKIVAFIETQKDSVKNRLIKSEKDLRIFKK-NN
A0A5C8A5B4      VEKGQAFLNKLMETYIDYELDKQQQKGRKTIDFIDKQIGTVSDSLQKVENSMEQFRGVSG
A0A7C1LGX3      PTKSELILNTLIKKFNQDGINDRQQVSKRTLDFIDERFVYLSTELDSIEGGKQAFKT-RN
A0A4Y9ITE2      VPFAEKVVNALVEGYNERGIEENRVKNQITADFIETRLGSIAEELNAAEREVEAYKV-DN
A0A5M8NYX7      PQKGIDVINTLIGIYNQRSIAEKNYVANHTIDFINDRITTITEELSSSEQKVEEYKQ-VQ
A0A0E3V905      PAKGEAILNQLIREYNEAAIMDKNKVAASTLKFIEDRLNIVSGELASAERNVEQYKS-HQ
A0A553ETH6      RYKARDLVNAIDSLYLNYSKQEKTKENKQKIEWLDNELREIESQLEDYENYFETFTV-EN
A0A640Q161      PSLSAELANAVADVYIENYLQAKLDMTAKATSFLTDSLEGLKKKLDVAERNLARFYE-EN
A0A640QU49      PNLSAELANAVADVYIENYLQAKLDMTAKATSFLTDSIEGLKDKLDIAERNLAKFYE-QN
A0A1Q3PII2      PRKGEAILSQLIARYMKASIAEKNKVADNTIAFINQNLQRISSELAEVETSIEHFRK-HH
A0A351BXT2      KYEAMLIANLYSKVYQSFSLDLSREELTSLTGYLREEKENKFKDLAVAEGELEDYQK-NG
A0A2K8Z965      PSKGEAVINQLITEYDQAAIMDKNKVAANTLKFIEDRLNIVSGELSSVEKNVQSYKS-HQ
A0A418M8U8      PEKGEAVLNQLIDEYNQAAIIDKNKVAANTLRFIEDRLAILSGELTTVEKEVERYKA-TQ
I2GTA4          PEKGEAVLNQLIEEYNQAAIIDKNKVAANTLRFIEDRLAILSGELTAVEKEVERYKA-TQ
A0A2K8ZAJ2      PSRGEAILNQLISEYNKEAVVDKNNQASSTLNFIEDRLALISGELSNVEKEVESYKS-TH
A0A368JPA3      ATKGEAILNQMIANYSSASTTEKNRAVANTLSFIQTRLKLVSAELATLEKSIETYKA-VN
A0A5N1JI29      PTKGEAILNQMIANYSSASTNEKNRAVANALSFIQTRLKLVSAELATLEKSIETYKA-VN
A0A7K0EGC9      PVKGEAILNQMIANYNSAATNEKNRMVAGTLSFIQSRLKLVSGELALLEKSIENYKA-TS
A0A3P1BT12      PAKGEAILNQMIANYSSAATDDKNRVVASTLSFIQTRLKLVSGELAGLEKSIETYKS-AN
A0A3P1CI15      PAKGEAILNQMIVNYNSAATVDKNRVVASTLSFIQARLKLVSGELAALEKSIENYKS-VN
A0A4R8CUK1      PAKGEAILNQIIANYHSAAIGDKSRMIANSLVSIQARLKQLSGEQKALEKSIEHYKS-VY
A0A3D0MYJ7      FPEASLISIIYANSYLSYSLELSKSELTLKRKFLENEKEKKFNELSIAESNLENFQK-QN
A0A662AH13      PFEARLIANTYADAYEGLSLRYTRQQLTTVVEFLKNQRQVQYNALLDVEEKLKDFQV-EG
A0A5C7QA01      KIHITQVLNAILKAYSVQNIERRTAESAQTLKFLDEQLPELKKQLDNAEREFNKFRQ-QY
A0A3D3LS70      RTEARLIANVYAAAYLNYNLEFSRKGVKNVGDYLFEIKNKKLNDLNNSEAALQDFQQ-RG
A0A1G1TM36      PQRGIDVLNQLIAAYNNASATEKNKLTANALQFIDSRLGSLRGELNQAESAVTGYRS-QQ
A0A1G7ZF38      PRKGEAILNQLIERYQKASIQEKNKVADNTIAFINSNLTHISSELTQVETNIEQFRK-RH
C6VS52          ARKGEAILKQLIVRYQKASIDEKNKVADNTIAFINHNLERVSAELASVETNIEGLRK-QH
A0A2A4G4B1      AERGQLILEELVATYNKLEQDDKNLISENTAAFIDSRLKGITKELVMVEGHLESFKT-QR
A0A0P7X1V8      PYEASRVVDLAIETYTDVSTRINRSQARNAIDFLDSELDKVSMQLNYSEEQLRDFMN-QN
A0A6P1P355      PQRGEDILNKLIQEYNQVAIDKRNDLAAKTLEYVNNRIQLVGKELKALENELVHYKS-SQ
A0A5C8KAD6      PERSEDILNYLINSYNDMAVLDRNELAANTLDFVESRIQLVEKELKDLENEVVHYKA-TN
A0A5N1J695      PQRGEAILNNLIYAYDQAALNERNTLAANTMAFIEDRIKLIEKDLENVEEKVQQYKS-SQ
A0A3N2M1H3      VQRAEDILNTVLLVYNENWIEDKNKMAVATSAFIDERLRLIQQELGDVDSNIAKYQT-TT
A0A4S2G8T2      VQRAEDILNTVLLVYNENWIEDKNKMAVATSAFIDERLRLIQQELGDVDSNIAKYQT-TT
A0A212K7W5      AQRAEDILDTLITVYNKNWIQERTQIAVNTSSFIEERLNVIEKELGGVEDSISRFKS-QN
F5IU11          AQRAEDVLDTLITVYNKNWIQDRTQIAVNTSSFIEERLNVIEKELGGVEDSISRFKS-QN
A0A7C1QWC7      RELTVDFLNAYIQTYLDNDLAKKNSIALNTMNFIDAQLSEISDSLYLSESKLRDYRS-TH
A0A352Z1R7      PVQARDLVNTLVQVYLGQNIELKTEEASRTVSFIENQLKGLRGELEGAEQDLETYKS-SS
A0A0A2F501      IQRAEDFLNMLINVYNESWVKDKNQVAISTSLFINERLSVIEQELGHVDKDISSFKS-AN
R5B7P0          TQRAQDILNTLIAVYNENWVRDKNQIANSTSVFINDRLRVIEGELAGVDSDISAYKS-EN
R5B0L5          PERAVDLLNGVIAVYNEKWLADKNQVSVSTASFINERLAVIENELGHVDSDIASYQS-EH
A0A6I1TEC0      TKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKS-AN
A0A3R5XWG1      TKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKS-AN
A0A5P0Y910      TKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKS-AN
A0A414YFM3      TKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKS-AN
A0A6A7UIA7      TKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKS-AN
A0A6A7VPS3      TKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKS-AN
A0A374THP7      PKRAEDVISTIISVYRKNWLEDKNQMTISTSHFITERLGVIERELGDVDKNISAFKS-SN
A0A6G1VND1      PKRAEDVISTIISVYRKNWLEDKNQMTISTSHFITERLGVIERELGDVDKNISAFKS-SN
A0A0A2EVS5      IERAEDFLDTLISVYNENWVKDKNKIAVSTSQFINERLSVIEQELGAVDSDISSFKS-KN
A0A1T4NAJ7      IERAEDFLDTLISVYNENWVKDKNKIAVSTSQFINERLSVIEQELGAVDSDISSFKS-KN
A0A255T941      PKKAEDILNTLIEVYNENWILDKNQIAISTSQFIGERLGVIEGELGHVDANISSFKS-AN
A0A4P7VSV0      TQRSQALLNTLIGVYNEYWVRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYKS-AN
A0A7J0AX49      TQRSQALLNTLIGVYNEYWVRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYKS-AN
A0A3N2KCL3      TQRSQALLNTLIGVYNEYWVRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYKS-AN
A0A2V1IJY1      TQRAQALLSTLIGVYNEYWIRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYKS-QH
A0A4P7VXK7      TQRAQALLSTLIGVYNEYWIRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYKS-QH
A0A1Y4CHN5      IQRAEDVLNTLIAVYNENWLKDKNQIAVSTSMFINDRLKVIENELGTVDADIASYKG-EN
A0A1M6I2S6      IPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGYKS-EH
A0A1Y3V692      IPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGYKS-EH
F3PXM2          VWKAEDILNTLIEVYNEYWIRDKNQIAVSTSQFIGDRLGVIENELGHVDANIAGYKS-EH
A0A174AHH7      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A174JCE8      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A3E4JMC4      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A412SND6      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A414IEQ9      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A7K0HNT3      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A0M1W8D8      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A3R6GKX5      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EH
A7V4S1          VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EH
B0NU19          VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EH
D4V601          VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EH
A0A4Q0U3M9      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EH
A0A7J5G2G2      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EH
A0A7J5HH13      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EH
A0A397WLT5      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EH
A0A6A2J529      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EH
A0A6N8DDD8      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKS-EH
A0A015XH67      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A078RZN2      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A6M4L7F4      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A6L0K5          VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A7ACT5          VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A6KY94          VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A173UQR8      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A3R6HK75      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A412B7D1      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A412VNY9      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A414LTU9      VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
I9Q4U4          VQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKS-EH
A0A373ISF0      IARAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGHVDENISSFKS-EH
U6RF62          IARAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGHVDENISSFKS-EH
A0A662ZZD5      IQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EH
A0A3A5TI83      IQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EH
A0A415NEB6      IQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EH
A7AJ60          IQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EH
A0A7J5MKN5      IQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EH
A0A6A2JF01      IQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EH
A0A7J4Y8G3      IQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EH
A0A015UXN7      IQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EH
A0A6I2NTL0      IQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EH
A0A6I2Q447      IQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKS-EH
A0A016E4F9      IPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGFKS-EH
A0A6N3HG44      IQKAEDILNTLIEIYNEKWIQDKNQIAVSTSQFIGDRLSIIESELGNVDENIAGFKS-EH
A0A7K0HSP7      IQKAEDILNTLIEIYNEKWIQDKNQIAVSTSQFIGDRLSIIESELGNVDENIAGFKS-EH
A0A7K1HEJ5      IQKAEDILNTLIEIYNEKWIQDKNQIAVSTSQFIGDRLSIIESELGNVDENIAGFKS-EH
A0A6H9P0U9      IRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EH
A0A108TH71      IRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EH
I8VXH0          IRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EH
A0A412S0N6      IRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EH
A0A412IIJ0      IRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EH
A0A0P0FM97      IRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EH
R6KTP3          IRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EH
A0A139LU87      IRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EH
A0A1C6B3Y5      IRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EH
A0A6L3KCD1      IRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EH
E2NMQ4          IRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EH
A0A412YDB9      IRKAEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAGYKS-EH
R7DY01          IRKAEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAGYKS-EH
A0A414LGK8      IRKAEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAGYKS-EH
A0A415IPQ4      IQKAEDILNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKS-EH
A0A3E5BRW7      IRKAEDLLNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIENELGHVDENISSYKS-EH
K9DXS6          IRKAEDLLNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIENELGHVDENISSYKS-EH
A0A1M6KFV3      TRKAEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLDVIENELGHVDENISNYKS-EH
A0A1Q6G7L3      TRKAEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLGVIENELGHVDENISNYKS-EH
A0A413H235      TRKAEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLGVIENELGHVDENISNYKS-EH
A0A1M5B2J8      IQRAEEVLNTLISVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDNDISSYKS-QH
A0A255RCT5      IQRAEEVLNTLISVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDNDISSYKS-QH
A0A1Y4GLF5      TQRAEDVLNTLISVYNENWVKDKNQVAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A1H3XSC0      IQRAEDILNTLISVYNENWVKDKNQIAVSTSMFINERLRVIERELGNVDEDISSYKS-EH
A6LE40          TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A4Y1VPX5      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A6N2XMM4      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
B3JI46          TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A358R8U0      TQRAEDVLNTMISVYNENWVRDKNQIAVSTSMFINERLGVIERELGNVDENISTYKS-EN
R6WSB6          TQRAEDVLNTMISVYNENWVRDKNQIAVSTSMFINERLGVIERELGNVDENISTYKS-EN
A0A401LPX7      TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A6G0GNY9      TQRAEDVLNTLIAVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A6I1BFM0      TQRAEDVLNTLIAVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A3A5Z900      TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A7K0GW19      TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A285TGL6      TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A3A5RFX4      TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A1Q6IUW9      TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A413XDP6      TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A6N8CVT6      TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
K6AP24          TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A6I2NHV3      TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A078RYI7      TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A7I0QD01      TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
C7XEQ8          TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
D7INX6          TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
K5ZG55          TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A662ZYI7      TQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKS-EH
A0A3N2N9B8      IERADDVLSTLIDVYKDAWIRDKNEIAVSTSQFINDRLGVIESELGNVDQDISSYKS-AH
A0A3N2NMI0      IQRADDVLATLIDVYKDSWIRDRNEIAVSTSQFINERLNVIEGELGNVDNDISSFKS-EH
A0A359I8H7      TQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFKR-DH
A0A3N2KA63      TQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFKR-DH
A0A4Q0IMT7      TQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFKR-DH
A0A7J0B660      TQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFKR-DH
A0A3B9FAU3      PYRADDIINTLITVYKESWVREKNMLTIATTKFINERLAIIERELSGIDSDISSYKS-SN
A0A3C1E5L7      PYRADDIINTLITVYKESWVRDKNMLTIATTKFINERLAIIERELSGIDSDISSYKS-SN
A0A4Q0UAV1      PQRAEDVLNTLLDVYNQRYVIERNQAAQAASQFITDRLNVIENELGDVESNISNYRS-SN
A0A354SN68      IGMLNDILNAVIKAYNKKWVEDRNQVALNTSKFINERLKVIEKDLGLVDEDISSYKS-MN
A0A6L5XFL0      PFRAEDVLNRLYVVYNQKWVEDINQQAISTSQFIDQELRAIEAELSNVDEDISSYKS-KN
A0A3N2N595      TQRAQDLLNTLIGVYNEYWISDKNQVAVSTSNFINERLGVIEGELGHVDSDISSYKS-EN
A0A7J0ACS3      PQRADDVLSTLIGVYNENWIRDRNQIAVSTSNFINDRLGVIEGELGDVDSDISSYKS-AN
A0A0A2DUD9      QERADAILNTLVATYNESWLADRNLSAVSASLFIDERLGLIEKDLGEVDKNITKYKS-QH
A0A3P1ZBJ5      VERAEDVLKTLIDVYNQNWVEDKNQVAVNTSKFINERLRVIESDLGNVDKNISSYKS-SN
R5FHS9          IQRAEDILNTIIAVYKDRWVRDKNQVAVATSAFIDDRLKKIELELGNVDNSISSFKS-KN
A0A413TW79      TQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKS-RN
A0A7K0AAG2      TQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKS-RN
A0A7K0ASF1      TQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKS-RN
A0A3E5E9M7      TQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKS-RN
A0A3E4SK73      TQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKS-RN
A0A415GGC6      TQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKS-RN
A0A413DBH9      TQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKS-RN
A0A495WI87      IQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYKS-EH
A0A354M4S6      IQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYKS-EH
R7DH52          IQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYKS-EH
A0A7J5IAE7      IQRAEDMLNMLISVYNENWVKDKNQVAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A016CWA4      IQRAEDVLDMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A4P8LP09      IQRAEDVLDMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A0M1W0V2      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A139KA16      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A174VQ92      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A1Q6HCG0      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A1Y4JYM9      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A3A5QW67      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A3A5RQE6      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A3A6BP07      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A3E5E153      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A3Q9IP20      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A412WV15      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A413ICP6      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A414KYB9      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A5B3FWR2      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A7J5QHB9      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
E5WX00          VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
K0X3P3          VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A1C6H117      VQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A6I1AQV4      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A5C6L2P1      TQRAEDVLSMLISVYNENWVKDKNQIAVSSSMFINERLGVIERELGNVDEDISSYKS-EH
A0A412MJT7      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A3E4WKT5      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A3A5YY33      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A1E9CFZ7      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A373FYU5      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A3A5TZ72      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A3A5XBP2      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A3A6MEG9      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A3E4JP35      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A3E4KP40      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A3E4NX82      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A3E4XFU8      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A412RG70      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A412TD37      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A413GAA4      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A414M7I4      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A496BTA0      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A496D2V6      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A5C6KCA6      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A5M5AHM5      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A6I0Y5K7      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A6I1BFB8      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A6I2P5W5      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A6N8DC51      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A7J5HGP0      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGIIERELGNVDEDISSYKS-EH
A0A7J5HVL8      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A7J5JHD3      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
E5UZA2          TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A069SMG6      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
C3RFN5          TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A3A5Z014      IQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A7J5GD93      TQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A7K0HGR5      TQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A078S3Q8      TQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A069SJV7      TQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A3E5DXI5      TQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A3E5EM98      TQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A6N2YYD4      TQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
I9T3G6          TQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A3E4SYU0      TQRAEDVLSMLISLYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A6LGY1          TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
K5ZSH4          TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A6A2RTB3      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A7J5PEN4      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A1M4YZ07      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKS-EH
A0A7J5I238      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A0P0FQW1      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A7K0I229      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A5M5C0W6      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A642NJ89      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A6L3JTQ2      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A7J5FQU6      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A7J4YLH7      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A6N3AEV2      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A6G0G4T5      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A6L3KG29      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKS-EH
A0A1Y4PQK7      PARAEDILNTVISVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYKS-EH
A0A1Y4IH41      PARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYKS-EH
A0A3A6AAP4      PARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYKS-EH
A0A6I0ZRD2      PARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYKS-EH
A0A7L4SP06      PARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYKS-EH
A0A1Y4DYA7      IQRAEDVLNTLIAVYNENWVKDKNQIAVSTSMFINERLEVIEQELGHVDENISSYKS-EN
A0A1Y3X4I9      IQRAEDVLNTLIAVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDENISSYKS-EN
A0A1Y4FNK8      TQRAEDVLNTVIAVYNENWIKDKNQIAVSTSAFISDRLGVIEQELGNVDENISSYKS-EH
A0A355FD59      TQRAEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISSFKS-KN
A0A359CEZ9      TQRAEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISSFKS-KN
A0A353Q7B4      TQRAEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISSFKS-KN
F8X3A5          TQRAEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISSYKR-QN
A0A1M3KVR9      TQRAEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISSYKR-QN
A0A4Y9IJS3      TQRAEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISSYKR-QN
A0A1H4ADG3      PEQGIDIMNGLIHVYQLSNIEDNNRITDSTIEFLNNRLFTVGAELDSIEGNIQHFKQ-HN
A0A5B8VUR8      PQQGIDIINGLIHRYQLSNIVDNNRIADSSIEFINNRLVTVGAELDSIEGNIQHFKQ-SN
A0A0D3L8Q3      PEKGKDILNKLIEVYNKEAVEDKNVIAANTIEFINERLQFLTEELTDVEKDVEEYKR-ER
A0A7G7G5F9      PEKGKDIINKLIEVYNKEAMEDKNSIATNTIQFIDARLKDLTGELSDVERNVEKYKS-QQ
A0A2N3U785      PEKGIDLVYHLISLYNKDKANDKKASAVNSLSFLDERIKFLSSELTDVEENVERYKR-SN
A0A5B6TJH8      PERAKDILNKLVEVYNKESIEDKNVLATNTLAFIDERLKYLTTELTGVEKNVEQYKS-QN
A0A519U664      PEKAKNIINKLMYVYNRESIEDKNLMAVSTLKFLDERLRLITAELSGVEKGVEKFKS-QN
A0A519MA34      PEKAKNIINTLMHVYNSEAIEDKNLMAVGTLKFLDERLRLITAELSGVEKGVEKYKS-QN
A0A519UCX0      PEKAKNIINKLMHVYNNEAIEDKNLMAVSTLKFLDERLRLITAELSGVEKGVEKFKS-VN
A0A0E3ZG78      PEKAKDIVNKLIEVYNKEAIEDKNLIASYTIDFIDERLRYLTSELSGVEKDVEQYKR-QH
A0A1I6BRK6      PERAKNIVDKLMQVYNDEAIDDKKQLGTSALKFLDERLKFVTTELSTVEKGVASYKS-TN
A0A243WAB1      PEKAKDILDKLMEVYNDEAVVDKNLMATSTLKFLDERLKYITAELSGVEKGVEKYKS-VN
A0A6G8C8X6      PEKARNIINKLIEVYNKEAIEDKNLMATNTLKFLDDRLKYITAELSGVEKGVEKYKS-IH
A0A416GA42      PQRAEDILNTLVDAYKEDIVNDKNTVARNTERFVVDRLAILEKELGNVDNQIASYRS-AN
A0A1T3IYP5      PERAADVLTALINVYNEVYLQDKNKIAENTANFIKDRLEIIEGELGSVESNIEDLKI-AN
A0A1T5K9D4      LQRANDILTAIVYRYNEEAVKEKNKVAVNTAEFIDSRIKIIRKELSDVEDMMSGYRS-TK
A0A077ENE7      SERAADILTSLITVYNDVYLQDKSKIAENTADFIKDRLAIIEGELGAVESNVENLKI-AN
A0A7H1Z2Z7      SERAADILTSLITVYNDVYLQDKSKIAENTADFIKDRLAIIEGELGAVESNVENLKI-AN
A0A6I5UW06      SERAADILTSLITVYNDVYLQDKSKIAENTADFIKDRLAIIEGELGAVESNVENLKI-AN
T0NN57          PERAADIITMLITVYNEVSLEDKNKIAVNTASFIKERLAIIESELGAVESDIENLKI-AN
X5K347          PERAADIITMLITVYNEVSLEDKNKIAVNTASFIKERLAIIESELGAVESDIENLKI-AN
A0A060RD97      PQRATAVLNTLIAEYNTESIMDKNRIARNTDIFIMERLAKLSKDLEGVDTDIADYKQ-QS
A0A3C1ITV0      EKRAEDVLNTLLDAYNEEWIRYTNKSTDNTAKFIDERLMSIERELGNVDSDIERFKS-SN
R7HN19          EKRAEDVLNTLLDAYNEEWIRYTNKSTDNTAKFIDERLMSIERELGNVDSDIERFKS-SN
A0A350IHV0      PRRAEDILNTLIDVYNEQWVANKNRSARNTTAFINDRLVVIENELGGVEESLKQYKE-TH
R5RVP0          PSRADAVLRTLIDVYNEHWVENKNRSARNTTAFINDRLIVIEKELGGVEENLKDYKS-SH
R6A0L2          IERADQVLATLYDTYKEDVVENKNRVALNTAKFIDDRIQIIGRELSSVENQLASFKK-RN
R7LG80          PKRAVDVLNTLYNTYKEDVVENKNRVALNTARFIDERLKLIGTELSDVENNLASFKK-RN
A0A2L2WX98      ETRAEDIINVVFDAYKRDIVANKNRVANNTAIFIDERIRIIDGERIASRDQMAKFLS-DN
G5GD56          TARAEDLLNTVYEAYKHDVVDNKNRVASSTANFIDRRVALIGQELTQVENRLASFKQ-QN
R5KD55          GKRAEDILSAVIDIYNKVWMKNRNEVSAGATKFLDERLAIIERELDNVDNDISRYKS-KN
A0A174QNT3      IARADAILATILQVYNETIVEDKNRIASNTARFIDDRIVIISHELGEVEDQLTIFKQ-EH
A0A4S2FGS1      IARADAILTSILQVYNETIVEDKNRIASNTARFIDERIVIISRELGDVENKLTTFKQ-EH
A0A7K3KG59      IARADAILTSILQVYNETIVEDKNRIASNTARFIDERIVIISRELGDVENKLTTFKQ-EH
R9I0H0          IARADAILTSILQVYNETIVEDKNRIASNTARFIDERIVIISRELGDVENKLTTFKQ-EH
K5BUT9          ISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQ-RN
A0A174FPA3      ISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQ-RN
R6S9Y6          ISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQ-RN
A0A7J4YSB2      ISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQ-RN
C9KX15          ISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQ-RN
A0A6H0KRK1      ISRADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFKQ-RN
R6DAG6          VSRADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFKQ-RN
A0A3L8AAP1      VSRADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFKQ-RN
A0A4S2AYX2      VSRADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFKQ-RN
A0A7J0A2L4      VSRADAILNALINVYNETIIEDKNRIAVNTAKFIDDRIAVIGKELGDVEEELTDFKQ-RN
A0A7K3MN31      VSRADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFKQ-RN
A0A0E2M2Y7      MDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-SN
A0A0K2J6Z0      MDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-SN
B2RKZ8          MDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-SN
A0A212GC82      MDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-SN
A0A254MU12      MDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKK-SN
R6CQ93          PLRAEDVLNTLVNVYNEEAVNDKNLVAVNTSKFINERLIIIQRELGGVETELESFKQ-SN
A0A3D1NQW3      PKKAEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEKFKK-DN
B0MT10          PKKAEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEKFKK-DN
R7JGW9          PKKAEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEKFKK-DN
A0A3D2BF46      PRRAEDVINTLIARYNDESINDKNRIADYTADFIDKRLRIIGSELDAVDRKISTYKK-DN
A0A358R538      PRRAEEVIDALVAVYNEDAVEDKRRISVVTSDFIRARLDVIGRELGDVDRGIEELKR-SN
A0A1Y4AAB8      PKRAEDVINTLITVYNNDAIADKRRISEETADFIHSRLEIIGSELNDVDRDIENFKR-DN
A0A1Y3WWY9      AKRAEDVINTLIDVYEKDAIDDKRRVSVTTAEFIKSRLEVIGRELGDVDRDIENLKK-DN
A0A1Y4U5L4      AKRAEDVINTLIDVYEKDAIDDKRRVSVTTAEFIKSRLEVIGRELGDVDRDIENLKK-DN
A0A1Y3VCJ1      PKRAEDVLNTLIEVYEQDAINDKRRVSVSTAEFIKSRLEVIGRELGEVDRDIENLKK-DN
A0A1Y3QTW7      PKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SN
R6XWY7          PKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SN
A0A4Y1X9Y9      PKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SN
A0A4Y1WM66      PKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SN
A0A6N4GYT3      PKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SN
A0A174AVF1      PKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SN
A0A656Q4F4      PKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKK-SN
A0A1Q6EIY0      PRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKK-SN
A0A5B5VN71      PRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKK-SN
E4M8L3          PRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKK-SN
I3YQ50          PRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKK-SN
R5UEY8          PRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKK-SN
A0A1H4D866      PRRAEDILNTLISVYNEDAIDDKRRVSVTTAEFIKARLAVIGRELGDVDRDIEDIKK-DN
A0A5B3G4Y7      PRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKK-DN
A0A374A9J5      PRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKK-DN
A0A5B3GQN5      PRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKK-DN
A0A1Q6E9S3      PRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKK-DN
D4IJ36          PRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKK-DN
A0A414Q925      VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
A0A415PUS9      VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
A0A108TCU0      VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
A0A413BA42      VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
S3Y344          VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
A0A7J5LEW3      VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
A0A412TGL3      VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
A0A413VJ33      VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
A0A414L0W6      VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
A0A412DP39      VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
A0A413ZSE8      VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
B0NP84          VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
R6AK43          VQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKK-KN
A0A412N2D9      VQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATVDAEIENYKK-KN
A0A1Y4JYS9      VQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATVDAEIENYKK-KN
R6LHA4          VQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIETDLATVDAEIENYKK-KN
A0A3E5HPT8      PTRAADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIEDLKR-AN
C6IJ48          PTRAADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIEDLKR-AN
Q8A3U2          PTRAADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIEDLKR-AN
A0A3R6S1H6      KARAEDIINTLIVVYNEDAINDKNQVAINTSNFINERLIIIEQELGGVESEIETFKK-EN
A0A3R6SD81      KARAEDIINTLIVVYNEDAINDKNQVAINTSNFINERLIIIEQELGGVESEIETFKK-EN
A0A354WXN6      IPRADDVLNTLIAVYKEDVINDKNQVAVNTSNFIAERLLIIEKELGSVDANIESFKR-EN
A0A7G1HW11      IKRAEDVINTLIAKYNEDAIADKNRLAVNTARFIDDRLEIISQELGDVDSQIETFKK-EN
R5IP14          IKRAEDVINTLIAKYNEDAIADKNRLAVNTARFIDDRLEIISQELGDVDSQIETFKK-EN
A0A316SZX7      PKRAEDVINTLIDVYNLDGTNDKKKVAESTANFIDERLLIIGKELGEVDSEIANFKS-TN
A0A1Y4AIY1      ASRAEDVLNTLIAVYNEDAIEDKNRITVSTSEFIAERLVIIEQELGSVDTDIETFKR-EH
A0A0J6CIR2      IPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-EN
A0A3D8HG59      IQRAEDIVNTLIAIYNEDVINDKNQITVNTSDFINDRLIIIEKELGNVDSHIESFKR-EN
A0A3R6S408      IQRAEDIVNTLIAIYNEDVINDKNQITVNTSDFINDRLIIIEKELGNVDSHIESFKR-EN
F3ZRU7          PQRAEDILNTLIDVYNEEAINDKNQMAMNTSEFINERLIIIEKELGGVDTQIETFKK-TE
A0A1C5Q1F3      PRRAEDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGVESQIADYKS-QH
R7A239          PRRAEDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGVESQIADYKS-QH
A0A3R6HIK7      IARAEDVLNTLIAVYNEDAIEDKNRVTVSTSEFIADRLVIIEQELGSVDANIETFKR-EN
K5ZVW7          IARAEDVLNTLIAVYNEDAIEDKNRVTVSTSEFIADRLVIIEQELGSVDANIETFKR-EN
A0A1Y4D5Z0      ISRAEDVLNTLIAVYNEAAIDDKNKVTISTSDFIADRLVIIEQELGDVDANIEAFKR-EN
A0A413VXJ7      IARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFKR-EN
I9RSN9          IARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFKR-EN
U6RJK5          IARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFKR-EN
A0A1Q6GA32      IARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFKR-EN
I9RPU6          TARAEDVLNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-EN
I8YFS5          TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFKR-EN
A0A7J4XCM0      TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFKR-EN
I8Y597          TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFKR-EN
A0A1Q6GBF5      TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-EN
I8YFZ3          IARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIENFKR-EN
A0A7J4XFW0      TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-EN
A0A1Q6GDH2      TARAEDILNMLISVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-EN
U6RSB0          TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-EN
I9GXM2          TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-EN
I9SIK1          TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-EN
A0A7J4XIJ5      TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-EN
I9TP59          TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-EN
R5S343          VARAEDVINTLIEAYNEDAVNDKNQIAINTASFINERLKIIDRDLGLVDSSIASFKS-EH
A0A1M6K7I9      IARAEDILNTLISVYNEDAINDKNQIAVNTSNFINERLIIIEKELGTVDADIESYKR-EN
A0A5M6A8C8      IARAEDILNTLISVYNEDAINDKNQIAVNTSNFINERLIIIEKELGTVDADIESYKR-EN
A0A7J4XCJ1      TARSEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKR-EN
A0A7J4XNQ7      TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFKR-EN
A0A3R5ZMK1      IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
A0A7K1HMX0      IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGSVDSDIESYKR-EH
A0A1Y3ZIA4      IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
K5Y1A4          IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
A0A7K1HDC0      IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
A0A3R6K8X4      IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
A0A6N8D6C8      IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
A0A3R6BKI7      IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
A0A412M2W1      IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
K5ZX55          IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
A0A415BDM7      IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
A0A1Q6I3T6      IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
A0A414XX40      IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
A7AEU7          IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKR-EH
A0A5F0U645      ASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-EN
K5ZBN2          ASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-EN
A0A0J6CKW3      ASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-EN
A0A0F5IQM7      ASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-EN
A0A496CDT3      ASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-EN
A0A6G1ZKM3      ASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-EN
S0GLB0          ASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKR-EN
A0A3R6NLC1      VSRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSVDAEIEVFKR-EN
A0A416WYC9      VSRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSVDAEIEVFKR-EN
A0A0F5IT40      IPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-EN
A0A496CX20      IPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-EN
A0A5F0UBI0      IPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-EN
A0A6G1ZHG0      IPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-EN
S0GSI7          IPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-EN
K5YB65          IPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKR-EN
A0A0F5IWP9      IPRAEDVLNMLIAVYNEDAINDKNQVTVNTSDFINDRLIIIEKELGSVDADIETYKR-EN
A0A0F5IZT8      IPRAEDVLNMLIAVYNEDAINDKNQVTVNTSDFINDRLIIIEKELGSVDADIETYKR-EN
A0A417LKQ2      IPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEKELGSVDADIETYKR-EN
A0A416TME1      IPRAEDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSVDADIETYKR-EN
A0A416XPE8      IPRAEDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSVDADIETYKR-EN
A0A3B0C2S4      PERSETVINELINKFNQDGIIDRQLISKRTLEFIDERFAYLSGELDSIEVGKEDFKR-LN
L8JI02          PHKTARFLDQLLHIYLQNELHKKNQLGVKTIQFIDSQLSGVSDSLKRVEGWLENFRA-KS
A0A4Q5WS95      PQRGEDILNNLIHDYNAASIDYKNSVARNTISFVDERMRIVQRELNAVEKQIQSYKA-QK
A0A501VZX6      PARGEDILNTLIYTYNSIAINERNKLAANTLEFVEDRIKLVEEELKDLENKVVKYKS-SE
A0A399SH26      PERGEAILNLLVHNYNQASVVERNILAENTLAFIEDRMQKVEKELDKLESRVQKYKT-SK
A0A501W1A9      PERGEDILNSLIKAYQQAALNERNQAVAQTLAFVESRIQLLEKELQGLEEKIVEFRS-TK
A0A0E3ZGV6      PERGEDILNALIHAYQKAAVTEKNSLVSQTLAFVEERIQLIEKELQNLEDKIVKYKS-TQ
A0A1I2N4S1      PERGEDILNALIDAYLQAAQVDRNALVSQTLAFVEDRIQLIEKELKVLEEQIVKYRA-SN
A0A2T5YE44      PERGEDILNALIDAYLQAAQVDRNALVSQTLAFVEDRIQLIEKELKVLEEQIVKYRS-SN
A0A1M5BA90      PERGENILNTLIQAYYRSAAKEKNVLAANTLSFIEGRISNVAKELDSIENRLQKFRN-QK
A0A512B879      TQRGKEILNLLISEYNQAAINDKNLLTSNTLSFVETRIKYVVRELDSIENQLRKFKT-DK
A0A559PPI3      PNRGEDILNGIIAAYNQNGIEDKNILAANTMKFIEARIRNIGNELDTLESENEQYRS-SK
A0A1T5CS78      PERAENILNRLIYQYNQKIIKDQNELALSTMTFIDERIENVEEELDELEYKIQQYKS-NE
A0A0Q9Z8F1      PERAENILNRLILEYNRKIIKDQNELAASTMTFIDERIENVEAELDELEYNIQEYKS-NQ
A0A2N0U0M7      PERAENILNRLILEYNRKIIKDQNELAASTMTFIDERIENVEADLDELEYKIEEYKS-NQ
A0A1V9FHD0      PQRGEDIMNHLLLAYNQLSIDEQRGTAANTLAFIETRLKSVRHELDSIEGKIQTFRT-NQ
A0A4V4H170      PERGEDILNKLLVAYNRLSIEEKKGTAANTLEFIETRLGRVEKELDSIEHIIQSFRT-DK
A0A1V9F098      RDRGEDVVNKLLVAYNRLSIEEKKGTAANTLEFIETRLAKVEKELDSIEQRIQTFRT-DK
A0A4R2VU64      PQRGEDILNKLLVVYNRLSIEEKKGTATNTLEFIENRLFKVERELDSIEQKIQTFRT-EK
A0A4S8HY23      PERGEDILNKLLIAYNLLSIEEKEGAAANTLTFIETRLSKVEKELDSIERTVQSFRT-DK
A0A1V9F383      PRRAEDILNKLLIAYHLQSIEEKKGMAANTLEFIEARLLKVERELDSIESVVQTFRT-DK
G8TRZ6          PKRGEDILNRLLTDYTQQSIDEKQDQATNTLNFIEVRLGKVERELDSIESVVQTFRT-DK
A0A4R5DL69      PRKGEALLKKLTENYLSTSITDKNRIADSTIAFIDQNLHLVSLELKDIEEKIESFRR-KN
A0A1M4YED3      AYRAKDVLNELMNVYTINGLSEKDALAANTLATIEKRLTFVAKDLDSIERTIQQYKS-QK
A0A2H3NSN0      PEEAAAVANTYADAYRAYSRESARAGVAAAREFLETQLDRREEDIEEVENEWQQFAR-RH
A0A2P6C324      PAEAALIANSFAQQYRLFSREMARAGVVAAREFLETQLEKRKDDIRAIENEWEAFAR-SN
A0A7C2DZI7      PEEAAVIANRYAEEYEKYSRERSRESLAAARAFVENQVEQRRQELEGLERQWETFAR-SR
A0A1M6XHU0      PEEAAVIANRYAEEYEKYSRERSRESLAAAREFVEKQVEQRRQELEALERQWEAFAR-SR
G2SF81          PEEAAVIANRYAEEYERYSRERSRESLAAAREFVEKQVEQRRQELEELERQWEAFAR-SR
A0A5S9EYW1      PEEAAVIANRYAEEYERFSRERSRESLAAAREFVEKQVEQRRQELEELERQWEAFAR-SR
D0MHQ9          PEEAAVIANRYAEEYERFSRERSRESLAAAREFVEKQVEQRRQELEELERQWEAFAR-SR
A0A126PFG0      PQRGMDVLNQLMAVYNGAATAAKNKLTANTLHFIDSRLASLRGELSQAEADEAGYRS-QQ
A0A3M1N7Z3      PVRATRFLNALIEQAREHERSIRQLQYTKALGYIDTLVNFFQNQLLVA----------QD
                                                                            

A0A1T5MMH4      KTNDLQ-----EDLRKTIESINKIDS---QRYELSRRL----DEINKLMDGL--------
A0A2W4R1L8      KTSNLD-----EELANTIRLIHEIDS---QRYQLTTRI----TGINELLDDM--------
A0A2E5CV79      SFFSSD-----GEASSVARQISALEN---DIYNTRSEL----NMRRERISFL-----NSK
A0A2D4ZVH1      LLIAVD-----PQTEEIISTIANLEV---EKQKLEVGL----VAVMSGIAQY--------
A0A0K8QSK7      RVIDLS-----AQSQQLLQQMSELDN---QRVVLESQL----KYYRYLRNYI-----I--
A0A1V6CN82      RIFDIG-----SQSGQLLSEMSELDS---KKQELETQN----KYYNYLKTYI-----L--
A0A1M4XZ45      QVLDIS-----MQSQQLLEQMRDLDQ---QRVALETQN----KYYHYLRDYI-----STS
A0A399D319      QVLDIS-----MQSQQLLEQMRELDE---ELVTLETQN----KYYHYLRDYI-----HSD
A0A1V5IPN7      KLIEIS-----ETTRKWIEQTTQVES---QYEAALTEQ----AVKAKTLDVLRKQLQDQD
A0A1M6GR99      KLMNID-----EQSTRLAQQRLDLQN---QLAELMTQK----RYYDYIKEYN--------
A6EBM4          KVMDIS-----VTSEHTLDKVSDLES---QQSILRIQL----IAIDQLRNTI--------
A0A7C5M4P4      KTVSLD-----EDIRRTVTQINRLDS---QRFKLQERL----DDLNDLSQQL--------
A0A1M6TTV4      RTTDLS-----RDLNNTIQLLNQLDS---QRFKIRNQI----TAIELASEQL--------
A0A4Q8RX32      QVIDVG-----MKASQIYDNLNALMA---EKEEKESHL----QYLEFLNSNF--------
K0X1U5          DLSDID-----AEAKIILEANSQYRK---LLLEAETQY----SIISMVDSFL--------
R5EXK3          DLSDID-----AEAKIILEANSQYRK---LLLEAETQY----SIISMVDSFL--------
A0A401UAP7      KTQDLT-----ADMSRTVEQINALDT---SSFTINSRL----RLIRKLKEDL--------
A0A1W2GF52      RTTDLS-----SDLTKTIALLNELDS---QRYNLREHL----AEVDLVGENF--------
A0A2G5L7B8      RTTDLS-----QDLNYTIRLLNQLDS---QRFNIRTQI----AAVELANKQL--------
A0A523GAC0      KTTDIQ-----TDLSNTIKAITVLDS---QNVILEKKL----TGIHQLQSNV--GNQTGA
L8JW09          RTSDLN-----EDLKRTIETINALDS---QRFQLTKRI----QAFDQLLADL--ENNKTE
A0A364XUP5      KTNNLD-----EDLKRTVTAISRLDS---QRYEFASRM----QELNQLSDGL--------
A0A1M5RLA9      KTNNLD-----EDLKKTVSAINRLDS---QRYELTNRI----VEVNTLMDGM--------
A0A385SFR9      KTNNLD-----EDLKKTVSAINRLDS---QRYELTNKI----VEVNTLMEGL--------
A0A5M4A9J4      NLLDLS-----YQSQQLLDQMVSLQE---QKEQLSTQK----SYYTYLLNYL--------
A0A5M4B1C7      KLLDIS-----YQSQQLLDQMVTLEE---QKEQLTTQQ----AYYRYLLQYL--------
A0A0D3LFR6      RTTNLN-----KDISNTILLLESVDS---QRVATRRQL----NNLTNLSSRI-------K
M7N6D4          KTTNLA-----GDINRTIIMMEAIDS---QRVQLRKQL----SSITSLASRI-------E
A0A4D7K1D4      QTVDLQ-----KDMAETIQFLNQLDS---QKRALKIYQ----IKIDKVQAQL--------
A0A5C7MX19      GYMDK------NELQTMSSEVSSTNI---IIRMLTQDI----LSIKSFKKIF--------
A0A1Q3ZMZ7      KLNNPD-----NVADQLIQKIDEANE---ESYLANNNL----STLKDLKRRI-----NST
A0A2D8JJW3      DILSSD-----GNANEHVEQFLKLKS---ERVAQQLKL----DDLINAKEIY--------
A0A2W2AFF7      ELTDIG-----EESKILLGSTSDYMK---QLTQSEVQL----SIVESLQKYL--------
R7PCR1          NIVDFQ-----KSAEAFLQQQGTARN---LALDYETQL----SVARYLESYL--------
A0A2N5YXE2      NIRSNTETLLFNKTNLYTTKMSELES---KLLNVDFEI----MTLEKVSEKI------EK
A0A1G9E2A9      RTLSIS-----STIGQTLEQIKNLRF---ERITYEQQL----PALDELEAYV------NR
A0A098LL25      RTVDVK-----QDFGKSGIKIEELEK---EKQVLKSRI----SMLGELKDLI--------
A0A6J4H627      KSSDVG-----AEVGKYALKIDDLLK---SRSDLAIQL----SLLNRLQELI--------
A0A6C0GJI1      RTTDVK-----SDVSKFVTNIEELNK---QRTELNSQL----SLLRNLQNII--------
A0A2T2YJE8      KTYDVR-----ADVSKSITKLEELNK---ERINLHLQI----SLLNEVDQLL--------
A0A7L7LEW0      KTYDVR-----ADVSNRMSKLEVLNK---RRIDLRLQI----SLLNEVEQLL--------
A0A127B287      KSYDVK-----AGLEGAMTQIQELEK---EKYDLRFRN----SLLSDIQQRI------RK
A0A6P1P2P6      KSYDVK-----AGLEGAMSQIQELEK---EKYALRFRN----SLLGDIQQRI------RK
A0A3M9N829      KSYDIR-----SSFQEAITEYRELEQ---KKLEQRFLL----TLYNTIQSKM------QQ
A0A0P0CSF9      MSYDLK-----ANFQEALAQVQELEK---EKLELRFQL----SLLNTIQTKV------QR
A0A5M8QQB8      KSYDIK-----ANLQEALSMVQELEK---EKLELRFQL----SLLNTIQAKV------QR
A0A3M9MNC3      KSYDIK-----SNLQEALAQVQELEK---EKLELRFQL----SLLNTIQSKV------QK
A0A5B6TAX2      KSYDIK-----SNLQEALGQVQELEK---EKLELRFQL----SLLNTIQAKV------QR
A0A7L5A132      KTFDVK-----NDMGTIVEQTAEMQK---EREELRLKI----NALADLTGLI-GQNRVFV
A0A512AYT3      RTYDIK-----AEVGTQLAKLETLNN---ERRELDIQI----GLLKDVARLV-SQAGQDE
A0A5M6CYN7      RTYDVK-----ADVSTQISKLEELGK---ARLDLSMRI----SLLRDVAQLI-N------
A0A369QP10      KTYDVR-----ADVNKQMTKLEDLNK---QRVDLRMEL----SLLNEIDQLI--------
A0A7G7G7M4      KTYDVR-----ADVTKQMGKLEELNK---ERVNLRLQI----SLLNEINQLL--------
A0A126PDF2      KTYDVK-----SEVAALASRGEDLEE---QRLKLNQNL----VLLSEISRMV-QQTHITR
A0A2Z3GKA1      KTYDVR-----SEVAALAAKGESLEE---QRLKLNQNL----VLLSEISRMVQQQTHITR
A0A502GZP7      KTYDVK-----SEVADLAAKSEDLEE---QRLKLNQNM----VLLNDIARVV-QQAHITR
A0A519SBU8      KTYDIK-----SEVSAIKGQMESLLK---ERLELEQKQ----RLLAEVRRLM-DSEQLTR
A0A4Q3JNZ3      KTYDVK-----GDMATIRGNLEKQQD---ERLKLQDKL----RLLAEVGRMM-NRDQLTR
A0A519Q9V3      KTYDVK-----GDMATIKGNLEKQQD---ARQKLQDKL----RLLSDISRLM-NRDQLTN
A0A0M3RW20      KTYDVK-----ADVGTLTEKLAEQEK---ERIELQKRL----DLLNGVARLI-QRERITR
A0A495VFX4      KTYDVK-----ADVGTLTEKLAEQEK---EKIELQKRL----DLLIGVARSV-QREHITR
A0A418R9X5      KVFDVK-----SEAGLVTNQLNMLES---QQEELQEQA----DMLAELSRLV-EQERLTS
A0A428JSJ3      RVFDVK-----SEASLINNQLTTQEA---EQEKLQEEA----DMLADLARLV-EQERLTD
A0A428KI59      RVFDVK-----SEANLVTNQLTAQEL---EQEQLQEQA----DMLAELARLI-EQERLTD
W8F1I6          RVFDVK-----SEASLVTNQLTAQEL---EQEQLQEQA----DMLAELARLI-EQERLTD
A0A246FQC0      GSYDVK-----GDVGQITGLLMELEE---ERTKLQQQA----DMMNDVARLV-EQDRLTV
A0A372E5P8      GSYDVK-----GEVSQLTGLLQTLEE---ERAKLQEQS----EMMSDVGQLL-DREQLTT
A0A1H3EMW1      GSYDVK-----GEVGTITGLLQELEV---ERAKLQEQG----EMMGDVGRLL-QQEQLTT
A0A1H9ZSN3      GSYDVK-----GEVGQITGLMQELEE---ERAKLQEQG----EMMNDVGQLL-DREQLTT
A0A1S9B3W0      KTYDAK-----SDLGAITQELSELQK---EREKLLRKA----TVLTEITRLV-EQERLT-
A0A1W1VRL3      RTYDVR-----ADAATVNGKILAQEE---KRQNLLQKQ----GLLADLSSLV-EQDQLTA
A0A7G6YQJ9      QAFDVK-----GELTTIASAIADQEV---ERQKLLEKV----KLLTELRSTV-DNDQIIG
A0A1M6R305      KTYDVK-----ATIGDLTGRLEKQEE---ERLRLVEKI----RLLNEVAALA-EQGTITA
A0A7G7W8X3      KTYDVK-----ATIGDLTARLEKQEE---ERLKLAEKI----RLLNEVAALA-EQGAITA
A0A4Z0PHK3      KTYDVK-----SELALITGKLAKQEE---ERLKMVEKA----RLLGEITRLV-EEDRLTQ
A0A2M9B9H9      KTYDVK-----TEVAGITEKLAEQEE---VRLKLVEKA----RLLGEISRLV-EQDRLTQ
A0A4Z0QCY9      KTYDVK-----GEVSAITEKLAKQEE---ERLKIVEKA----RLLGEITRLV-EQDRLTA
A0A5N1J2M4      KSYDIK-----SDVSASRLKIEELMK---ERQALRLKI----ALLDDVSALL-AKN----
A0A519S476      KTYDIT-----TEVEGLKTRLEKQQD---TRFELEGKL----RLLAEVGRIM-ARDQLTR
A0A4Q3JRW8      KTYDVK-----GDMASIKGNLEKQQE---ARQKLQDKL----RSLSDISRLM-NREQLTR
A0A519M923      KTYDVK-----GDMTAIKADLEKQQE---DRQKLQDKL----RLLADVSRLM-NRDQMTR
A0A4Z0ENW1      RTYDAK-----GELGIITDKLEKIEE---DRLKLEQKL----TLLSEVSRLT-SAEYLTP
A0A519UDB4      GTYDAK-----GQLGDISEKLLEIQK---GRSELEQRL----GLLTEVGRLA-SQELIMT
A0A3S0QKV1      KTYDAK-----ADVGTLTTQLSDLRK---ERETLQRKA----SLLTQVSRLV-QQERITS
A0A328BL48      RTYDAK-----GDLATITTQMQELAK---QREQILRRQ----GVLQELSRVV-ETERLIG
A0A5R8WLY4      RTYDAK-----GDLTAITTQLQELAK---QREEIQRRQ----GVLQELSRVV-EKDRVVG
A0A1I5WSL8      GTYDTR-----AELEAISGKMEKLEA---ERLKLTDKM----ILLTEIEVMA-RQDRLTR
A0A0U3JVM7      GTYDSK-----GEFSAITEKLEKLEA---DRLKLTDKI----NMLGEIAQMA-SQGSLTR
A0A1G1SSV2      GTYDSK-----GEFEAISGKLEKFET---ERLKLTDNI----AMLAEIANMA-NQDRLTR
A0A1G1SXV7      GTYDSK-----GEFEAISAKLEKFET---ERLKLTDNI----ALLAAITNMA-NQERLTR
A0A6G8CBJ6      KTYDVR-----RDAATVIDKIAIQEE---KRQELLQRQ----SLLADLSRLV-EQDQITS
A0A0W8EDI5      KTYDVK-----SDLATITEKMEALEE---EKEQLLRKA----GAIGEIAQLV-EQNQVMV
A0A3B7RBP8      KTYDVK-----SDVANIAEKMAALQE---ERVELQRKA----GALAEVASLV-QQNRVLT
A0A3R9P8H7      GTYDVK-----GDVGQIMTALKEQET---EREKLQEQV----DMLNDVARLI-EQDRLTD
A0A238WIA7      NLFDAE-----SELGTVTSAITTQQE---ERQELQEQI----NLLRNLSNQI-ESNQFVA
A0A212UCJ7      RLFDAE-----TELGSLTTILTTQQE---ERQKLQEQL----TLLRSLNSQI-AQNRIVA
A0A4Z0MQE1      KLFDAE-----SELGSLTTLLNSQEE---ERQKLQEQL----SLLRSLNSQI-EQNRIIA
A0A4Z0PCF4      KLFDAE-----SELGSLTGTLKEQEK---ERQELQEQL----TLLRNLNGQI-EQNRFVA
A0A6M6BED0      KLFDAE-----SELGSLTTLLSTQEE---ERQKLQEQL----SLLRNLNGQI-EQNRFVA
A0A5D6VDG1      KMYDVR-----SGVQTITDQLDEQEK---EQQALQRRL----ELLTSVARLT-SRDRIAR
A0A243WHR7      KTYDVR-----GDLASISDKLLEQEK---ERLQLQQQI----DLLDEIVALV-ESNQLTN
A0A5B8A0P6      KTYDVR-----SDVSTVIAKLAQLEE---DRRKLDEKS----RLLEEVSRLV-EQERLTT
A0A076HRT9      KTYDVR-----ASIGEITARLEKQEE---ERLKLSEKI----RLLNEVADLA-ERGTITS
A0A4Z0PVM7      KTYDVK-----GEVSVITDKLAKQEE---ERLELEEKA----RLLGEITNLV-EQGRLTE
A0A1M6DHW8      KTYDVK-----ADVAAITEKLAAQAE---EQQKLAEKA----RLLSNVARLV-EQDRLIA
A0A4Q5LC61      KTYDVK-----ADVAAISEKLAEQEE---ERLKLTEKA----RLLGEVTRLV-EQDRLVA
K0XJ09          RIVSID-----AAATQFMSESSKMRD---ELVQLETEY----AIARAVERYL--T-----
R5EUZ0          RIVSID-----AAATQFMSESSKMRD---ELVQLETEY----AIARAVERYL--T-----
W0EQS0          RIVSID-----AAASQFMSENSQMRS---ELVQLEMEY----AIAQAVQKAF--S-----
A0A1Y3WE15      RIVSID-----AAASQFMSENSKMRD---ELVQLETEY----AIAQAVQRAF--A-----
A0A1Y4GUK3      RIVSID-----ASANQFMSENSQMRT---ELVQLETEY----AIAQAVHRAF--T-----
A0A2U1FKU2      NITDIT-----TDVGTYLKNSSDLQK---DQLIVERNL----SLAKYIQAFL--R-----
A0A0A2F954      NITDIS-----TDVGAYLKSSADLQK---DQLIVERNL----SLAKYIQSFL--R-----
A0A0A2FW91      NITDIS-----TDVGAFLKSNADLQK---DQLVVERNL----SLAKYIQSFL--R-----
A0A2D2N2N1      NITDIS-----TDVGTYLKSSADLQK---DQLIVERNL----SLAKYIQSFL--R-----
Q7MWZ2          NITDIS-----TDVGTYLKSSADLQK---DQLIVERNL----SLAKYIQSFL--R-----
T2NDT6          NITDIS-----TDVGTYLKSSADLQK---DQLIVERNL----SLAKYIQSFL--R-----
W1R7P9          NITDIS-----TDVGTYLKSSADLQK---DQLIVERNL----SLAKYIQSFL--R-----
A0A1R4AFZ0      NITDIS-----TDVGTYLKSSADLQK---DQLIVERNL----SLAKYIQSFL--R-----
A0A1R4DVZ7      NITDIS-----TDVGTYLKSSADLQK---DQLIVERNL----SLAKYIQSFL--R-----
A0A7C0WKI7      GIVALP-----EETQRMVDQVVEFQT---AYNTADIEL----KTYQTRLNYL--KSQLGD
A0A2A8CVM9      QVVTQGIGGE-RLVAEYTELTARRDA---LRFELEQEE----EALRLLRDQL--AQFEP-
A0A5M4B212      NLLDVS-----YQSQQLLDQLVKLED---QKSLLETQH----QYYQYLEEYL--S-----
A0A3D1KEX9      KIVDFT-----ENARTYLQQSALSQQ---ELNKTQAEL----SVAKYLREYV--V-----
A0A358Y7S2      RLPNIE-----KIGDNLSENLTNYSK---VILELEEEL----STLYLVQGKL--TSNP--
A0A1X7J248      KTINPS-----DDVSRLIAEMVKMDS---ILYGINYQL----GEIENIQKQL--EKDTLS
E4TQD2          KTVNPS-----QDVSRLISEMVSMDS---ILYGINYQL----AEINNIQSQL--DKDTLS
A0A2J6HHN3      PDSL-------EDKTGLKSRMRELDR---LISKTKYEK----EVLSAFILSV--EN----
A0A1Y3WMT8      DLSDID-----TEAKIILEANSEYRK---LLLEAETQY----SIISMVDSFM--N-----
A0A1Y4GQU1      DLSDIN-----SEAKIILEANSQYRK---LLLEAETQY----SIISMVDSFL--N-----
A0A6A0R272      RIIDFE-----SVERIESERLIDLES---SKRIAELRI----LNFNIVENEL--------
A0A1V5W8T5      NITGSIF----DDKAAIQNALMDNSQ---QIKQYDTQL----QSLQKVNKQI--AAG---
A0A2T8HKA9      KGMDVN-----EAAGMYITESREYLN---ASRELETQL----SLAEMMRDYI--Y-----
A0A2I0QZ80      NITNPE-----HLSGSISSKIEFLRT---EERNIIEEI----RVLKVVKEKL--NSDP--
A0A3E1F1A3      NITNPE-----YLTSSVASKMEKLKA---EENNALEEM----RVLETVKKKI--EGNP--
A0A2U2XBJ3      NITNPE-----QIAANTSQKIEKLRT---EIRQGMEEL----RVLNSVQDKL--EGNP--
A0A4Q4KU94      NITNPE-----FIASTTSQKIEILKL---EERNGLEEL----RILNSVESKL--KGNP--
A0A3B8INU3      QTTDLS-----SDLQKTIQQIWTLDT---LLGTARSKQ----KSVNRMFSSV--IDSADI
A0A2W1NDY9      KNNNPA-----LYKENLLDQIDQLRT---EVLQADLEY----DLILGLVEGI--NSK---
A0A5C8AQR5      NLPDPE-----GITSELNGNISKLKD---QLYTIEDEL----STLRMVSGKL--KAEP--
A0A1G0CI31      QLNDPE-----TDGLSLTQNMDQFQD---QLFMLEEER----SALKLVSSKL--RNDP--
A0A556N0M0      RLTDPE-----NTNGSLTENMDKFQD---MLFELENEL----ATLKTVHSKL--KLEP--
F2IKD6          HLTDPE-----GTGGSLSENMDKFQD---ILFDLENEL----TTLKVVNSKL--KTEP--
A0A1I7BM74      NLSDLE-----NIESNLSAKVNTLEN---ELEKLKIEH----QDLKRIKTEI--NNSP--
A0A2G2FJ17      NLPDPE-----NLGESIATKLEKYRF---DKFELQDEL----NTLEMISLKL--KQSP--
A0A2E3R1D0      GAVALQ-----EETSRLVDQIATLDA---RRDQAQVNL----VTKRAELAAL--QSELSR
A0A2T2USC0      NAVALD-----QETQQIVQQISEMQA---RRDELQIEL----DMESSALQSL--KEELAN
A0A2T2V0F3      KAVALD-----QETSRIVDQIANLQT---RQDELRIEL----DMKQSALTSK--QEELAN
A0A2T2S682      EAVSLD-----QEASRLVQQLSELEA---RRDELRIEL----DMAESALNTK--KKELKR
D5H561          DAVSLD-----QRQGSLTSRIAETES---SLEQARIEL----RMEQSSLESL--REELES
A0A2H3NWA9      EAVALD-----EETSSTVSRITSLES---ERAQLRIEL----EMTRARFNAQ--QDNIES
A0A2A8CVB6      GAIALD-----QESGRIVSDIAQMEA---EQRQLQIEL----QLARTSLDEK--RSELEK
A0A2P6C1S6      NAVSLD-----QETGRVVQQISELEA---QRAELRIEL----DMQQAALETQ--KEELGT
A0A2T2UTM4      KAISLD-----QETGRVVQQISELES---KRARLRIEL----DMKQATLETR--KEELRQ
A0A414ZBF2      KLTDVT-----SESALLLQNSSRLGG---ESLSIENEV----VMAEYIKDYL--Q-----
A0A1Q3Q573      EIFSDD-----NSSQGILTSANALQQ---ALIASENQL----YLLQNFKMLL--------
A0A662BAY3      KLLNIS-----IQSEQLLDQVNELEK---EKVVLETKN----KYYKYLREYI--------
A0A4U3L369      KIISPD-----VQAQLMASTYDENFK---LGNQLELQL----AIIKNLKEYL--Q-----
A0A357YNR3      GITDIA-----AQANLYNNQMANVGQ---RRMDIESQL----SIVSNLNDYV--Q-----
A0A5E8AX52      RTTNIQ-----TDLGRTIVLLQSLDS---QRYDLQNKL----TNIQMAQEQM--DKGE--
F4KK08          QIADIQ-----AEAQEYIKGSSEVKT---RLVELNNSI----SIAQFVRGHL--K-----
A0A6B5PK86      NLSDPE-----KEGDLMQTDANKFQE---ELFNLEDEL----STLQFINQRM--NENS--
A0A2G2F510      NLPNPE-----EAASNITDNISKLQD---QLFLIEDEL----NSLITVHKMI--GSSP--
A0A316JZ08      SVVDPE-----LSGGELNEKLNDLEL---QLSDIDKEV----ASLIAIDNQL--ERAP--
A0A496LCF9      NMYGE------NNTTILTSKMDELQQ---VGKQIRLRD----EYFKYLRNYL--K-----
A0A5P2G2A9      NIADLE-----AQAQAVISSSSEYEK---QLNQAQVQL----AIVNTMLDYV--L-----
A0A3C0ZQC7      GIVSLD-----DEAKKVIDQLATLEA---QRDAADIEL----QALSKTLTSY--QEELAK
A0A3N2N6F7      LVPDVA-----AASEMYMANANENTK---QQLGVMTQM----EITRFLIDYM--Q-----
A0A419VXB7      KVFDLS-----QEATLVTGKLSNLDT---KRSMAEMQL----EYYKNLRGYI--GE----
A0A0B0BTJ4      SAVDII-----SETKLSLETSRQYED---DLLKTEIQL----EMLSAIGDIL--------
A0A3B9CNN6      SAVDII-----SETKLSLETSRQYED---DLLKTEIQL----EMLSAIGDIL--------
R5X290          SAVDII-----SETKLSLETSRQYED---DLLKTEIQL----EMLSAIGDIL--------
A0A1Q6E6I7      SAVDII-----SETKLSLETSRQYED---DLLKTEIQL----EMLSAIGDIL--------
C3J7R8          RIADIQ-----QEARSYITGTAEFAR---QMTEVNNKL----AVANYLKDYL--K-----
A0A1G8BVM8      NLTDIP-----SVSSMYLDASSRINA---EALGLENQL----SIANYMKNYL--H-----
A0A1I1FXP9      RVIDVR-----DQVAEMITHVEKLKK---DKIELEIQN----SLLMDLRNTI--I-----
A0A4P7VVU7      LVPDVA-----AASAMYMEDANENTK---QQMQVSTQI----AISKFILDYI--K-----
A0A2V1ILM4      LVPDVA-----AASAMYMEDANENTK---QQMQVSTQI----AISKFILDYI--K-----
A0A3N2L0E8      LVPDVA-----AASAMYMEDANENTK---QQMQVSTQI----AISKFILDYI--K-----
A0A3N2LFC5      LVPDVA-----AASAMYMEDANENTK---QQMQVSTQI----AISKFILDYI--K-----
A0A7K3KWJ8      LVPDVA-----AASAMYMEDANENTK---QQMQVSTQI----AISKFILDYI--K-----
A0A3N4H5N3      RITDIG-----LDSRIFLESTQEMRK---EISDISSKI----EILESLENLI--NSQSSQ
A0A2P8EAX2      RVTDIG-----LDSRIYLESTASTSK---EISELSNKI----EILESIESLI--AVQGSG
A0A4V2F6N9      RVTDIG-----LDSRIFLESTASTSK---EISELSNKI----EILESLENLI--AVQGNG
A0A3B9FXJ0      QLINPS-----IAEQNLMTKFNELDQ---NKLDVQLEE----RSLKWLLDYA--N-----
R5GSU5          QIVDFE-----KSAQSALEEQRTLRL---SMLQAEVQL----SVAEYLEDFL--K-----
A0A2A3UE91      NISEKD-----KIITTELMRYSTIED---QMLQAQMEE----TLITEIQANI--AKN---
A0A0A2G557      QIANIA-----SEAEVYIESSKEITK---QTIEVNNAL----AVAGFIKEHL--T-----
A0A2N2WFW8      FDST-------LDRSSLQARLFELDN---LLAANISEL----ESLDRFYNTF--ES----
A0A1F3IU95      VDSS-------LDRTALQSRLFELDN---LISENSSEV----ESLEIFYKAF--SS----
A0A3D0VUF6      VDSS-------LDRTALQSRLFELDN---LISENSSEV----ESLEIFYKAF--SS----
A0A1T4PT95      QIANIE-----SEAEIYIESSKEITK---QTIEINNSL----AIARFIKEHL--T-----
A0A6I6JYY3      QVIDIS-----LQSQQLLEQMKELDN---ERVALETQN----KYYHYLRDYV--GNN---
A0A2A4PYG9      KLSQQ-----GDFITVYVXKLDNIEN---ELMDLELET----SMLDEVADMI--KKK---
A0A1F3K695      NINISESELNTLSLNLYASKIEEIET---EILNLDFEL----ITLKRIQEQI--NSK---
A0A353KZR1      NINISESELNTLSLNLYASKIEEIET---EILNLDFEL----ITLKRIQEQI--NSK---
A0A2N2WYB5      KLNLDKYPINGSPFPIFTAKISEFED---ELINIEFEL----VTLQRISTQV--NVD---
A0A1F3K4G0      KINTDQFKAEGSPFPLFTTKISELED---ELINIDFEL----VALQRINQQV--AND---
A0A356H8Y3      KINTDQFKAEGSPFPLFTTKISELED---ELINIDFEL----VALQRINQQV--AND---
A0A351HSA6      KINTDQFKAEGSPFPLFTTKISELED---ELINIDFEL----VALQRINQQV--AND---
A0A1F3Q014      NVTNT--DIENT---AKTTRLNALDD---QIISLELEE----NVLNKIETTL--SNS---
A0A2D5KD44      GITEI--DQFSK---VYIERMNQIDQ---AQVELEIEI----ATLEEIKKQI--KEGG--
A0A6N9NIX1      KVSGA--KEFSS---IFIERLNQLDN---AIVESTIQK----NILEEIYNQI--NVDP--
A0A2A4YXP3      NYTSM--DRSSS---YF-DRSNRLEN---ELIDVDLQQ----SVLKEVKKSI--SLNN--
A0A1F3R158      KLTDI--DKFSS---LYVDRVNKLEN---QLVDIDLQK----NVLEEINNSV--KGKI--
A0A2M8ADX2      KLSDI--DKFSS---LYIERVNKLEN---QLVDIDLQK----SVLEEINNSV--KGKI--
A0A1J5B2H0      KIDTIKLDVVPT---LF-SRQNELEN---QFSKLELEE----NMLNEVEITF--NAS---
A0A1V5N756      KIDLI-FQPLPE---VY-SIIKEFNS---EILKLEIEI----AKLKRVEEFV--NQS---
A0A651GU15      KISDLN-----RISEFYLSYFQQYDD---RQMELEYEE----KLLGELEKVA--LANP--
A0A3Q9FR88      DLSSY------MEAGPIVGNIQELEK---SLSSLKNEK----KKYQKLRHFL--EAD---
A0A553GEX3      DLSSY------MEAGPIVGNIQELEK---SLSSLKNEK----KKYQKLRHFL--EAD---
A0A150ADJ9      DLSSY------MDAGPIVNNIQELEK---SLNELKGER----KKYQKLRHFL--EAD---
A0A1B1FWQ4      DLSSY------MEAGPIVGNIQELEK---SLNSLKSEK----KKYQKLRTLL--QAD---
A0A1S1Z228      DLSSY------MEAGPIVGNIQELEK---SLNQLKSEK----KKYQKLRHFL--EAD---
A1ZKR2          KTNDVN-----KKLEESVKEIEKLIK---EKIVFNEQL----AAIKELDDLV--N-----
A0A1Q3GX01      KTNDVN-----EKLEKSVQEIEELLK---QKLALSDEL----AGIKELENLM--E-----
A0A349DQI4      KTNNIN-----EKLDKSVQEIEQLIK---KKLKFTDEL----AGIKEIENLI--A-----
A0A4P5TMD1      SLISTD-----SKQQEILTALKEINA---NEEGLNLDE----KNLNYYLGYF--N-----
A0A2N3IIZ0      KTNNIE-----GKISELVNKIQQLTE---ERYKINAKL----QTIIELEIFV--NQRF--
A0A7K3WUF2      KISNLD-----NLATLYFDYFRQFED---EMVLVDLET----NMLNQVLKAI--DEGKD-
A0A1F3SJM1      NLPDPE-----SISGTITENISKLND---ELYRLEEEQ----LSLDILDQKL--NAKV--
A0A2G2EB96      QLSDPE-----NAGISISDNVNKMQD---QLFELEEEY----NGLLNVKQKL--SKTP--
A0A2G6PRA9      QLSDPE-----NVGVSINENANKLQD---QLFELEEEY----NGLLNVKRKL--SKSP--
A0A497D5Z2      KIINIS-----LQTEQLLDQINDLDK---HRVMLETKD----KYYNYLRDYI--------
A0A662B170      KIINIS-----LQTEQLLDQINDLDK---HRVMLETKD----KYYNYLRDYI--------
A0A2A5FYT6      RITGND-----GFTGIYLERLNLLEN---EVINLELEE----SVLKEIEKKI--TANE--
A0A2E6SYP1      SSETKDDF---DYNQLTRDLKGKDEN---EKIELQASL----SDFTQFQLKL--SENP--
A0A2E5RLE8      ENNSEYGT---DYGKLALDLAAKDQI---EKTKTESTL----NDFRNFYSAI--SNKI--
A0A2E7TQF6      ENNSEYGT---DYGKLALDLAAKDQI---EKTKTESTL----NDFRNFYSAI--SNKI--
A0A2E6GVY9      KDNQEIKT---DYGKLALDLASKDQI---EKTKLETTL----IDFKNFYSSI--SNKI--
A0A350JJ90      KLTKKK-----GIAATYITRVNVLEQ---KKVELELKI----SLLSELRGGI--QIEK--
A0A3M1CDV2      NIVSTDNNS--ALSTSQSQIYSSVQE---QLLQIELNE----KLLDEILNNI--QTQ---
A0A6C1QGZ7      GI----DDVTITPLPMLQTRIADFEN---QIVMLQLEK----SIFSEIEKSL--QFE---
A0A4P5U6G4      GLISTE-----SKISEILTALNNIKQ---KQIMLNIKD----NMLYSYQDYF--N-----
A0A2E2TFD1      KVTGSS-----ELTGIYLDRLGNLEE---ELIKQELEQ----EILIQVKQAA--TSSS--
A0A2E4ELE6      KVSKTE-----NFTEMYIDRLALLEE---ELIKLELEK----DILDELKAAS--DGEK--
A0A522EYA6      KVTEVK-----NMPDAGSARLNSLED---ELISLELRA----NVLVELEKSI--EGK---
A0A2E3XZI5      DFENKT-----TLIENQTKRIEEIEK---ELTVINSNI----NLLNQFDLMF--DENLSS
A0A6I7QXV0      RYLNPT-----DEVQMVMGRLNRVEN---MMLELSFNL----QAIEWLENYI--SGQ---
A0A2M7NLQ9      GITSQKPEEYQALVQNILNDIRELQE---KRVEMDNEL----KLYREISTLL--EDD---
I4AFR0          GITSQNPQEYQSLVQNILNDIRDLQA---KRLDIDNEL----KLYKEISTLL--END---
A0A2N2Y3E5      NIKTDDEKDL-ATYRSVIERITRVES---DLEGIKVEV----DTYNNLLDYL--KK----
A0A2D9D7T6      KL----SNPD-NTTVELSSRINSFKT---RQLENEEEL----VTLYLIKSKI--TPNP--
A0A1F3PPL5      KISPNSDLNL-SAFPIYTSKIHEFDE---EIMNIEFEL----VTLNRIKSEV--AEN---
A0A357QK06      KISPNSDLNL-SAFPIYTSKIHEFDE---EIMNIEFEL----VTLNRIKSEV--AEN---
A0A662AEA4      KLNYNILSNQ-NSAPIFTTKITEFQN---EILNIDFQL----VTLNRIQKQI--VKG---
A0A0S2HYK8      NIPSEALER--TPFPIFTAKIEEFEE---QITTLDFEL----ITLKNVKTQL--ETN---
A0A2N5ZWN6      NIPSDAFER--SPFPIFTSKIEEFSE---QITQLDFEI----FTLENVNDQL--KKQ---
A0A2E0FJ09      KI----RQVE-GMTDSYLSRIEEMES---ELVKLDVDE----EILNEIATVI--TDNP--
A0A1F3FZ62      KIPDRLTDM--KSPPTYFSRVNDLQS---QLLNIEVEE----KMLEELEKNF--SSI---
A0A1F3K211      KIPDRLTDM--KSPPTYFSRVNDLQS---QLLNIEVEE----KMLEELEKNF--SSI---
A0A1V6I2U9      NILNIKDEYLFNKSNIYSSQISDIES---KILNVDFEI----MTLEKMLDKL--KSN---
A0A2H0B957      QIQGDKESST-SNVNRYANLLTKIEE---DIDITDIEI----SSLKQILDEI--SKT---
A0A1F3CFW6      QIRNDNDSKE-TGTERYSILLSKIEE---ELDNVEIDI----SNLKQILDEI--SKT---
A0A2M7E2T8      QIRNDKDSKE-TGPERYSILLSKIEE---ELDNVEIDI----SNLKQILDEI--SKT---
A0A2M7NC69      QIRNDKDSKE-TGPERYSILLSKIEE---ELDNVEIDI----SNLKQILDEI--SKT---
A0A1F3KLL5      -IDSALQNKL-SPLPLFTAKINELQS---EILKTDFEL----ATLKRIEKQL--SAG---
A0A359D1M1      -IDSALQNKL-SPLPLFTAKINELQS---EILKTDFEL----ATLKRIEKQL--SAG---
A0A0F2NS19      KI----GNPN-EVSSIYLDKINRFEN---QLIDIDFQT----SVLKEISKSV--TGKI--
A0A2A5H8X6      KI----GNPN-EVSSIYLDKINRFEN---QLIDIDFQT----SVLKEISKSV--TGKI--
A0A2H0GAU8      KI----GNPQ-EFSSIYLDRLNRFEN---QLIDIDFQR----NVLTEISKSV--SGKL--
A0A2M8FTK1      KI----GNPQ-EFSSIYLDRLNRFEN---QLIDIDFQR----NVLTEISKSV--SGKL--
A0A2A5B3B0      NF----STLD-R-SSIYFDRSSKLEN---DLFNIDLQK----KILEEIKTSI--SSND--
A0A5C6RXM7      NF----KGAD-A-TQKYFDRSTKLED---QLIDIELQK----NVLVEISSSI--ESEL--
A0A1F3C1M2      NIELTNQDNV-KPISIYLTKFTEIET---EILNIEFEY----STLKRINEYV--NKN---
A0A1F3DS87      KIELTNQDNV-KPISIYLTKFTEIET---EVLNIEFEY----STLKRINEYV--NKN---
A0A6A0R6K9      FL----PDVD-DYSRIMIDRISQLNE---AQVDLEVQI----SLLEEVKKEI--DKN---
A0A2E7CT70      NV----NSSL-MANKTQLSKISEVEN---KLVQNQVDI----TLLNQFQEMF--QSTLSK
A0A2D5V560      KX----NXXL-LNISGIKENXEKIEI---EIAKXQIDI----DLXNQFSDMF--ENXLST
A0A2D7K5A8      KF----KNEL-IGITGLKDKAEKIEK---EIVKIQLDI----DLMDQFSNMF--ENNLST
A0A2E1XQ82      KF----KNEL-ININGFQDKAEEIEK---EIVKIQLDI----DLMDQFSNMF--ENNLST
A0A5C8A5B4      GMINTA-----STQDALFQERSRLED---ERSNILKRR----NYCSSVLSKI--------
A0A7C1LGX3      NLSYIE-----ADAGVSLERKSETEN---DVIKLETQI----SLSALLKNSV--------
A0A4Y9ITE2      NFVDLV-----ADAQYIFTKKGTIDE---ALVTAETEY----EILEMTRELM--------
A0A5M8NYX7      GMTDLT-----AEAQLFLTSQSEYSK---KIIELQNQM----SVISSVKNYL--------
A0A0E3V905      GITDLS-----VQAQTFLQTVQQNDA---LMNQVQIQL----ATLNDLQKYI--------
A0A553ETH6      RTSDLN-----EDLKNLILIINDIDS---QRLSIK-------NKSKDIKIFL--------
A0A640Q161      QVVNID-----GVVGLAAEELEQLSK---QLLDAQTAL----KLNAVIYKQT--------
A0A640QU49      QVVNID-----GVVGLASDELEQLNK---QLLDAQTAL----KLNAVIYRQT--------
A0A1Q3PII2      RVIDAT-----EDGRQILERFHANAS---EEKELAVRM----KIVELLAAHL--------
A0A351BXT2      GLILLD-----AQVKNVVENISVLEA---QQNAARIELNSKQEEYNSLKSEI--------
A0A2K8Z965      GITDLS-----VQAQSFLETVQQNDA---SLIQVNVQL----AALNDLQKYV--------
A0A418M8U8      GITDLS-----TQAASFLQAIQQNDG---LLNQVNIQL----SALSDLQRYI--------
I2GTA4          GITDLS-----TQSASFLQAIQQNDG---LLNQVNIQL----TTLSDLQRYI--------
A0A2K8ZAJ2      GITDLS-----VQAEKFLTTVKDNDL---QLNDVNMRL----GALADVERYV--------
A0A368JPA3      GISGIG-----SGAQSLLSSLQSNDA---QLNRVAIQL----STLGDVEKYV--------
A0A5N1JI29      GISGIG-----SGPQSLLSSLQSNDA---QLNRVAIQL----STLGDVEKYV--------
A0A7K0EGC9      GITDIG-----AGAQALLNGLQSNDA---QLNQVAIQL----SALGDVERYI--------
A0A3P1BT12      RISGIG-----SDAQALLSTLQNNDA---QLNQVAIQL----STLGDVEKYI--------
A0A3P1CI15      RITGMG-----SSAQALLSNLQSNDA---QLNQVAIQL----SSLGDVEKYI--------
A0A4R8CUK1      RIAGMG-----PGAQWLLDTLQKNDA---QLSQLAVQL----SALGDVEQYI--------
A0A3D0MYJ7      GIVDVQ-----QNVSELLGKSSEVEN---IKNLGKIELNAVEIQINNLRRKI--------
A0A662AH13      GIIALD-----DQAKALIDILSTFEA---QRDATFIEMVATERTINVYKAEI--------
A0A5C7QA01      NTVDVS-----KESELYLSQSITLET---KK-----------------------------
A0A3D3LS70      GIVFLD-----DQAKSIVEQIATLEA---QKNASEVELITSRRTYDALKSEL--------
A0A1G1TM36      GLADVA-----SQSQIVLENTQANDT---RLNTAQVQL----AVVESIERYL--------
A0A1G7ZF38      RVIDMA-----EDGRQALQQYHSNAS---DEKQLAMHL----KIVGLLEAHL--------
C6VS52          KLIDIA-----EDTRQALQKLAANTS---EEREWATHL----KIVQLLEDHL--------
A0A2A4G4B1      VLTDLD-----MESGLYLRDNAQSRQ---EINTLSTQL----ELALLMKKSV--------
A0A0P7X1V8      QLVQLD-----AQAQQLIETLSTLEA---ESQGIQVKL----VAANSALEAY--------
A0A6P1P355      GVVNLS-----EQGKMYLSSVGESDR---NLSDINLQL----AILSEVEQYV--------
A0A5C8KAD6      GAVDLN-----EQGKLYLRNIGDNDR---RISEISNHL----SVLDQIEKFV--------
A0A5N1J695      GVVNLG-----EQSKLYLQSVGENDR---KIADINIQL----AVLQKVENYV--------
A0A3N2M1H3      GSPDLI-----ASAQASMEKESNLEQ---SILNIENQL----SITTYMKDFL--------
A0A4S2G8T2      GSPDLI-----ASAQASMEKESNLEQ---SILNIENQL----SITTYMKDFL--------
A0A212K7W5      LIPDIQ-----AASNMYMARSNENDT---KIQALSTQH----TIAKYILSHL--------
F5IU11          LIPDIQ-----AASNLYMVKSNENDT---KIQALNTQY----TIAKYILSHL--------
A0A7C1QWC7      QVTDLS-----YQGQQALNQMTQIEN---EKSTLKVQE----RYYNYILDYF--------
A0A352Z1R7      GMFKLD-----SEAQEVVKNLSETEK---LRAEVIFQK----KQVEFALDAL--------
A0A0A2F501      LIPDLK-----ETTRIYLDQTSEAEA---QLLDLSNQL----YMARYIRQHL--------
R5B7P0          MIPDVG-----AAATMYMQQSTVLNQ---QLQDVSNQL----YMARYIKDYI--------
R5B0L5          LIPNVQ-----QAASMYMTESQVVST---QMLELNNQL----QMTRYLRNYL--------
A0A6I1TEC0      LLPDVE-----TAAQQYMQKSSDLSK---QIMDFNSRL----SIAQYIRSSL--------
A0A3R5XWG1      LLPDVE-----TAAQQYMQKSSDLSK---QIMDLNSRL----SIAQYIRSSL--------
A0A5P0Y910      LLPDVE-----TAAQQYMQKSSDLSK---QIMDLNSRL----SIAQYIRSSL--------
A0A414YFM3      LLPDVE-----TAAQQYMQKSSDLSK---QIMDLNSRL----SIAQYIRSSL--------
A0A6A7UIA7      LLPDVE-----TAAQQYMQKSSDLSK---QIMDLNSRL----SIAQYIRSSL--------
A0A6A7VPS3      LLPDVE-----TAAQQYMQKSSDLSK---QIMDFNSRL----SIAQYIRSSL--------
A0A374THP7      LLPDVE-----AAAQQYMQKSTEVDK---QIMDLNSRL----AIAQYIRNYL--------
A0A6G1VND1      LLPDVE-----AAAQQYMQKSTEVDK---QIMDLNSRL----AIAQYIRNYL--------
A0A0A2EVS5      LIPDVR-----TASEMYMTQAGEAGT---QILALNNQL----YMARYIRGHI--------
A0A1T4NAJ7      LIPDVR-----TASEMYMTQAGEAGT---QILALNNQL----YMARYIRGHI--------
A0A255T941      LLPDVQ-----AASALYMNQSAESKK---AILELNSQL----TTAQYIRHEL--------
A0A4P7VSV0      LIPDVS-----AASSMYMSQNQQISQ---QIMDLKNQL----KQTLYIKSYL--------
A0A7J0AX49      LIPDVS-----AASSMYMSQNQQISQ---QIMDLKNQL----KQTLYIKSYL--------
A0A3N2KCL3      LIPDVS-----AASSMYMSQNQQISQ---QIMDLKNQL----KQTLYIKSYL--------
A0A2V1IJY1      LIPDVS-----AASSMYMSQNQQISQ---QIMDLRNQL----KQTLYIKSYL--------
A0A4P7VXK7      LIPDVS-----AASSMYMSQNQQISQ---QIMDLRNQL----KQTLYIKSYL--------
A0A1Y4CHN5      LLPDIQ-----AASSMYMSQSQETNA---QILELSMQL----SMAKYIKSYL--------
A0A1M6I2S6      LLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYIRREL--------
A0A1Y3V692      LLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYIRREL--------
F3PXM2          LLPDVQ-----AASSLYLMQSAENKK---ELLALNNQL----STARYIRGEL--------
A0A174AHH7      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYIRREL--------
A0A174JCE8      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYIRREL--------
A0A3E4JMC4      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYIRREL--------
A0A412SND6      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYIRREL--------
A0A414IEQ9      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYIRREL--------
A0A7K0HNT3      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYIRREL--------
A0A0M1W8D8      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----TTAQYIRREL--------
A0A3R6GKX5      LLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYIRREL--------
A7V4S1          LLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYIRREL--------
B0NU19          LLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYIRREL--------
D4V601          LLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYIRREL--------
A0A4Q0U3M9      LLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYIRREL--------
A0A7J5G2G2      LLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYIRREL--------
A0A7J5HH13      LLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYIRREL--------
A0A397WLT5      LLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYIRREL--------
A0A6A2J529      LLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYIRREL--------
A0A6N8DDD8      LLPDVQ-----AASNLYMSQSAENKK---EIQALTNQL----TTAQYIRREL--------
A0A015XH67      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFIRREL--------
A0A078RZN2      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFIRREL--------
A0A6M4L7F4      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFIRREL--------
A6L0K5          LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFIRREL--------
A7ACT5          LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFIRREL--------
A6KY94          LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFIRREL--------
A0A173UQR8      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFIRREL--------
A0A3R6HK75      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFIRREL--------
A0A412B7D1      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFIRREL--------
A0A412VNY9      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFIRREL--------
A0A414LTU9      LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFIRREL--------
I9Q4U4          LLPDVQ-----AASSLYMSQSAENKK---EIQTLTNQL----ATAQFIRREL--------
A0A373ISF0      LLPDVQ-----AASSLYMAQSAENKK---ELLTLNTQL----STARYILKEL--------
U6RF62          LLPDVQ-----AASSLYMAQSAENKK---ELLTLNTQL----STARYILKEL--------
A0A662ZZD5      LLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYIRKEL--------
A0A3A5TI83      LLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYIRKEL--------
A0A415NEB6      LLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYIRKEL--------
A7AJ60          LLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYIRKEL--------
A0A7J5MKN5      LLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYIRKEL--------
A0A6A2JF01      LLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYIRKEL--------
A0A7J4Y8G3      LLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYIRKEL--------
A0A015UXN7      LLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYIRKEL--------
A0A6I2NTL0      LLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYIRKEL--------
A0A6I2Q447      LLPDVQ-----AASSLYLSQSAENKK---ELLALNSQL----STAQYIRKEL--------
A0A016E4F9      LLPDVQ-----AASSLYMAQSAENKK---ELLALNSQL----STARYIRKEL--------
A0A6N3HG44      LLPDVQ-----AASSLYMAQSAENKK---ELLALNSQL----STARYIRKEL--------
A0A7K0HSP7      LLPDVQ-----AASSLYMAQSAENKK---ELLALNSQL----STARYIRKEL--------
A0A7K1HEJ5      LLPDVQ-----AASSLYMAQSAENKK---ELLALNSQL----STARYIRKEL--------
A0A6H9P0U9      LLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYIRREL--------
A0A108TH71      LLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYIRREL--------
I8VXH0          LLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYIRREL--------
A0A412S0N6      LLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYIRREL--------
A0A412IIJ0      LLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYIRREL--------
A0A0P0FM97      LLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYIRREL--------
R6KTP3          LLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYIRREL--------
A0A139LU87      LLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYIRREL--------
A0A1C6B3Y5      LLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYIRREL--------
A0A6L3KCD1      LLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYIRREL--------
E2NMQ4          LLPDVQ-----AASSLYMAQSAENNK---ELSTLNNQL----STAQYIRREL--------
A0A412YDB9      LLPDVQ-----AASSLYMAQSAENNK---ELSALNNQL----STAQYIRREL--------
R7DY01          LLPDVQ-----AASSLYMAQSAENNK---ELSALNNQL----STAQYIRREL--------
A0A414LGK8      LLPDVQ-----AASSLYMAQSAENNK---ELSALNNQL----STAQYIRREL--------
A0A415IPQ4      LLPDVQ-----AASSLYMAQSAENKK---ELSALNNQL----STAQYIRREL--------
A0A3E5BRW7      LLPDVQ-----AASSLYMTQSAENNK---ELSALNNQL----STAQYIRREL--------
K9DXS6          LLPDVQ-----AASSLYMTQSAENNK---ELSALNNQL----STAQYIRREL--------
A0A1M6KFV3      LLPDVQ-----AASSLYMAQSAENKK---ELSALNNQL----STAQYIRREL--------
A0A1Q6G7L3      LLPDVQ-----AASSLYMAQSAENKK---ELSALNNQL----STAQYIRREL--------
A0A413H235      LLPDVQ-----AASSLYMAQSAENKK---ELSALNNQL----STAQYIRREL--------
A0A1M5B2J8      LLPDVQ-----AAANMYMAQASEANA---AIKSLNNQT----YMARYIRNYL--------
A0A255RCT5      LLPDVQ-----AAANMYMAQASEANA---AIKSLNNQT----YMARYIRNYL--------
A0A1Y4GLF5      LLPDVQ-----AASNMYMMQSSETNS---QILALNNQL----YMARYIRNYL--------
A0A1H3XSC0      LLPDVQ-----AASSMYMAQSNQTNA---LILTLNNQL----YMTRYIRNYL--------
A6LE40          LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A4Y1VPX5      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A6N2XMM4      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
B3JI46          LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A358R8U0      LLPDVQ-----AASSLYMAQSSETNA---QIMALSNQL----YMTRYVRNYL--------
R6WSB6          LLPDVQ-----AASSLYMAQSSETNA---QIMALSNQL----YMTRYVRNYL--------
A0A401LPX7      LLPDVQ-----AAASMYMTQANEANT---AIRELNNQA----YMARYIKNYL--------
A0A6G0GNY9      LLPDVQ-----VAANMYMTQANEANA---EIRELNNQV----YMARYIKNYL--------
A0A6I1BFM0      LLPDVQ-----VAANMYMTQANEANA---EIRELNNQV----YMARYIKNYL--------
A0A3A5Z900      LLPDVQ-----AAANMYMTQANEANA---AIRELNNQT----YMARYIKNYL--------
A0A7K0GW19      LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
A0A285TGL6      LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
A0A3A5RFX4      LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
A0A1Q6IUW9      LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
A0A413XDP6      LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
A0A6N8CVT6      LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
K6AP24          LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
A0A6I2NHV3      LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
A0A078RYI7      LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
A0A7I0QD01      LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
C7XEQ8          LLPDVQ-----AAANMYMTQANEANA---AIRELNDQA----YMARYIKNYL--------
D7INX6          LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
K5ZG55          LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
A0A662ZYI7      LLPDVQ-----AAANMYMTQANEANA---AIRELNNQA----YMARYIKNYL--------
A0A3N2N9B8      LIPDVQ-----AASSMYMSENRQIAS---GIMDINNQL----QMTRFVRNYL--------
A0A3N2NMI0      LIPDIA-----AASSMYMSQNQQIAS---EILAINNQI----QMARFVRTYL--------
A0A359I8H7      RVPNLE-----EAAKTQMKQSVEMSN---KMLEVTNQM----SMSIYLRDYL--------
A0A3N2KA63      RVPNLE-----EAAKTQMKQSVEMSN---KMLEVTNQM----SMSIYLRDYL--------
A0A4Q0IMT7      RVPNLE-----EAAKTQMKQSVEMSN---KMLEVTNQM----SMSIYLRDYL--------
A0A7J0B660      RVPNLE-----EAAKTQMKQSVEMSN---KMLEVTNQM----SMSIYLRDYL--------
A0A3B9FAU3      LLPSVQ-----AASQMSMQQSQESQK---QVLALNTQR----SMAQYVKGML--------
A0A3C1E5L7      LLPSVQ-----AASQMSMQQSQESQK---QVLALNTQR----SMAQYVKGML--------
A0A4Q0UAV1      LIGDGS-----STANGAMQQRQQSQN---AILELNNRL----SLVKYLRREV--------
A0A354SN68      YVPNIG-----IATGMVMSQENSLDN---TIVSTNNKI----HMAYFIKEYL--------
A0A6L5XFL0      MVPDVA-----ANAALNLNKADQTSQ---QLLEFENQL----YMAKYIRKQM--------
A0A3N2N595      LIPDVD-----AASTLYMGESQRISQ---EIMGLRNQL----QMTRYIRNYL--------
A0A7J0ACS3      LVPDVQ-----AAAAIYMNQSQQAQA---KILEVNNQL----SMARYIRSYL--------
A0A0A2DUD9      LLPDVQ-----TASNLFLNQAAQVDN---QIVELRSRE----YMARQVRNLL--------
A0A3P1ZBJ5      LLPDVE-----SASKLYMQKTSANDD---KLMELNNQL----YMTRYVSQML--------
R5FHS9          LITDVD-----AVATSYLDQSTAANA---KLLDLNTQR----AMAQYVLSYI--------
A0A413TW79      LLPDVE-----TAAQQYMQKSGDVDK---QILELNSRL----SMARYLRDFL--------
A0A7K0AAG2      LLPDVE-----TAAQQYMQKSGDVDK---QILDLNSRL----SMARYLRDFL--------
A0A7K0ASF1      LLPDVE-----TAAQQYMQKSGDVDK---QILELNSRL----SMARYLRNFL--------
A0A3E5E9M7      LLPDVE-----TAAQQYMQKSGDVDK---QILELNSRL----SMARYLRDFL--------
A0A3E4SK73      LLPDVE-----TAAQQYMQKSGDVDK---QILELNSRL----SMARYLRDFL--------
A0A415GGC6      LLPDVE-----TAAQQYMQKSGDVDK---QILELNSRL----SMARYLRDFL--------
A0A413DBH9      LLPDVE-----TAAQQYMQKSGDVDK---QILELNSRL----SMARYLRDFL--------
A0A495WI87      LLPDVQ-----AASSMYMAQVNETDA---QLLALNNQL----YMARYIRNYL--------
A0A354M4S6      LLPDVQ-----AASSMYMAQVSETDA---QLLALNNQL----YMARYIRNYL--------
R7DH52          LLPDVQ-----AASSMYMAQVSETDA---QLLALNNQL----YMARYIRNYL--------
A0A7J5IAE7      LLPDVQ-----TASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A016CWA4      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A4P8LP09      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A0M1W0V2      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A139KA16      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A174VQ92      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A1Q6HCG0      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A1Y4JYM9      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A3A5QW67      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A3A5RQE6      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A3A6BP07      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A3E5E153      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A3Q9IP20      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A412WV15      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A413ICP6      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A414KYB9      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A5B3FWR2      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A7J5QHB9      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
E5WX00          LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
K0X3P3          LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A1C6H117      LLPDVQ-----AASSMYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A0A6I1AQV4      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A5C6L2P1      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A412MJT7      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A3E4WKT5      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A3A5YY33      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A1E9CFZ7      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A373FYU5      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A3A5TZ72      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A3A5XBP2      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A3A6MEG9      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A3E4JP35      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A3E4KP40      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A3E4NX82      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A3E4XFU8      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A412RG70      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A412TD37      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A413GAA4      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A414M7I4      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A496BTA0      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A496D2V6      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A5C6KCA6      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A5M5AHM5      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A6I0Y5K7      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A6I1BFB8      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A6I2P5W5      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A6N8DC51      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A7J5HGP0      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A7J5HVL8      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A7J5JHD3      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
E5UZA2          LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A069SMG6      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
C3RFN5          LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A3A5Z014      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A7J5GD93      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A7K0HGR5      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A078S3Q8      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A069SJV7      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A3E5DXI5      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A3E5EM98      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A6N2YYD4      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
I9T3G6          LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A3E4SYU0      LLPDVQ-----AASSIYMAQSSQTNA---QILALNNQL----YMTRYIRNYL--------
A6LGY1          LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
K5ZSH4          LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A6A2RTB3      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A7J5PEN4      LLPDVQ-----AASSMYMAQSSAANA---QILSLNNQL----YMTRYIRNYL--------
A0A1M4YZ07      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A7J5I238      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A0P0FQW1      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A7K0I229      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A5M5C0W6      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A642NJ89      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A6L3JTQ2      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A7J5FQU6      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A7J4YLH7      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A6N3AEV2      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A6G0G4T5      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A6L3KG29      LLPDVQ-----AASSMYMAQSSATNA---QILALNNQL----YMTRYIRNYL--------
A0A1Y4PQK7      LLPDVQ-----TASNLYMAQNSQISS---QILALNTQL----SLVRYIRNYL--------
A0A1Y4IH41      LLPDVQ-----AASNLYMAQSSQTSS---QILALSTQL----SMVRYIRNYL--------
A0A3A6AAP4      LLPDVQ-----AASNLYMAQSSQTSS---QILALSTQL----SMVRYIRNYL--------
A0A6I0ZRD2      LLPDVQ-----AASNLYMAQSSQTSS---QILALSTQL----SMVRYIRNYL--------
A0A7L4SP06      LLPDVQ-----AASNLYMAQSSQTSS---QILALSTQL----SMVRYIRNYL--------
A0A1Y4DYA7      LLPDVQ-----AAANMYMTQSNATNS---QILVLNTQL----AMTRYVRNYL--------
A0A1Y3X4I9      LLPDVQ-----AAASMYMTQSSETSS---QILALNTQL----AMTRYVRNYL--------
A0A1Y4FNK8      LLPDVQ-----AAASMYMAQSSETNA---QILALNTQL----SMARYIRNYL--------
A0A355FD59      LLPDVE-----AASGMYMEQSRETSN---LLLSLKSQL----SMANYIRNYL--------
A0A359CEZ9      LLPDVE-----AASGMYMEQSRETSN---LLLSLKSQL----SMANYIRNYL--------
A0A353Q7B4      LLPDVE-----AASGMYMEQSRETSN---LLLSLKSQL----SMANYIRNYL--------
F8X3A5          LVPDVD-----AASSMYMAQSRETSN---LMLDLNTRL----SMARYMRNHL--------
A0A1M3KVR9      LVPDVE-----AASSMYMAQSRETSN---LMLDLNTRL----SMARYMRNHL--------
A0A4Y9IJS3      LVPDVE-----AASSMYMAQSRETSN---LMLDLNTRL----SMARYMRNHL--------
A0A1H4ADG3      ELADLP-----TQSQSLIANAGENAK---ELAAQQVQL----SITNSLIEYM--------
A0A5B8VUR8      DLADLP-----SQSQSLISNAGANAK---DLATQQVQL----SITNSLIGYM--------
A0A0D3L8Q3      RLTNVG-----TEAQLYLQGRTGYDQ---QLSEYELQL----EILNSIEDYL--------
A0A7G7G5F9      LLTDVE-----ADARLSISNASDYTK---QLTDWGIQI----DVLTSLENYL--------
A0A2N3U785      EVTNLD-----SDARMYVEKAADYNR---QISEWQVQI----DVLQTIEDYL--------
A0A5B6TJH8      EVTDVN-----TQASDYLAQASDYNK---QLSEWAIQI----DILRSIEKYL--------
A0A519U664      ALTDIS-----SQASGYETQASNYTQ---QLAEWATQI----DLLESLESYL--------
A0A519MA34      ALTDIA-----SQASGYETQAASTTQ---QLSEGATQI----DLLESLEGYL--------
A0A519UCX0      ALTDIT-----SQASDFQAQNSTTTQ---QLSEWATQI----DLLESLESYL--------
A0A0E3ZG78      ELTDVN-----IQASNYLNIASGYNK---QLSDWAIQI----EILESIESYL--------
A0A1I6BRK6      SLTDIA-----AQATSYAEQATNYDS---QIAEWATQS----EVLESLENYL--------
A0A243WAB1      GLTDIS-----TQASDYTAQASDYNK---QLSEWGIQI----DVLESIENYL--------
A0A6G8C8X6      GLTDIS-----TQASNYTNQASDYNK---QLSEWAIQI----DVLESIETYL--------
A0A416GA42      QLID-G-----TQSGLYLQRADQFQN---EAVQLQTEL----ELTRYLKEFL--------
A0A1T3IYP5      QGIDIA-----TAGGTFLTEKNQYRS---EGAKVETDI----RLAEMMRSYL--------
A0A1T5K9D4      KLLDAN-----ADAAEYLSESRSYGS---DISQVETNL----SIAEYLRDYV--------
A0A077ENE7      QGIDVA-----TAGSLYLNEKNQYKS---EGTKIETDI----RLAEMMRSYL--------
A0A7H1Z2Z7      QGIDVA-----TAGSLYLNEKNQYKS---EGTKIETDI----RLAEMMRSYL--------
A0A6I5UW06      QGIDVA-----TAGSLYLNEKNQYKS---EGTKIETDI----RLAEMMRSYL--------
T0NN57          KGVDVE-----AAGGMYLSESNQYKT---EKTKIETDI----RLAEMMRSYL--------
X5K347          KGVDVE-----AAGGMYLSESNQYKT---EKTKIETDI----RLAEMMRSYL--------
A0A060RD97      NVLDFS-----AAANMYMQTSNEIRR---DAAEVENQI----AMANYIKDYL--------
A0A3C1ITV0      RLLDMN-----AETAQVTQESSKYSE---QAFLANNQL----AVARFIREYL--------
R7HN19          RLLDMN-----AETAQVTQESSKYSE---QAFLANNQL----AVARFIREYL--------
A0A350IHV0      KITDIA-----SISEAYLKESTDYSA---KSFEVNNQL----AIAKFIKEYL--------
R5RVP0          KITDIR-----SLSAAYLEESTEYKA---KSFDVNNQL----AIAKFIKEYL--------
R6A0L2          QLVDFD-----KTPQAMIDESSTARQ---QSLQAETQL----NVAKYLDEYL--------
R7LG80          SVLDFE-----TTAQSITQESSLARQ---KTLEAETQL----NVAQYLYNYL--------
A0A2L2WX98      KLTDFE-----QSAQMYLTESSAARK---QRLELETQV----AVARYLTQYL--------
G5GD56          RVIDFQ-----QAAGTVTAQSADARQ---QALQLETQL----SVARYLQEFL--------
R5KD55          LLPDVE-----KAYSLSMERADKNSA---ILLDLNTKL----SVAGYIRDYI--------
A0A174QNT3      RIVDIN-----ANANIYLQEGSKAKE---ESIQLEAQL----NVVEFIKKYV--------
A0A4S2FGS1      RIVDIN-----SNANLYLQEGSKAKE---ESIQLEAQL----NVVEFVKNYV--------
A0A7K3KG59      RIVDIN-----SNANLYLQEGSKAKE---ESIQLEAQL----NVVEFVKNYV--------
R9I0H0          RIVDIN-----SNANLYLQEGSKAKE---ESIQLEAQL----NVVEFVKNYV--------
K5BUT9          QIVDMS-----ANATQYLAESSKVKE---ESAQLETEL----SIARSIKSYL--------
A0A174FPA3      QIVDMS-----ANATQYLAESSKVKE---ESAQLETEL----SIARSIKTYL--------
R6S9Y6          QIVDMS-----ANATQYLAESSKIKE---ESAQLETEL----SIARSIKTYL--------
A0A7J4YSB2      QIVDMS-----ANATQYLAESSKVKE---ESAQLETEL----SIARSIKTYL--------
C9KX15          QIVDMS-----ANATQYLAESSKVKE---ESAQLETEL----SIARSIKTYL--------
A0A6H0KRK1      RIIGSE-----GNGTQFLAESSRMKT---ETLQMETEL----SIAQSIKSYL--------
R6DAG6          RIIGSE-----GNGTQFLAESSRMKT---ENLQMETEL----SIAQSIKSYL--------
A0A3L8AAP1      RIIGSE-----GNGSQFLAESSRMKT---ENLQMETEL----SIAQSIKSYL--------
A0A4S2AYX2      RIIGSE-----GNGSQFLAESSRMKT---ENLQMETEL----SIAQSIKSYL--------
A0A7J0A2L4      RIIGSE-----GNGSQFLAESSRMKT---ENLQMETEL----SIAQSIKSYL--------
A0A7K3MN31      RIIGSE-----GNGSQFLAESSRMKT---ENLQMETEL----SIAQSIKSYL--------
A0A0E2M2Y7      NITDIS-----TDVGAFLKSNADLQK---DQLVVERNL----SLAKYIQSFL--------
A0A0K2J6Z0      NITDIS-----TDVGAFLKSNADLQK---DQLVVERNL----SLAKYIQSFL--------
B2RKZ8          NITDIS-----TDVGAFLKSNADLQK---DQLVVERNL----SLAKYIQSFL--------
A0A212GC82      NITDIS-----TDVGAFLKSNADLQK---DQLVVERNL----SLAKYIQSFL--------
A0A254MU12      NITDIS-----TDVGAFLKSNADLQK---DQLVVERNL----SLAKYIQSFL--------
R6CQ93          QLMDIG-----SLAGRYMGEAQTYSA---DAMEQETQL----KLAQFIKEYL--------
A0A3D1NQW3      KIYDIV-----SEAEQTITESAQYKT---DGLSLENQI----RMTEFLKEYL--------
B0MT10          KIYDIV-----SEAEQTITESAQYKT---DGLSLENQI----RMTEFLKEYL--------
R7JGW9          KIYDIV-----SEAEQTITESAQYKT---DGLSLENQI----RMTEFLKEYL--------
A0A3D2BF46      EMYDIT-----AQATQSLTESSQFKT---AGLSVENQI----SMAQYIRDYL--------
A0A358R538      RMIDLQ-----SEAARNVTESSRYKA---EGLSLENQI----AVARFVSDYL--------
A0A1Y4AAB8      RMVDLA-----SEATRNVEESSQFKA---EGLSLENQI----NVAEFIRSYL--------
A0A1Y3WWY9      QMVDIA-----SEATRSVTESSQYKA---EGLSLDNQI----NVAQFIRSYL--------
A0A1Y4U5L4      QMVDIA-----SEATRSVTESSQYKA---EGLSLDNQI----NVAQFIRSYL--------
A0A1Y3VCJ1      RMVDIS-----SEATRSLTESSQYKA---EGLSLDNQI----NIAEFVRGYL--------
A0A1Y3QTW7      QMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYIRDYL--------
R6XWY7          QMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYIRDYL--------
A0A4Y1X9Y9      QMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYIRDYL--------
A0A4Y1WM66      QMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYIRDYL--------
A0A6N4GYT3      QMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYIRDYL--------
A0A174AVF1      QMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYIRDYL--------
A0A656Q4F4      QMIDIT-----SEATRSITESSKFKV---EGLSIENQI----SVANYIRDYL--------
A0A1Q6EIY0      KMIDIT-----SEATRTITESTRYKA---ESLTIENQI----SVADFIREYL--------
A0A5B5VN71      KMIDIT-----SEATRTITESTRYKA---ESLTIENQI----SVADFIREYL--------
E4M8L3          KMIDIT-----SEATRTITESTRYKA---ESLTIENQI----SVADFIREYL--------
I3YQ50          KMIDIT-----SEATRTITESTRYKA---ESLTIENQI----SVADFIREYL--------
R5UEY8          KMIDIT-----SEATRTITESTRYKA---ESLTIENQI----SVADFIREYL--------
A0A1H4D866      QMVDIT-----SEAARSVSESSKYKA---EGLSLENQI----NVAEFIRTYL--------
A0A5B3G4Y7      RMVDIT-----SEAARSVSESSRYKT---EGLSLENQI----NVAEYIRTYL--------
A0A374A9J5      RMVDIT-----SEAARSVSESSRYKT---EGLSLENQI----NVAEYIRTYL--------
A0A5B3GQN5      RMVDIT-----SEAARSVSESSRYKT---EGLSLENQI----NVAEYIRTYL--------
A0A1Q6E9S3      RMVDIT-----SEAARSVSESSRYKT---EGLSLENQI----NVAEYIRTYL--------
D4IJ36          RMVDIT-----SEAARSVSESSRYKT---EGLSLENQI----NVAEYIRTYL--------
A0A414Q925      RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
A0A415PUS9      RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
A0A108TCU0      RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
A0A413BA42      RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
S3Y344          RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
A0A7J5LEW3      RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
A0A412TGL3      RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
A0A413VJ33      RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
A0A414L0W6      RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
A0A412DP39      RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
A0A413ZSE8      RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
B0NP84          RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
R6AK43          RLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
A0A412N2D9      KLTDIA-----SESALYLKSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
A0A1Y4JYS9      KLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
R6LHA4          KLTDIA-----SESALYLQSSSMLDT---EGLSVENQL----NMAQYMKEYL--------
A0A3E5HPT8      NGVDIN-----TVAGMYIQDSRQYES---SIKELDTQL----QLVSFIKQYL--------
C6IJ48          NGVDIN-----TVAGMYIQDSRQYES---SIKELDTQL----QLVSFIKQYL--------
Q8A3U2          NGVDIN-----TVAGMYIQDSRQYES---SIKELDTQL----QLVSFIKQYL--------
A0A3R6S1H6      LLTDIV-----SETGIYLQNSNLYQQ---EGLGLENQL----SLARSIKEYL--------
A0A3R6SD81      LLTDIV-----SETGIYLQNSNLYQQ---EGLGLENQL----SLARSIKEYL--------
A0A354WXN6      QLTDIT-----SETGMYLQNTSQYNQ---ESLSLQSQL----QLAKYIKEYL--------
A0A7G1HW11      ELTDIT-----SEAGMSLTMKSGYMS---EGVSLENQI----SLVNFIKDYL--------
R5IP14          ELTDIT-----SEAGMSLTMKSGYMS---EGVSLENQI----SLVNFIKDYL--------
A0A316SZX7      KLTDIS-----SEAQSQLQQSSAFKK---EGLSLENQI----NLALFIKEYL--------
A0A1Y4AIY1      QLTDIT-----SETGMYLQNTSQYRK---EGLSLENQL----SVAQYIRDYL--------
A0A0J6CIR2      QLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYIRDYL--------
A0A3D8HG59      QLTDIV-----SETGMYLKESSEYSR---EGLSLENQL----TLARYIRSYL--------
A0A3R6S408      QLTDIV-----SETGMYLKESSEYSR---EGLSLENQL----TLARYIRSYL--------
F3ZRU7          KLTNIT-----SDAEMFITETTGLKK---EELEVLNQL----SLGQYIKDYL--------
A0A1C5Q1F3      NLADIS-----TQTGSFMERSNRYQQ---EGVTLENQR----TLALYIRDYL--------
R7A239          NLADIS-----TQTGSFMERSNRYQQ---EGVTLENQR----TLALYIRDYL--------
A0A3R6HIK7      QLTDIK-----SETGMYLQNTSQYKQ---EGLSLENQV----AVAKYIRDYL--------
K5ZVW7          QLTDIK-----SETGMYLQNTSQYKQ---EGLSLENQV----AVAKYIRDYL--------
A0A1Y4D5Z0      QLTDIS-----SETGMYLQNTSKYKQ---EGLSLENQL----AMAKYVREYL--------
A0A413VXJ7      QLTDIT-----SETGMYLANTSLYRQ---EGLSLENQL----SIAKYIKDYL--------
I9RSN9          QLTDIT-----SETGMYLANTSLYRQ---EGLSLENQL----SIAKYIKDYL--------
U6RJK5          QLTDIT-----SETGMYLANTSLYRQ---EGLSLENQL----SIAKYIKDYL--------
A0A1Q6GA32      QLTDIT-----SETGMYLANTSLYRQ---EGLSLENQL----SIAKYIKDYL--------
I9RPU6          QLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIARYIKEYL--------
I8YFS5          QLTDIT-----SETGMYLANTSRYKQ---EGLSLENQL----SIVKYIKEYL--------
A0A7J4XCM0      QLTDIT-----SETGMYLQNTSRYKQ---EGLSLENQL----SIVKYIKEYL--------
I8Y597          QLTDIT-----SETGMYLQNTSRYKQ---EGLSLENQL----SIVKYIKEYL--------
A0A1Q6GBF5      QLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIARYIKEYL--------
I8YFZ3          QLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIVRYIKEYL--------
A0A7J4XFW0      QLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIARYIKEYL--------
A0A1Q6GDH2      QLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIAKYIKEYL--------
U6RSB0          QLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIARYIKEYL--------
I9GXM2          QLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIAKYIKEYL--------
I9SIK1          QLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIAKYIKEYL--------
A0A7J4XIJ5      QLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIAKYIKEYL--------
I9TP59          QLTDIT-----SETGMYLANTSRYQQ---EGLSLENQL----SIAKYIKEYL--------
R5S343          RLTDAG-----LETGVFLQESSLYNQ---TGLGLDNQL----SLAKYIREYL--------
A0A1M6K7I9      QLTDIT-----SETGMYLQTTTKYKQ---EGLSLENQL----SLAEYIKQYL--------
A0A5M6A8C8      QLTDIT-----SETGMYLQTTTKYKQ---EGLSLENQL----SLAEYIKQYL--------
A0A7J4XCJ1      QLTDIT-----SETGMYLQNTSRYKQ---EGLSLENQL----SISKYIKEYL--------
A0A7J4XNQ7      QLTDIT-----SETGMYLQNTSRYKQ---EGLTLENQL----SIAKYIKEYL--------
A0A3R5ZMK1      QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
A0A7K1HMX0      QLTDIS-----SETGMYLQTSSRNQQ---EGLSLENQL----SLAKYIKNYL--------
A0A1Y3ZIA4      QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
K5Y1A4          QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
A0A7K1HDC0      QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
A0A3R6K8X4      QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
A0A6N8D6C8      QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
A0A3R6BKI7      QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
A0A412M2W1      QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
K5ZX55          QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
A0A415BDM7      QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
A0A1Q6I3T6      QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
A0A414XX40      QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
A7AEU7          QLTDIS-----SETGMYLQTSSQYRQ---EGLSLENQL----SLAKYIKNYL--------
A0A5F0U645      QLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYIREYL--------
K5ZBN2          QLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYIREYL--------
A0A0J6CKW3      QLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYIREYL--------
A0A0F5IQM7      QLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYIREYL--------
A0A496CDT3      QLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYIREYL--------
A0A6G1ZKM3      QLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYIREYL--------
S0GLB0          QLTDIH-----SEAGMYLQEGSQYSQ---EGLGLENQL----TLAKYIREYL--------
A0A3R6NLC1      QLTDIH-----SEAGLYLQEGSQYSQ---EGLGLENQL----TLAKYIREYL--------
A0A416WYC9      QLTDIH-----SEAGLYLQEGSQYSQ---EGLGLENQL----TLAKYIREYL--------
A0A0F5IT40      QLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYIRDYL--------
A0A496CX20      QLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYIRDYL--------
A0A5F0UBI0      QLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYIRDYL--------
A0A6G1ZHG0      QLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYIRDYL--------
S0GSI7          QLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYIRDYL--------
K5YB65          QLTDIS-----SETGMYLQESSQYSK---EGLGLENQV----TLAKYIRDYL--------
A0A0F5IWP9      QLTDIS-----SETGMYLQESSQYSQ---EGLGLENQL----TLAKYIRDYL--------
A0A0F5IZT8      QLTDIS-----SETGMYLQESSQYSQ---EGLGLENQL----TLAKYIRDYL--------
A0A417LKQ2      QLTDIS-----SETGMYLQESSQYSK---EGLGLENQR----TLAKYIRDYL--------
A0A416TME1      RLTDIS-----SETGMYLQESSQYSK---EGLGLENQR----TLAKYIRDYL--------
A0A416XPE8      RLTDIS-----SETGMYLQESSQYSK---EGLGLENQR----TLAKYIRDYL--------
A0A3B0C2S4      NLSYIE-----SDVDFSLQRKAVAQD---EVTNLETQI----SLAALLKNAV--------
L8JI02          NIQDIS-----YTAENLSKNLDRLES---EKADLQVKL----KYYTYISESL--------
A0A4Q5WS95      GIVDLS-----EQGKLYLKNVGEIDQ---KLAEVNMKM----AVLGQVEQYV--------
A0A501VZX6      GVVNLS-----EQGKLYLESVEGRDL---KMSDIDLQL----AVLDKVENYV--------
A0A399SH26      GIVDLS-----EQGRTFLQNMSANDS---KVEDINLQL----AVLAKIENYI--------
A0A501W1A9      GAVNLN-----EQGRMFLQNVGENDR---RLGEINLQL----AVLDNVESYV--------
A0A0E3ZGV6      GAVNLN-----EQGKLFLQSVDNNDR---RLNEINLQL----AVLDNVERYV--------
A0A1I2N4S1      GAVNLN-----EQGKLYLQSVDFNDR---RMNEINLQL----AVLDNVEKYV--------
A0A2T5YE44      GAVNLN-----EQGKLYLQSVDFNDR---RMNEINLQL----AVLDNVEKYV--------
A0A1M5BA90      GVVDLS-----EQGKLYLQNVGDNDR---KMTDINMQL----AMLNEVEKYV--------
A0A512B879      GVVDIS-----EQGRLYLQNVGDNDR---KMTEVNMEM----AMLNEVEKYV--------
A0A559PPI3      GVVDLS-----QQSRIYLQDAGHNDQ---RIADIRLKL----SVLDKVENYI--------
A0A1T5CS78      GVVDLS-----EQGRLYLQDVGENDK---QISELELQL----AVLNNVENYV--------
A0A0Q9Z8F1      GVVDLS-----EQGRLYLQDVGENDK---QISELELQL----AVLNNVENYV--------
A0A2N0U0M7      GVVDLS-----EQGRLYLQDIGENDK---QISELELQL----AVLNNVENYV--------
A0A1V9FHD0      GVVDLT-----EQGKQYLENVGTNDR---KIADLSMEL----AALDEMERYA--------
A0A4V4H170      GVVNLG-----EQSRQYLENVGSNDR---KIADLSMQL----AALGEMERYV--------
A0A1V9F098      GVVDLS-----AQGRQYLENVGSNDR---KMADLSMQL----ASLNEMERYV--------
A0A4R2VU64      GVVDLG-----AQGRQYLDNVGSNDR---KMVDISMQL----ASLNEMERFV--------
A0A4S8HY23      GIVDLG-----EQSKQYLENVGSNDR---KMADLSMQL----AALEEMERYV--------
A0A1V9F383      GVVDLG-----EQSKMYLENVGDNDR---KIADLSMQK----AALDEMENYV--------
G8TRZ6          GVVDLG-----EQGKMYLDNVGDNDR---KIADLSMQI----AAVDEMENYV--------
A0A4R5DL69      HITDMA-----EQSRLLLANSSLYDK---EKLQVNLEL----DMISSLQAFI--------
A0A1M4YED3      GIVDIS-----EQGKEFLRTVSDNER---QATSINMQV----STLDQIERYV--------
A0A2H3NSN0      DVAIDG-----QDGNRVATDYVEMMG---QRDQLEFQL----QEEQRTLDML--------
A0A2P6C324      AIVTEG-----LDGQNVAAEYAELQS---QRDALTFQL----EQEKRTLSIL--------
A0A7C2DZI7      QVVRLG-----PQGERLVAEVAQLEA---QRDAARFQL----EQERSALQFI--------
A0A1M6XHU0      QVVRLG-----PQGERLVAEVAQLEA---QRDAARFQL----EQEKSALQFI--------
G2SF81          QVVRLG-----PQGERLVAEVAQLEA---QRDAARFQL----EQEKSALQFI--------
A0A5S9EYW1      QVVRLG-----PQGERLVAEVAQLEA---QRDAARFQL----EQEKSALQFI--------
D0MHQ9          QVVRLG-----PQGERLVAEVAQLEA---QRDAARFQL----EQEKSALQFI--------
A0A126PFG0      GLTDIA-----SQSKVYLENAQANDS-----RLNEAQV----QLAV--------------
A0A3M1N7Z3      TLYRVE-----TKEDILFMEARKDRALSLYQDLNKLDK----SLSVEYLNAF--------
                                                                            

A0A1T5MMH4      --QTGN----------FSVN-PSIRQ-A-LPEYM--FKDIDEVQSLLLQ-----------
A0A2W4R1L8      --SNGV----------YLVN-PVHRL-Y-FPQAI--NDNLDKLSELQMS-----------
A0A2E5CV79      LSAEEK----------NFAT-KISTD-I-NAQMIVLRKEINQLESQSIQ-----------
A0A2D4ZVH1      --ENQL----------NEIK-PGLAD-L-YSDAI--GPVIERYQYALAELETNKL-----
A0A0K8QSK7      QNQELE----------SIMA-PSAMG-V-EDPMM--TSLTQELNTLTLE-----------
A0A1V6CN82      ENRDVG----------SILV-PSSVG-I-NDPLL--SGLLSQYNQLTVE-----------
A0A1M4XZ45      SSQEME----------TVIA-PSAMG-I-QDPLL--NSLILQLNELITE-----------
A0A399D319      TNKE-E----------TIIA-PSAMG-I-QDPLL--NSLILRLNELITE-----------
A0A1V5IPN7      SLLVKV----------ENVL-Q--------------APYIGELRRQITNTQATI------
A0A1M6GR99      -SDNSD----------DTQI-VPPSA-M-GVQDPLLNNLIEELSTAQTQ-----------
A6EBM4          -TTEQT----------NTPL-NLSLE-G-TIDPLL-ATLAQNLNSLLHE-----------
A0A7C5M4P4      ----KS----------GRKI-SLPGP-A-TEFPAHLVSLVDEMNLLINE-----------
A0A1M6TTV4      -DEGTP----------ISPV-DMPKE-I--------MQLLVDYNKLKNE-----------
A0A4Q8RX32      -NKDDD----------FTDY-SLTIL-S-DLNNQVLNDLLNEYVDLVGR-----------
K0X1U5          NKPENK----------YSLV-PVTTG-L-PDRGA--AEAINEYNKLLLE-----------
R5EXK3          NKPENK----------YSLV-PVTTG-L-PDRGA--AEAINEYNKLLLE-----------
A0A401UAP7      -KDGKT----------ERYV-SLTDK-E-TLPQEV-INDVLAYQKKREA-----------
A0A1W2GF52      -RNGQQ----------VSIF-KMPTR-I--------TELVNSYNDLVND-----------
A0A2G5L7B8      -GEGTP----------ITTL-GLPKP-F--------LEMLAEYNELKNE-----------
A0A523GAC0      PERLLQ----------YSSY-NEDI-----------NTTLSKLGDLVRE-----------
L8JW09          FLGISQ-----------ETY-PKHI-----------ADAYNELSVQISE-----------
A0A364XUP5      ----RS----------KKFF-VSPGL-R-KILPEYISKNLDRVQELFLT-----------
A0A1M5RLA9      ----KA----------GDLS-ISLTQ-L-HALPPTVAKNLEQLEDLYRD-----------
A0A385SFR9      ----KT----------GDLF-ISLTQ-L-HALPPTIAKNLEQLEDLYRD-----------
A0A5M4A9J4      -KSNND----------LKQI-AAPST-V-GINNPMLVSLLQQLAGQTLD-----------
A0A5M4B1C7      -KSNNS----------IEQI-AAPST-M-GVDDPMIVNLLQQLTSQTLS-----------
A0A0D3LFR6      SEDTYF----------AQSL-VNRAG-D-DFPADI-KTLLDQLNKLISE-----------
M7N6D4          AEDSYF----------AQSL-VNRQD-G-NFPAEL-KGLVEELNTLTSE-----------
A0A4D7K1D4      -GNNEQ----------LEFG-SLTLE-N-FPESI--TELIEEINVLETE-----------
A0A5C7MX19      -KDTEF----------SSIP-LVALQ-E-KDIDV--NDLITRINVLKNE-----------
A0A1Q3ZMZ7      SSETEI----------SNIL-IEIAN-E-EYSGII-RTQIETLQEMITD-----------
A0A2D8JJW3      ------------------------------------------------------------
A0A2W2AFF7      HENVNN----------RRVV-PSSLV-L-QDPTF--VALIDKYNGVQLE-----------
R7PCR1          -HSKSK----------DDEF-IPMLD-L-GDAGI--QQEISAYNDILIE-----------
A0A2N5YXE2      DPELKT----------YEIL-AMLSG-Q-QSETFI-AGMINSLQELLNK-----------
A0A1G9E2A9      VDSTLE----------VEFI-PSTRA-I-RDEQL--LSLVNQLNTKRIE-----------
A0A098LL25      LGDQEV----------NSFI-PALSQ-V-ENPQL--SAAINSLNTLQEE-----------
A0A6J4H627      NHKDDL----------SSFI-PSVPL-L-PDPQL--QTYTNDINRLQQE-----------
A0A6C0GJI1      ETEGDL----------ASFI-PSIPL-L-TDQQL--GELTQNINKLQQE-----------
A0A2T2YJE8      NKSSNL----------DQMI-PSLKE-L-DDAQL--LKQIAQLSDLQLD-----------
A0A7L7LEW0      NKNSNL----------DQMI-PSLKE-L-DDAQL--LKQISQLSDLQLD-----------
A0A127B287      GDDLSL----------VISS-LQLQE-Q-QDPQL--AQLLTELNDLQAQ-----------
A0A6P1P2P6      DDDLTA----------VISS-LQLQE-Q-QDPQL--AQLLTELNDLQAQ-----------
A0A3M9N829      DEDLGL----------IVAG-LQGQP-N-QDPQL--SELLTELSQLQAR-----------
A0A0P0CSF9      NEDLGM----------IASS-IQGQE-N-QDPQL--AEQLTELSDLQAQ-----------
A0A5M8QQB8      NEDLGM----------VVSG-LQGQE-G-QDPQL--TEQLTELSDLQAR-----------
A0A3M9MNC3      NEDLGM----------IAST-IQGQE-N-QDPQL--AEQLTELSDLQAQ-----------
A0A5B6TAX2      NEDLGM----------VVSG-LQGQG-N-QDPEL--AEQLTELSDLQAR-----------
A0A7L5A132      REGQSL----------EQSI-PAIGA-L-ENPQI--AEQISILNEQQGD-----------
A0A512AYT3      QESD-L----------EQVI-PSLKA-V-EDQEL--SSRISELSNLQLY-----------
A0A5M6CYN7      NDSE-L----------DQVI-PSLKA-V-EDQEL--SQRIAELSDMQLY-----------
A0A369QP10      GRNTSL----------DQMI-PSLKE-L-DDEQL--SNRISQLSNLQLD-----------
A0A7G7G7M4      GRNTSL----------DQMV-PSLKE-L-NDEQL--TARITQLSNLQLD-----------
A0A126PDF2      NEDETI----------EQSI-PGLGD-I-NDPIL--SQLLSQLNGMQWE-----------
A0A2Z3GKA1      NENETI----------EQSI-PGLGD-I-NDPVL--SQLLSQLNGMQWD-----------
A0A502GZP7      NENETI----------EQSI-PGLGD-I-NDPLL--SQLLSQLNGMQWD-----------
A0A519SBU8      NDDETV----------ADNI-PGLAE-I-EDPIL--EKLLDQLDNEQRE-----------
A0A4Q3JNZ3      TDDETV----------ADNL-PGLIE-L-ADPVL--TGMLEQLDAQQRS-----------
A0A519Q9V3      NDDETV----------TDNL-PGLAE-L-EDQVL--TGLLEQLDGQQRS-----------
A0A0M3RW20      DENVSV----------EQSV-PGLVT-L-EDPIL--TQQITELNLAQQD-----------
A0A495VFX4      DENTSV----------EQSV-PGLVT-L-EDPVL--TQQITELNLSQQD-----------
A0A418R9X5      RQDGDV----------MQTI-PALST-I-EDAQL--TKRITELSDLQLD-----------
A0A428JSJ3      REDGDV----------FQTI-PALST-I-KDGQL--LQRITELSNLQLD-----------
A0A428KI59      REDGDV----------FQTI-PALST-I-KDGQL--TQRIIELSDLQLD-----------
W8F1I6          REDGDV----------FQTI-PALST-I-KDGQL--TQRIIELSDLQLD-----------
A0A246FQC0      RPDGDV----------MQSI-PALAE-V-KDGQL--VQRITELSDAQLD-----------
A0A372E5P8      RADGDV----------MQSI-PALAD-V-KDGQL--IQRITELSDAQLD-----------
A0A1H3EMW1      RADGDV----------MQSI-PALAE-V-KDGQL--VQRITELSDAQLD-----------
A0A1H9ZSN3      RADGDV----------MQSI-PALAE-V-KDAQL--VQRITELSDAQLD-----------
A0A1S9B3W0      KDDETV----------EQSI-PGLAA-L-EDPVL--SQQIGFLNEQQRE-----------
A0A1W1VRL3      NEDSTV----------AQSI-PGLAE-L-EDGRL--TQEIEALNDQQWD-----------
A0A7G6YQJ9      RGDVDV----------AQAI-PALGD-L-GDSQL--PQLLQQFNDQQLE-----------
A0A1M6R305      REDLTV----------EESI-PALAT-I-ENPQL--SQQLTEVNSLQWN-----------
A0A7G7W8X3      REDMTV----------EQSI-PALAT-I-DNPQL--AQQLTELNGLQWN-----------
A0A4Z0PHK3      SEDATL----------EQSI-PGIAA-F-EDGQL--TGQLAELNNLQWN-----------
A0A2M9B9H9      NEDATL----------EQSI-PGIAA-V-EDAQL--TQQLSELNALQWN-----------
A0A4Z0QCY9      NEDATL----------EQSI-PGIAA-I-EDNQL--TSQLTELNSLQWN-----------
A0A5N1J2M4      ---THV----------DQII-PTLGS-L-QDQQL--SEKIKELGTLQTR-----------
A0A519S476      SDDETV----------AENL-PGLSE-I-EDESL--VSLLEELDTRQRR-----------
A0A4Q3JRW8      NDDETV----------ADNL-PGLAE-L-DDPTL--VALLDQLDGQQRQ-----------
A0A519M923      NDDETV----------AETL-PGLVE-L-DDPVL--MGMLDQLDGQQRS-----------
A0A4Z0ENW1      SDEVTV----------DQTI-PGLAL-L-EDPAL--SQQLNNLNILQQN-----------
A0A519UDB4      NENSTL----------AESI-PGLAI-L-NDGPI--TQQLNDLHILQQN-----------
A0A3S0QKV1      RDDETV----------EQSI-PGLAL-L-EDPQL--TQLMSVLNEQQRD-----------
A0A328BL48      SDELTV----------EESI-PGLAV-L-QDPQI--SQQLTVLNEQQRE-----------
A0A5R8WLY4      SDELTV----------EESI-PGLAV-L-QDPQI--SQQLTALNEQQRE-----------
A0A1I5WSL8      DETQTV----------EQSM-PAIVG-I-EDAQL--LQQLNELNNLQWN-----------
A0A0U3JVM7      DETQTV----------EQSI-PALAG-I-EDPQL--AQQLNELNDLQWQ-----------
A0A1G1SSV2      DETQTV----------EQSL-PALAG-I-EDAQL--GQELNQLNSLQWR-----------
A0A1G1SXV7      DETQTV----------EQSL-PALAG-I-EDAQL--GQELNQLNSLQWR-----------
A0A6G8CBJ6      NEDSTV----------AQSI-PGLAE-L-EDNRL--IQEIEALNSQQWD-----------
A0A0W8EDI5      QEGDDI----------EQSI-PALAI-L-EDAQL--TQQIGVLNDQQAD-----------
A0A3B7RBP8      REGETI----------EQSI-PALTV-L-EDAQL--SQQIALLNDQQAD-----------
A0A3R9P8H7      RADGDV----------LQSI-PALTD-A-KDGQL--VARIQELSDAQLD-----------
A0A238WIA7      REDVSA----------EQSI-PALAE-I-KAPEL--TERIGELYGLQLD-----------
A0A212UCJ7      SEERSA----------EQSI-PALAE-L-KAPEL--AARIGELYDLQLQ-----------
A0A4Z0MQE1      VEGRSA----------EQSI-PALAE-V-KAPEL--TERISELYGLQLE-----------
A0A4Z0PCF4      VEGVSA----------EQSI-PALAE-L-KSPEL--TERVSELYGLQLD-----------
A0A6M6BED0      VEGVSA----------EQSI-PALAE-I-KAPEL--SERVSELYDLQLQ-----------
A0A5D6VDG1      DENASI----------DQSV-PGLSQ-L-EDPVL--TQQITELNAAQQD-----------
A0A243WHR7      SEEASI----------SESI-PGLKQ-L-GDEQV--TQQINRLNDLQWN-----------
A0A5B8A0P6      SEDLTV----------EKSI-PGLAL-L-EDPGL--TEQLTELNNQQYN-----------
A0A076HRT9      REDLTV----------EQSI-PALAT-L-ENSQL--SQQLGELNDLQWN-----------
A0A4Z0PVM7      SEDATL----------EQSI-PGISA-I-EDNQL--TSQLTELNSLQWN-----------
A0A1M6DHW8      SDEATL----------EEGI-PGIAL-L-DDSPL--TQQLSELNDLQRN-----------
A0A4Q5LC61      SEEATL----------EESI-PGLAT-L-EDSPL--TQQLEELNQLQQN-----------
K0XJ09          -DNENG----------KQLI-PNVSG-V-GDSGL--QNQITTYNEILLQ-----------
R5EUZ0          -DNEHS----------KQLI-PNVSG-V-GDSGL--QNQITTYNEILLQ-----------
W0EQS0          -GKENN----------KQLI-PNVSG-V-GDAGL--QSQIEAYNAMILQ-----------
A0A1Y3WE15      -NEKGD----------KQLI-PNVSG-V-GDAGL--QKQIESYNEMLLQ-----------
A0A1Y4GUK3      -NDKDN----------KQLI-PNVSG-V-GDAGL--QSQIEAYNEMLLQ-----------
A0A2U1FKU2      -QTNSD----------NELM-PANLG-L-TEQGI--DNSIAQYNELKLR-----------
A0A0A2F954      -QTSTD----------NELM-PANLG-L-TERGI--DNSITLYNELKLK-----------
A0A0A2FW91      -QTSTD----------NELM-PANLG-L-TERGI--DNSITLYNDLKLK-----------
A0A2D2N2N1      -QTSTD----------NELM-PANLG-L-TERGI--DNSITLYNELKLK-----------
Q7MWZ2          -QTSTD----------NELM-PANLG-L-TERGI--DNSITLYNELKLK-----------
T2NDT6          -QTSTD----------NELM-PANLG-L-TERGI--DNSITLYNELKLK-----------
W1R7P9          -QTSTD----------NELM-PANLG-L-TERGI--DNSITLYNELKLK-----------
A0A1R4AFZ0      -QTSTD----------NELM-PANLG-L-TERGI--DNSITLYNELKLK-----------
A0A1R4DVZ7      -QTSTD----------NELM-PANLG-L-TERGI--DNSITLYNELKLK-----------
A0A7C0WKI7      RRESLE----------NDLS-QIA------------TPYIRQLRERIAEKEARY------
A0A2A8CVM9      -GLRET----------VQQE-QEASG-L-RSEISVLERKIGEMRAEAAQYYVANDGLEGD
A0A5M4B212      -KNEDL----------ESLV-APTTV-G-INDPLL-VNLLQELSQLNIE-----------
A0A3D1KEX9      -KNASN----------TNLI-PDLNL-G-DNGAM--QGQIGKYNDAVIQ-----------
A0A358Y7S2      -NRLDI----------YKVI-PEMIG-K-KSFEGAVIRQIEELNDLLEK-----------
A0A1X7J248      FDKINY----------LVLP-SNM------------QPLFEEFSELKEE-----------
E4TQD2          FDKINY----------LVLP-SNM------------QPLFEEFSELKRD-----------
A0A2J6HHN3      -EENDV----------LFLI-SMLTG-T-ESYTYL-SPYLTSLQDLEFK-----------
A0A1Y3WMT8      -SPENK----------YSLV-PITTG-L-PDRGA--AEAINEYNKLLLE-----------
A0A1Y4GQU1      -RPENK----------YSLV-PVTTG-L-PDKGA--AEAINEYNKLLLE-----------
A0A6A0R272      -NQGKK----------LSEI-SINAE-G-NMDPTL-NQLITAFNNLKIQ-----------
A0A1V5W8T5      -KDFNA----------VELI-SILSG-S-SSESMV-LNFLNGIQQLQKQ-----------
A0A2T8HKA9      -DAGRS----------EKLI-PSNMG-L-ADLNV--DRYISDYNSALLR-----------
A0A2I0QZ80      -NSNDV----------YRLI-PNIIG-Q-SYEGSL-TKQIQELYELIER-----------
A0A3E1F1A3      -NSLDV----------YRLI-PIIIG-K-SYESSL-NQQIQELYELIEE-----------
A0A2U2XBJ3      -NSLDV----------YRLI-PVIIG-K-SYESSL-NSQIQELYNLIEE-----------
A0A4Q4KU94      -NSLDV----------YRLI-PVIIG-K-SYESSL-SIQIQELYNLIEQ-----------
A0A3B8INU3      PDQSLL----------FPHL----------------NTALQEYGNLKVE-----------
A0A2W1NDY9      -NRVSI----------YNLI-PTLAG-T-RFQPLL-EGQIEKLYRLLED-----------
A0A5C8AQR5      -NRLEI----------YKIL-PEMLG-K-SYESSL-SKQIEDLHQMLEK-----------
A0A1G0CI31      -NRLEI----------YRLI-PEMLG-K-SFEISL-TRQITDLHALLQR-----------
A0A556N0M0      -NRLDI----------YRLI-PEMLG-K-SYELSL-TKQITDLNTLLER-----------
F2IKD6          -NRLDI----------YRLI-PEMLG-K-SYESSL-TKQITDLNTLLER-----------
A0A1I7BM74      -RSTEV----------YKLL-PVLIE-K-SYQNAL-KDQIETLFSKLEQ-----------
A0A2G2FJ17      -ESLDV----------YKLI-PELIG-K-SFEGSL-NLQVKELHELLET-----------
A0A2E3R1D0      LES-QL----------GTRL-SSNLD-S-ELAAA--RERIQQLNAELEVFYRQNPALRN-
A0A2T2USC0      IRP-NL----------AERI-ASGLG-E-ELSQV--QKEKAEVASEINAVRRNNPNLEPG
A0A2T2V0F3      IRP-NL----------AERI-SSGLE-E-ELSQV--QREKAQVTAEINAVKRNNPDLDPG
A0A2T2S682      IRP-RL----------AERL-SSGIQ-T-ELKQV--QQEKANVAAEINRVKTRNPNLDAD
D5H561          IQPGQL----------SDQL-ASTVD-Q-EISSL--QSEIAKLELSKQQLELQS----GA
A0A2H3NWA9      IEP-QL----------AERL-ASNID-S-ELARV--QEERAELKQQLDQALERNSNLSPN
A0A2A8CVB6      IEP-QI----------SDRL-SSTTG-D-VLESV--QEEKARLQARIDQIERENPNLGA-
A0A2P6C1S6      IEP-KL----------AERL-SSSLG-Q-RLSSL--QTEQAELESKIDRVERNNPDLEP-
A0A2T2UTM4      IEP-KL----------AERL-SSDLG-E-KLSTF--QTEKAELEVKIDRVERRNPDLDP-
A0A414ZBF2      -DNSKT----------AELI-PSSIG-I-NDNGI--QNQINEYNTTLTK-----------
A0A1Q3Q573      -QKTKD----------YSTL-PILQF-K-EEEMSI-AGEIENINQLQRS-----------
A0A662BAY3      -INNQE----------LETI-IAPSA-M-DIDDPLLNALILELNNLSIE-----------
A0A4U3L369      -DERNN----------KRIV-PSNLV-T-SDPTF--TELVGKYNTLMIE-----------
A0A357YNR3      -NINNH----------EQLI-PANSG-I-NSQSL--NNQINSYNNLVLE-----------
A0A5E8AX52      -----------------PLL-LANYN-S-RSLPEFISGSLTEYNKLFGE-----------
F4KK08          -DKNQM----------ESLI-PANVG-I-ASPSI--EAAIAKYNEFLLK-----------
A0A6B5PK86      -NRLEI----------YRIL-PELLG-K-SYESAI-AGHIEALHLLLEE-----------
A0A2G2F510      -NRLEV----------YKML-PEMLG-K-SYETSL-VKHIEELHLLLER-----------
A0A316JZ08      -NRLEV----------FRMI-PEMLG-K-SYEASL-VTHITDLHDMLEQ-----------
A0A496LCF9      -SNIDR----------ESLA-SPATL-G-IQEPRL-IALVDKYNELQIK-----------
A0A5P2G2A9      -NTKNN----------QRPV-PSLLA-T-PDPAL--ESILTQYNALVLQ-----------
A0A3C0ZQC7      -QEPNV----------AKAI-GEAND-P-YIRLLQEQLAMLEVRRDVTV-----------
A0A3N2N6F7      -SPANK----------GKLL-PGNLG-I-ENQGI--VAQITEYNNLQLE-----------
A0A419VXB7      -DGNMK----------NIVF-PSVVG-I-TDVGL--NSMVVRLSELNSK-----------
A0A0B0BTJ4      -NGKEE----------IGIL-PVNIG-I-ENQAL--SNAINKYNELVLE-----------
A0A3B9CNN6      -NGKEE----------IGIL-PVNIG-I-ENQAL--SNAINKYNELVLE-----------
R5X290          -NGKEE----------IGIL-PVNIG-I-ENQAL--SNAINKYNELVLE-----------
A0A1Q6E6I7      -NGKEE----------IGIL-PVNIG-I-ENQAL--SNAINKYNELVLE-----------
C3J7R8          -SPSSK----------DELI-PANVG-L-NEASA--DNLIREYNSLLLR-----------
A0A1G8BVM8      -DNANK----------SELI-PGNLG-I-NNSGI--ESQIARYNETMTL-----------
A0A1I1FXP9      -NNQDI----------RKII-PALKH-I-NDQELV--DLAEALSDLQNQ-----------
A0A4P7VVU7      -NPDTN----------GQLV-PANAG-L-ENPGI--EAQINEFNQLQLE-----------
A0A2V1ILM4      -NPDTN----------GQLV-PANAG-L-ENPGI--EAQINEFNQLQLE-----------
A0A3N2L0E8      -NPDTN----------GQLV-PANAG-L-ENPGI--EAQINEFNQLQLE-----------
A0A3N2LFC5      -NPDTN----------GQLV-PANAG-L-ENPGI--EAQINEFNQLQLE-----------
A0A7K3KWJ8      -NPDTN----------GQLV-PANAG-L-ENPGI--EAQINEFNQLQLE-----------
A0A3N4H5N3      -GDLIP----------SSLV-SLDPA-L--------GDLLTRYNDLQRD-----------
A0A2P8EAX2      -NETIP----------SSFV-TLDPT-L--------SELLSKYNDLLRE-----------
A0A4V2F6N9      -NETIP----------SSFV-TLDPT-L--------SDLLAKYNDLLRE-----------
A0A3B9FXJ0      -NNIED----------LDAL-SGYFG-N-LKFNNF-APYFNSLSELEKQ-----------
R5GSU5          -NNSKA----------DQVI-PVLND-M-VDQGI--QQQITEYNKLVLE-----------
A0A2A3UE91      -KNIDI----------YQLI-SLMSG-T-EYESVI-KDVTQNIQKLLSE-----------
A0A0A2G557      -NPSSA----------NGLI-PASSG-L-EDLAS--NSLIKEYNTLYLY-----------
A0A2N2WFW8      -GNSDF----------VVLL-SLLSG-L-ESQVYL-APYLQSLKELEMK-----------
A0A1F3IU95      -GNADI----------ITLL-PLISG-I-ESQVYL-SPYLQSLKDLEMR-----------
A0A3D0VUF6      -GNADI----------ITLL-PLISG-I-ESQVYL-SPYLQSLKDLEMR-----------
A0A1T4PT95      -NPSTA----------GGLI-PASSG-L-EDLSS--NTLINEYNTLYLY-----------
A0A6I6JYY3      ----QE----------LETL-IAPSA-M-GINDPLLNSLILQLNDLITQ-----------
A0A2A4PYG9      -DDIDV----------YNLL-PALTG-S-SFQDEI-SDLVQSLHKLLAK-----------
A0A1F3K695      -ANLNI----------FELI-ALLSG-T-KSGNVI-EGILNTLQSLITQ-----------
A0A353KZR1      -ANLNI----------FELI-ALLSG-T-KSGNVI-EGILNTLQSLITQ-----------
A0A2N2WYB5      -NELNI----------YELI-ALLSG-T-KSEAIL-VSVLNNLQQLISE-----------
A0A1F3K4G0      -HDLNI----------YELI-ATLSG-T-KSETIV-VNVLNNLQELINK-----------
A0A356H8Y3      -HDLNI----------YELI-ATLSG-T-KSETIV-VNVLNNLQELINK-----------
A0A351HSA6      -HDLNI----------YELI-ATLSG-T-KSETIV-VNVLNNLQELINK-----------
A0A1F3Q014      -KNIDT----------YTLI-AMLAG-T-TTESNI-TSAVEALHKLLIQ-----------
A0A2D5KD44      -EQIDI----------YEFL-PILVG-S-QFESSI-SSLIEQLNDLLLK-----------
A0A6N9NIX1      -EKIDV----------YQIL-PILMG-S-DFQKSL-EGLMSELNFLLIE-----------
A0A2A4YXP3      -DDIDV----------YDLL-PILAG-T-DYAGGI-MSLITSLKEFLIQ-----------
A0A1F3R158      -KDINV----------YNLL-PILSG-T-EYEIRI-TTLITDLQTLLLQ-----------
A0A2M8ADX2      -KEINV----------YNLL-PILAG-T-EYEIRI-TSLITDLQSLLIQ-----------
A0A1J5B2H0      -ENVDI----------YKLI-ATIAG-S-EFQGII-SSLLNNLQDLLLK-----------
A0A1V5N756      -KDLDV----------YELY-ALVAG-S-QFQSSV-SGNLQAIQNLLMQ-----------
A0A651GU15      -EETDI----------YALI-PLIVG-T-RLENSL-SGLITDLREILLR-----------
A0A3Q9FR88      ----SS----------IVYI-QAYAT-I-LTDGSI-SSSLDELAKLETE-----------
A0A553GEX3      ----SS----------IVYI-QAYAT-I-LTDGSI-SSSLDELAKLETE-----------
A0A150ADJ9      ----SS----------IVYI-QAYAT-I-LTDGSI-ASNLSELAKLEVQ-----------
A0A1B1FWQ4      ----SS----------IVYI-QAYAT-I-LTDGSI-SSSLDELAKLETE-----------
A0A1S1Z228      ----SS----------IVYI-QAYAT-I-LTDGSI-SSSLSELAKLETE-----------
A1ZKR2          -KQGDL----------SEFL-PTLTT-P-IQGLGQLQPLISKLNQLQEN-----------
A0A1Q3GX01      -QDKEL----------VLYL-PETSA-G-LQGLTQ---IMNQINKLQEE-----------
A0A349DQI4      -EDKEL----------VLYL-PENTS-G-LQSLTE---ILKKISKLQED-----------
A0A4P5TMD1      -LYKDS----------SKLL-LGIVD-Q-KYVGL--QSYVEALDKLQSD-----------
A0A2N3IIZ0      -VDSKN----------IPLM-PDVDG-A-I------LQQISELNRLRQI-----------
A0A7K3WUF2      -DGMNV----------YSII-PLLTG-T-KYESSI-ATMLDKLRELLVQ-----------
A0A1F3SJM1      -SRLNV----------YRMI-PEMLG-K-SYETAL-VGHIESLHTLLEK-----------
A0A2G2EB96      -NRLEV----------YKLL-PELLG-R-SYERAL-EGHLNQLHDFLER-----------
A0A2G6PRA9      -NRLEV----------YKLL-PELLG-R-SYEASL-AGHLRELHEFLER-----------
A0A497D5Z2      -RNNQH----------LGNV-IAPSA-M-GIDDPLLNSLIAELNTLIVE-----------
A0A662B170      -RNNQH----------LGNV-IAPSA-M-GIDDPLLNSLIAELNTLIVE-----------
A0A2A5FYT6      -KEIDP----------YTII-PVLTG-T-HFEKNI-SRQINSLHQLLIK-----------
A0A2E6SYP1      -SNEEL----------YSIL-LLNST-N-KYL----SSVGTSLKQLLAK-----------
A0A2E5RLE8      -NHEEL----------YSIL-LLNSK-N-QYI----STTSSRLRNLLSE-----------
A0A2E7TQF6      -NHEEL----------YSIL-LLNSK-N-QYI----STTSSRLRNLLSE-----------
A0A2E6GVY9      -SHEEL----------YSVL-LLNSK-N-QYI----STTASRLRKLLSD-----------
A0A350JJ90      -TGVDI----------YNLL-PVLAG-T-EFENSV-KGQIEELQNLVLT-----------
A0A3M1CDV2      -KNIDL----------YQLI-SLASG-T-SYEESI-KNITSNIQKLLLE-----------
A0A6C1QGZ7      -DEADI----------FRLI-AILSG-S-EFRGNI-SGMLRTLQDQLLD-----------
A0A4P5U6G4      -RYEDS----------TRLF-SGIVD-V-QFSAL--QEFVRMLDKLQAD-----------
A0A2E2TFD1      -DSVEV----------HQLI-PLLTG-T-QFEDNL-LQQIAYLQELQIE-----------
A0A2E4ELE6      -DSVDV----------YDLL-PLLAG-T-QFEIGI-KKQIQFLHELLLE-----------
A0A522EYA6      -KEVDS----------YQLV-SLLTG-I-EFESAL-NNQINSLQELLKS-----------
A0A2E3XZI5      KITTSS----------IKNI-SLLTN-I-FYEDELIKIMITQLQEDVLK-----------
A0A6I7QXV0      -EDLSS----------IPKG-INIAN-L-EQY----THYLEAISDLEKE-----------
A0A2M7NLQ9      -----S----------TLLV-ALTYS-S-MLKDTNLKNRIEKVYDEEKE-----------
I4AFR0          -----S----------TLLI-ALTYS-T-ILKEPSLKIRLEEVYEEEKE-----------
A0A2N2Y3E5      -KDLSA----------VELI-AIIPQ-N-LNSSVL-TSILSEIQSLIKE-----------
A0A2D9D7T6      -DRIQI----------YKLI-PEMLG-K-KNLEANVIKQVEELNALLEK-----------
A0A1F3PPL5      -KNIDV----------YELI-ALLSG-T-KSEGYI-SNILESIQQKNDQ-----------
A0A357QK06      -KNIDV----------YELI-ALLSG-T-KSEGYI-SNILESIQQKNDQ-----------
A0A662AEA4      -KDSNI----------YEII-AILSG-T-KFDGVI-VNVLNNLQKLISK-----------
A0A0S2HYK8      -QQLNT----------YEMI-ATLAG-T-NSEKVL-VSILTNLQNLINE-----------
A0A2N5ZWN6      -GQINI----------YEMI-ATLAG-T-SSEKVL-VNILSNLQQLINE-----------
A0A2E0FJ09      -LELDI----------YNVL-PILIG-S-EFESNL-YTLISVLHKKLML-----------
A0A1F3FZ62      -KDLDV----------YKLI-AFISG-T-EVNKIV-KGNLDAIQSILLQ-----------
A0A1F3K211      -KDLDV----------YKLI-AFISG-T-EVNKIV-KGNLDAIQSILLQ-----------
A0A1V6I2U9      -PEINT----------YELL-AMLSG-Q-KSEVFL-SSMINSLQELLNR-----------
A0A2H0B957      -PNINA----------YNLI-SLLPL-K---DNNILLSLLNQIQNLITQ-----------
A0A1F3CFW6      -PNIKV----------YDLI-SLLPS-K---NDGILISLLNQMQNLINQ-----------
A0A2M7E2T8      -PNIKV----------YDLI-SLLPS-K---NDGILISLLNQMQNLINQ-----------
A0A2M7NC69      -PNIKV----------YDLI-SLLPS-K---NDGILISLLNQMQNLINQ-----------
A0A1F3KLL5      -ENLKY----------YDLY-SLLSG-T-KSENVV-SRLLEEINKLEND-----------
A0A359D1M1      -ENLKY----------YDLY-SLLSG-T-KSENVV-SRLLEEINKLEND-----------
A0A0F2NS19      -NTIDI----------YNLL-PTLTG-T-EYEASI-TALITNLQNLMVQ-----------
A0A2A5H8X6      -NTIDV----------YNLL-PTLTG-T-EYEASI-TALITNLQSLMVQ-----------
A0A2H0GAU8      -NTIDV----------YNLM-PTLTG-T-EYEASI-SALITNLQGLLVQ-----------
A0A2M8FTK1      -NTIDV----------YNLM-PTLTG-T-EYEASI-SALITNLQGLLVQ-----------
A0A2A5B3B0      -KDIDV----------YELL-PILAG-T-EYAGGI-MSLITTLKELLFR-----------
A0A5C6RXM7      -KNVDV----------YKLL-SILAG-T-DYSSGI-TSLVTELKRLLLL-----------
A0A1F3C1M2      -SNLNI----------LDLI-AILSG-T--KSEGLIVSILNKLQDLINQ-----------
A0A1F3DS87      -SNLNI----------LDLI-AILSG-T--KSEGLIVSILNKLQDLINQ-----------
A0A6A0R6K9      GENIDI----------YKLL-PLLIA-S-TYDNSL-KQLVDNLNQELIH-----------
A0A2E7CT70      KISSNS----------IKSL-S-LSK-I-FYDNLVIQNMIESLEKNVIK-----------
A0A2D5V560      EINSTS----------MKNI-SLLTA-I-FYNESLTSKMIEQLQEDVNK-----------
A0A2D7K5A8      EINSSS----------VKNI-SLLTT-I-FYGESLTSKMIDQLEKDVIQ-----------
A0A2E1XQ82      EINSSS----------VKNI-SLLTT-I-FYGESLTSKMIAQLEEDVNQ-----------
A0A5C8A5B4      RSSSDL----------RNVPAPSSSG-I-DDPVL--NNLVIEITKLSAD-----------
A0A7C1LGX3      VGQAAF-----------ELL-PVDVG-L-ENSGL--NSMVDRYNDQVLQ-----------
A0A4Y9ITE2      NDPNHR----------YDLI-PTPYG-A-EAAV----DAIAEYNKLILE-----------
A0A5M8NYX7      SNPDNK----------NNGA-PANVG-I-TDPMV--ISLMNAYNTEIFE-----------
A0A0E3V905      EGKGDT----------RGNT-PAVVG-L-SDPVL--LSLINNLTQLEQQ-----------
A0A553ETH6      KNLEAD----------KVS--EVNYE-Q-LPRFI--GENIRLLNELFLE-----------
A0A640Q161      RNDVSL----------DDIA-RLPEV-L-NHPTI--RDVRRDEAKAMTR-----------
A0A640QU49      RNDVSL----------NDIA-RLPEV-L-NHPTI--RDVRRDEAKAMTR-----------
A0A1Q3PII2      RAKPTM----------AI---PSALY-P-REDNF--ADLVTKYNDMLLS-----------
A0A351BXT2      ERMDPT----------LVNF--LQGK-V-DELYL--TEIQSKIAELESQ-----------
A0A2K8Z965      ETKSEN----------RGNTPPAVVG-L-NDPVL--LGLITNLTTLEQQ-----------
A0A418M8U8      NNRSLD----------RGAT-PALVG-L-NDPVL--FSLIEKLTQLDLQ-----------
I2GTA4          NNRSLD----------RSAT-PALVG-L-NDPVL--FSLIEKLTQLDLQ-----------
A0A2K8ZAJ2      QSHSGR----------KGVA-PATLG-L-SEPIL--TSLLTKAAELELK-----------
A0A368JPA3      RSKGEN----------RGVL-PTTLK-F-SDPTL--TALIGKLTELETQ-----------
A0A5N1JI29      RSKGEN----------RGVL-PTTLK-F-SDPTL--TALIGKLTELETQ-----------
A0A7K0EGC9      RSNSEN----------RVVL-PSSLK-F-SDPTL--SSLIGKLTDLESQ-----------
A0A3P1BT12      RAKGEN----------RGML-PATLK-F-NDPAL--TSLISKLNDLEQQ-----------
A0A3P1CI15      RSKKDN----------RAAL-PATLK-F-NDPTL--TSLLGKLTDLEVQ-----------
A0A4R8CUK1      REEGTH----------YCSL-PAMLD-F-SDPAV--TAFVTKIQDLERQ-----------
A0A3D0MYJ7      SEISPE-----------VDL-YVNSQ-A-NQSKF--TTISNEIASLEVK-----------
A0A662AH13      DKKNPT-----------LSK-YIENY-A-STPRM--LALQEAIGNYELQ-----------
A0A5C7QA01      -------------------------------------------IELKQQ-----------
A0A3D3LS70      EKLDPQ-----------LIT-YVESQ-I-SQSYV--EEIQKTIANVEAE-----------
A0A1G1TM36      RNPQPA-----------ATV-PTTLG-I-TDEAL--NNLVGRLTSLQLQ-----------
A0A1G7ZF38      RE-KSA-----------TAI-PSALY-P-QESNF--AAMVSKYNETQLA-----------
C6VS52          RK-SPS-----------TAI-PSLLY-P-QESNF--SALASTFNEMQLN-----------
A0A2A4G4B1      LEGG------------IQLL-PTNIG-L-DHSGV--KETIDNFNQLILE-----------
A0A0P7X1V8      QQELDR------------LT-PGLSE-Q-LTASI--APRINQLQVFLAD-----------
A0A6P1P355      VLKSNS----------GGMA-PSTLG-I-KDPAL--TQLLQKLYDSEIE-----------
A0A5C8KAD6      VSRNSS----------TGSI-PSTLG-I-NDPIL--SDLLQKLQNLEIQ-----------
A0A5N1J695      ISKNKA----------TGIV-PSTLG-V-NDPVL--EQLLQKLYNAETQ-----------
A0A3N2M1H3      DDSANK----------FNII-PANTG-L-DNPSI--EKDIATYNTILLA-----------
A0A4S2G8T2      DDSANK----------FNII-PANTG-L-DNPSI--EKDIATYNTILLA-----------
A0A212K7W5      KDSRTK----------DMLL-PANLG-I-EGTNI--DRQINEYNTLLLK-----------
F5IU11          KNPRTK----------DILL-PANLG-I-EGANI--EGQINEYNTLLLK-----------
A0A7C1QWC7      NTNKDI----------AGLA-PPSAANV-VDPIM--NTLVLELLDLNAQ-----------
A0A352Z1R7      NSTLRK----------GNIY-SPAIM-R-DDPLV--AGLATKLSELEIQ-----------
A0A0A2F501      GTDTNA----------TQLI-PAISG-I-GNKLI--DQQIGEYNQKMLE-----------
R5B7P0          GKEDNR----------NQPL-PANMG-L-SSQTI--ENGISEYNSKILQ-----------
R5B0L5          GSESSR----------NQPL-PVNVG-S-GSPAI--ESQIAQYNDAMLE-----------
A0A6I1TEC0      VGRVSK----------NQVL-PSNTG-I-DSPGI--EQQIAEYNKTLLE-----------
A0A3R5XWG1      VGRVSK----------NQVL-PSNTG-I-DSPGI--EQQIAEYNKTLLE-----------
A0A5P0Y910      VGRVSK----------NQVL-PSNTG-I-DSPGI--EQQIAEYNKTLLE-----------
A0A414YFM3      VGRVSK----------NQVL-PSNTG-I-DSPGI--EQQIAEYNKTLLE-----------
A0A6A7UIA7      VGRVSK----------NQVL-PSNTG-I-DSPGI--EQQIAEYNKTLLE-----------
A0A6A7VPS3      VGRVSK----------NQVL-PSNTG-I-DSPGI--EQQIAEYNKTLLE-----------
A0A374THP7      TGKVGK----------NQLL-PSNTG-I-ESPGI--EQQIAEYNKSQLE-----------
A0A6G1VND1      TGKVGK----------NQLL-PSNTG-I-ESPGI--EQQIAEYNKSQLE-----------
A0A0A2EVS5      -TGGQG----------RELL-PVNSG-I-NSPVI--EREISEYNETLLQ-----------
A0A1T4NAJ7      -TGGQG----------RELL-PVNSG-I-NSPVI--EREISEYNETLLQ-----------
A0A255T941      -TSKSI----------DQTL-PTNSG-I-ANANI--ETQINNYNNMVLD-----------
A0A4P7VSV0      GAASDN----------EKML-PMNSG-V-ANVDI--QSQITDYNNLVLQ-----------
A0A7J0AX49      GAANDN----------EKML-PMNSG-V-ANVDI--QSQITDYNNLVLQ-----------
A0A3N2KCL3      GAASDN----------EKML-PMNSG-V-ANVDI--QSQITDYNNLVLQ-----------
A0A2V1IJY1      GAASDN----------EKML-PMNSG-V-ANVDI--QSQITDYNNLVLQ-----------
A0A4P7VXK7      GAASDN----------EKML-PMNSG-V-ANVDI--QSQITDYNNLVLQ-----------
A0A1Y4CHN5      AAGESQ----------NQLL-PANSG-I-SGGNI--ENQISEYNTAQLQ-----------
A0A1M6I2S6      -NNKEL----------SQLL-PTNSG-I-ANVNI--ESQIGEYNTMVLD-----------
A0A1Y3V692      -NNKEL----------SQLL-PTNSG-I-ANVNI--ESQIGEYNTMVLD-----------
F3PXM2          -NGKGL----------TQLL-PANSD-I-GNSHI--ESLIGEYNAQVLE-----------
A0A174AHH7      -NSKDM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A174JCE8      -NSKDM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A3E4JMC4      -NSKDM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A412SND6      -NSKDM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A414IEQ9      -NSKDM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A7K0HNT3      -NSKDM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A0M1W8D8      -NSKDM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A3R6GKX5      -NSKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKIVLD-----------
A7V4S1          -NSKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKIVLD-----------
B0NU19          -NSKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKIVLD-----------
D4V601          -NSKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKIVLD-----------
A0A4Q0U3M9      -NSKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKIVLD-----------
A0A7J5G2G2      -NSKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKIVLD-----------
A0A7J5HH13      -NSKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKIVLD-----------
A0A397WLT5      -NSKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKIVLD-----------
A0A6A2J529      -NSKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKIVLD-----------
A0A6N8DDD8      -NSKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKIVLD-----------
A0A015XH67      -GGKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A078RZN2      -GGKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A6M4L7F4      -GGKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A6L0K5          -GGKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A7ACT5          -GGKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A6KY94          -GGKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A173UQR8      -GGKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A3R6HK75      -GGKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A412B7D1      -GGKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A412VNY9      -GGKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A414LTU9      -GGKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
I9Q4U4          -GGKEM----------NQPL-PTNSG-I-ANVNI--ESQIGEYNKMVLD-----------
A0A373ISF0      -KEKSL----------SQPL-PTNSG-I-ANSNI--ESQISEYNNMVLN-----------
U6RF62          -KEKSL----------SQPL-PTNSG-I-ANSNI--ENQISEYNNMVLN-----------
A0A662ZZD5      -NNKKL----------SQLL-PTNSG-I-ANVNI--ESQIGEYNTIVLE-----------
A0A3A5TI83      -NNKKL----------SQLL-PTNSG-I-ANVNI--ESQIGEYNTIVLE-----------
A0A415NEB6      -NNKKL----------SQLL-PTNSG-I-ANVNI--ESQIGEYNTIVLE-----------
A7AJ60          -NNKKL----------SQLL-PTNSG-I-ANVNI--ESQIGEYNTIVLE-----------
A0A7J5MKN5      -NNKKL----------SQLL-PTNSG-I-ANVNI--ESQIGEYNTIVLE-----------
A0A6A2JF01      -NNKKL----------SQLL-PTNSG-I-ANVNI--ESQIGEYNTIVLE-----------
A0A7J4Y8G3      -NNKKL----------SQLL-PTNSG-I-ANVNI--ESQIGEYNTIVLE-----------
A0A015UXN7      -NNKKL----------SQLL-PTNSG-I-ANVNI--ESQIGEYNTIVLE-----------
A0A6I2NTL0      -NNKKL----------SQLL-PTNSG-I-ANVNI--ESQIGEYNTIVLE-----------
A0A6I2Q447      -NNKKL----------SQLL-PTNSG-I-ANVNI--ESQIGEYNTIVLE-----------
A0A016E4F9      -NNKEL----------DQLL-PTNSG-I-ANVNI--ESQIGEYNTMVLD-----------
A0A6N3HG44      -NNKEL----------GQLL-PTNSG-I-ANVNI--ESQIGEYNTMVLD-----------
A0A7K0HSP7      -NNKEL----------GQLL-PTNSG-I-ANVNI--ESQIGEYNTMVLD-----------
A0A7K1HEJ5      -NNKEL----------GQLL-PTNSG-I-ANVNI--ESQIGEYNTMVLD-----------
A0A6H9P0U9      -NTKQL----------DQTL-PANSG-I-VSANI--ETQISEYNNLVLD-----------
A0A108TH71      -NTKQL----------DQTL-PANSG-I-VSANI--ETQISEYNNLVLD-----------
I8VXH0          -NTKQL----------DQTL-PANSG-I-VSANI--ETQISEYNNLVLD-----------
A0A412S0N6      -NTKQL----------DQTL-PANSG-I-VSANI--ETQISEYNNLVLD-----------
A0A412IIJ0      -NTKQL----------DQTL-PANSG-I-VSANI--ETQISEYNNLVLD-----------
A0A0P0FM97      -NTKQL----------DQTL-PANSG-I-VSANI--ETQISEYNNLVLD-----------
R6KTP3          -NTKQL----------DQTL-PANSG-I-VSANI--ETQISEYNNLVLD-----------
A0A139LU87      -NTKQL----------DQTL-PANSG-I-VSANI--ETQISEYNNLVLD-----------
A0A1C6B3Y5      -NTKQL----------DQTL-PANSG-I-VSANI--ETQISEYNNLVLD-----------
A0A6L3KCD1      -NTKQL----------DQTL-PANSG-I-VSANI--ETQISEYNNLVLD-----------
E2NMQ4          -NTKQL----------DQTL-PANSG-I-VSANI--ETQISEYNNLVLD-----------
A0A412YDB9      -NTKQL----------NQTL-PTNSG-I-VSANI--ETQISEYNNLVLD-----------
R7DY01          -NTKQL----------NQTL-PTNSG-I-VSANI--ETQISEYNNLVLD-----------
A0A414LGK8      -NTKQL----------NQTL-PTNSG-I-VSANI--ETQISEYNNLVLD-----------
A0A415IPQ4      -NAKQP----------DQPL-PTNSG-I-VNANI--ETLISEYNNLVLD-----------
A0A3E5BRW7      -NAKLL----------DQPL-PANSG-I-VNANI--ETLIGEYNNLVLD-----------
K9DXS6          -NAKLL----------DQPL-PANSG-I-VNANI--ETLIGEYNNLVLD-----------
A0A1M6KFV3      -NSKQL----------NQPL-PANSG-I-VNANI--ETLISEYNNLVLD-----------
A0A1Q6G7L3      -NSKQL----------NQPL-PANSG-I-VNANI--ETLISEYNNLVLD-----------
A0A413H235      -NSKQL----------NQPL-PANSG-I-VNANI--ETLISEYNNLVLD-----------
A0A1M5B2J8      TSETNR----------FQLL-PANSG-I-DNPNI--ASQINEYNNQLLE-----------
A0A255RCT5      TSETNR----------FQLL-PANSG-I-DNANI--GSQITEYNNQLLE-----------
A0A1Y4GLF5      ANDANK----------SQLL-PANSG-I-DNGNI--ESQISEYNRQLLQ-----------
A0A1H3XSC0      TNDANK----------NQLL-PANSG-I-ESANI--ESQIAEYNRQLLQ-----------
A6LE40          ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A4Y1VPX5      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A6N2XMM4      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
B3JI46          ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A358R8U0      SDENNR----------TQLL-PANSG-I-ESTNI--ESQISEYNTKLLQ-----------
R6WSB6          SDENNR----------TQLL-PANSG-I-ESTNI--ESQISEYNTKLLQ-----------
A0A401LPX7      TDENNK----------YQLL-PANSG-I-ENASL--STQLNEYNTKLLE-----------
A0A6G0GNY9      TNENNK----------HQLL-PANSS-I-ENASL--ATQLNEYNTKLLE-----------
A0A6I1BFM0      TNENNK----------HQLL-PANSS-I-ENASL--ATQLNEYNTKLLE-----------
A0A3A5Z900      TNENNK----------HQLL-PANSG-I-ENANL--ATQLNEYNTKLLE-----------
A0A7K0GW19      TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
A0A285TGL6      TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
A0A3A5RFX4      TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
A0A1Q6IUW9      TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
A0A413XDP6      TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
A0A6N8CVT6      TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
K6AP24          TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
A0A6I2NHV3      TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
A0A078RYI7      TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
A0A7I0QD01      TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
C7XEQ8          TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
D7INX6          TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
K5ZG55          TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
A0A662ZYI7      TNENNK----------HQLL-PANSG-I-ENASL--ATQLNEYNTKLLE-----------
A0A3N2N9B8      TAESSR----------NQLL-PANSG-L--VGDI--ASQVGEYNDLLLQ-----------
A0A3N2NMI0      TAEDSR----------NQLL-PANSG-L--VGDI--AKQVSEYNEMLLQ-----------
A0A359I8H7      NNPGNA----------KSVI-PVNTG-I-GSPTL--EAQISNYNNLLLT-----------
A0A3N2KA63      NNPGNA----------KSVI-PVNTG-I-GSPTL--EAQISNYNNLLLT-----------
A0A4Q0IMT7      NNPGNA----------KSVI-PVNTG-I-GSPTL--EAQISNYNNLLLT-----------
A0A7J0B660      NNPGNA----------KSVI-PVNTG-I-GSPTL--EAQISNYNNLLLT-----------
A0A3B9FAU3      TRGAKS----------RKLL-PTNAG-L-ESTGI--EQQIAEYNTLLLQ-----------
A0A3C1E5L7      TRGAKS----------RKLL-PTNAG-L-ESTGI--EQQIAEYNTLLLQ-----------
A0A4Q0UAV1      QN-ASL----------DQPL-PNPAG-I-EGTTV--ESQIAEYNTIVRE-----------
A0A354SN68      SNVKNR----------NQLL-PVNSG-I-GNEGI--EGLINDYNAQILQ-----------
A0A6L5XFL0      SEGAYK------------IL-PANTG-I-DNTVL--SQQIGSYNEKVLQ-----------
A0A3N2N595      SADNDN----------TKLL-PIPSE-V-ENVDV--KSQLTNYNDLILQ-----------
A0A7J0ACS3      TSEGNR----------DQLL-PANTG-L-QSSNI--QSLIGEYNDKLLQ-----------
A0A0A2DUD9      KN-LDK----------SRLL-PVNSF-V-NNPSL--EQQIGEFNDLLLK-----------
A0A3P1ZBJ5      TNEKNK----------FDLL-PANSG-I-NSSSV--EALIGDYNGNILQ-----------
R5FHS9          TNPKQR----------NHVL-PANFG-L-TDQNI--EQQIESYNKDLIE-----------
A0A413TW79      TGKVGK----------NQLL-PANIG-I-DSPGI--EQQITEYNKQQLE-----------
A0A7K0AAG2      TGKVGK----------NQLL-PANIG-I-ESPGI--EQQITEYNKQQLE-----------
A0A7K0ASF1      TGKVGK----------NQLL-PANIG-I-DSPGI--EQQITEYNKQQLE-----------
A0A3E5E9M7      TGKVGK----------NQLL-PANIG-I-DSPGI--EQQITEYNKQQLE-----------
A0A3E4SK73      TGKVGK----------NQLL-PANIG-I-DSPGI--EQQITEYNKQQLE-----------
A0A415GGC6      TGKVGK----------NQLL-PANIG-I-DSPGI--EQQITEYNKQQLE-----------
A0A413DBH9      TGKVGK----------NQLL-PANIG-I-DSPGI--EQQITEYNKQQLE-----------
A0A495WI87      GGESNK----------YQLL-PANSG-I-ENSNL--GDQITEYNNKLLQ-----------
A0A354M4S6      GGESNK----------YQLL-PANSG-I-ENSNL--GDQITEYNNKLLQ-----------
R7DH52          GGESNK----------YQLL-PANSG-I-ENSNL--GDQITEYNNKLLQ-----------
A0A7J5IAE7      TNDANR----------TQLL-PANSG-I-ENANI--ESQITEYNKQLLQ-----------
A0A016CWA4      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A4P8LP09      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A0M1W0V2      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A139KA16      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A174VQ92      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A1Q6HCG0      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A1Y4JYM9      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3A5QW67      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3A5RQE6      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3A6BP07      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3E5E153      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3Q9IP20      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A412WV15      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A413ICP6      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A414KYB9      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A5B3FWR2      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A7J5QHB9      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
E5WX00          SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
K0X3P3          SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A1C6H117      SNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A6I1AQV4      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A5C6L2P1      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A412MJT7      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3E4WKT5      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3A5YY33      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A1E9CFZ7      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A373FYU5      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3A5TZ72      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3A5XBP2      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3A6MEG9      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3E4JP35      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3E4KP40      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3E4NX82      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3E4XFU8      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A412RG70      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A412TD37      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A413GAA4      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A414M7I4      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A496BTA0      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A496D2V6      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A5C6KCA6      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A5M5AHM5      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A6I0Y5K7      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A6I1BFB8      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A6I2P5W5      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A6N8DC51      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A7J5HGP0      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A7J5HVL8      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A7J5JHD3      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
E5UZA2          ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A069SMG6      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
C3RFN5          ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3A5Z014      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A7J5GD93      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A7K0HGR5      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A078S3Q8      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A069SJV7      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3E5DXI5      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3E5EM98      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A6N2YYD4      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
I9T3G6          ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A3E4SYU0      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A6LGY1          ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
K5ZSH4          ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A6A2RTB3      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A7J5PEN4      ANDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A1M4YZ07      TNDANR----------TQLL-PANSG-I-ESANI--ESQIAEYNKQLLQ-----------
A0A7J5I238      ANDANR----------TQLL-PANSG-I-ESVNI--ESQIAEYNKQLLQ-----------
A0A0P0FQW1      ANDANR----------TQLL-PANSG-I-ESVNI--ESQIAEYNKQLLQ-----------
A0A7K0I229      ANDANR----------TQLL-PANSG-I-ESVNI--ESQIAEYNKQLLQ-----------
A0A5M5C0W6      ANDANR----------TQLL-PANSG-I-ESVNI--ESQIAEYNKQLLQ-----------
A0A642NJ89      ANDANR----------TQLL-PANSG-I-ESVNI--ESQIAEYNKQLLQ-----------
A0A6L3JTQ2      ANDANR----------TQLL-PANSG-I-ESVNI--ESQIAEYNKQLLQ-----------
A0A7J5FQU6      ANDANR----------TQLL-PANSG-I-ESVNI--ESQIAEYNKQLLQ-----------
A0A7J4YLH7      ANDANR----------TQLL-PANSG-I-ESVNI--ESQIAEYNKQLLQ-----------
A0A6N3AEV2      ANDANR----------TQLL-PANSG-I-ESVNI--ESQIAEYNKQLLQ-----------
A0A6G0G4T5      ANDANR----------TQLL-PANSG-I-ESVNI--ESQIAEYNKQLLQ-----------
A0A6L3KG29      ANDANR----------TQLL-PANSG-I-ESVNI--ESQIAEYNKQLLQ-----------
A0A1Y4PQK7      ATTAGQ----------NQLL-PANSG-L-ENVGI--EKQISEYNTLQLQ-----------
A0A1Y4IH41      ATTAEQ----------NQLL-PANSG-L-ENVGI--EKQISEYNTLQLQ-----------
A0A3A6AAP4      ATTAEQ----------NQLL-PANSG-L-ENVGI--EKQISEYNTLQLQ-----------
A0A6I0ZRD2      ATTAEQ----------NQLL-PANSG-L-ENVGI--EKQISEYNTLQLQ-----------
A0A7L4SP06      ATTAEQ----------NQLL-PANSG-L-ENVGI--EKQISEYNTLQLQ-----------
A0A1Y4DYA7      TNNNNK----------NQLL-PANSG-I-ESSGI--ENQILDYNTLQLQ-----------
A0A1Y3X4I9      TGGNSR----------NQLL-PANSG-I-ESSGI--EKQIADYNALQLQ-----------
A0A1Y4FNK8      TNATSK----------NQLL-PANSG-I-ESPGI--EQQIANYNTAQLR-----------
A0A355FD59      TGPAYT----------NQLL-PANSG-I-ENSGI--ESQISEYNTLQLQ-----------
A0A359CEZ9      TGPAYT----------NQLL-PANSG-I-ENSGI--ESQISEYNTLQLQ-----------
A0A353Q7B4      TGPAYT----------NQLL-PANSG-I-ENSGI--ESQISEYNTLQLQ-----------
F8X3A5          MTSTNN----------NQLI-PANSG-I-ESASV--ENQITEYNTIQLQ-----------
A0A1M3KVR9      MTSTNN----------NQLI-PANSG-I-ESASV--ENQITEYNTIQLQ-----------
A0A4Y9IJS3      MTSTNN----------NQLI-PANSG-I-ESASV--ENQITEYNTIQLQ-----------
A0A1H4ADG3      HSQNGN----------DRVV-PASLT-I-NDGSL--SAIIDNYNKLLLQ-----------
A0A5B8VUR8      -SQNGN----------DRVI-PASLT-I-NDGNL--NTIIDSYNKLLLQ-----------
A0A0D3L8Q3      RREGNE----------VGIV-PSTLS-I-TDHTL--NRLIERYNELQLE-----------
A0A7G7G5F9      KKPRSR----------YELA-PSNLN-I-KDPIL--LDLISKFNALQLE-----------
A0A2N3U785      TKSKNK----------SILV-PSTLN-I-KDPTL--QDLISRFNELQLE-----------
A0A5B6TJH8      SQDKGE----------YRMV-PSSLG-I-QDQTL--MSLIGKFNELQLE-----------
A0A519U664      RKNTGQ----------YSIV-PSSLG-L-KDETL--LGLIGKF-----------------
A0A519MA34      RKNAGQ----------YSIV-PSSLG-L-KDETL--LGLIGKFNELQVT-----------
A0A519UCX0      RKNAGQ----------YSIV-PSTLG-L-KDETL--LVLIAKFNELQAT-----------
A0A0E3ZG78      NKDENQ----------YKMV-PSTLS-I-QDVTL--MGLIARFNELQLD-----------
A0A1I6BRK6      KNNNN------------SIV-PNSLG-I-KDETL--AKLIGRFNEVELE-----------
A0A243WAB1      KRTNGQ----------YSMV-PSTLG-I-KDETL--LGLIGKFNELQLE-----------
A0A6G8C8X6      RKTSGQ----------YSMV-PSSLG-I-QDPTL--MSLITKFNELQLE-----------
A0A416GA42      LQPKND----------KSLI-PVNIG-V-SETNL--VNQIAEYNKMRLQ-----------
A0A1T3IYP5      SAKGKQ----------NNLI-PNNTG-L-VDASV--ENQIAEYNTTLLK-----------
A0A1T5K9D4      RGSMDS----------FEVI-PANTG-L-NDANL--DQAISQYNDLVIK-----------
A0A077ENE7      MNKGKQ----------NNLI-PNNTG-L-VDSGV--EGQIAEYNKALLK-----------
A0A7H1Z2Z7      MNKGKQ----------NNLI-PNNTG-L-VDSGV--EGQIAEYNKALLK-----------
A0A6I5UW06      MNKGKQ----------NNLI-PNNTG-L-VDSGV--EGQIAEYNKALLK-----------
T0NN57          VNKNKR----------NDLI-PNNTG-L-VDASV--EGQIAEYNMALLK-----------
X5K347          VNKNKR----------NDLI-PNNTG-L-VDASV--EGQIAEYNMALLK-----------
A0A060RD97      LDPINA----------NALI-PRVSG-A-QNLGV--DSQIDSYNELRLK-----------
A0A3C1ITV0      VDNTRQ----------YDLL-PSNSG-V-GSQAI--EEQIAEYNKRLLE-----------
R7HN19          VDNTRQ----------YDLL-PSNSG-V-GSQAI--EEQIAEYNKKLLE-----------
A0A350IHV0      KDPQHD----------GALI-PSNLG-L-DSKTV--DSQITEYNQMVLT-----------
R5RVP0          ENPAHS----------GALI-PANSG-L-TSTTV--EAQIKEYNSLVLN-----------
R6A0L2          HTHSNS----------HDLI-PALNV---GDASF--NTQIAAYNDQMNK-----------
R7LG80          DNQTND----------RDLI-PALSL---KDASF--NTTIDKYNQLQMQ-----------
A0A2L2WX98      QNSSKR----------NETV-PVLSL---PEASF--TPLIGEYNNQMLE-----------
G5GD56          QNNSNE----------HQII-PA-IN-L-ERATF--NGQIDTYNQLMNE-----------
R5KD55          TNRANT----------NQLL-PANMG-L-DDGKT--DGLIDKYNALQLE-----------
A0A174QNT3      TDKSKS----------ADLI-PNVSG-V-GDAGV--QTQIEDYNEMMLQ-----------
A0A4S2FGS1      TDKTRS----------SDLI-PNVSG-V-GDVGV--QSQIESYNEMMLQ-----------
A0A7K3KG59      TDKTRS----------SDLI-PNVSG-V-GDVGV--QSQIESYNEMMLQ-----------
R9I0H0          TDKTRS----------SDLI-PNVSG-V-GDVGV--QSQIESYNEMMLQ-----------
K5BUT9          ADVTRK----------DQLI-PNVTG-V-GDVSM--QSQITAYNELMLQ-----------
A0A174FPA3      ADVTRK----------DQLI-PNVTG-V-GDVSM--QSQITAYNELMLQ-----------
R6S9Y6          ADVTRK----------DQLI-PNVTG-V-GDVSM--QSQITAYNELMLQ-----------
A0A7J4YSB2      ADVTRK----------DQLI-PNVTG-V-GDVSM--QSQITAYNELMLQ-----------
C9KX15          ADVTRK----------DQLI-PNVTG-V-GDVSM--QSQITAYNELMLQ-----------
A0A6H0KRK1      LDATRN----------NQLI-PNVSG-V-GDASV--QSQITAYNELMLQ-----------
R6DAG6          LDATRN----------NQLI-PNVSG-V-GDASV--QSQITAYNELMLQ-----------
A0A3L8AAP1      LDATRN----------NQLI-PNVSG-V-GDASV--QSQITAYNELMLQ-----------
A0A4S2AYX2      LDATRN----------NQLI-PNVSG-V-GDASV--QSQITAYNELMLQ-----------
A0A7J0A2L4      LDATRN----------NQLI-PNVSG-V-GDASV--QSQITAYNELMLQ-----------
A0A7K3MN31      LDATRN----------NQLI-PNVSG-V-GDASV--QSQITAYNELMLQ-----------
A0A0E2M2Y7      RQTSTD----------NELM-PANLG-L-TERGI--DNSITLYNDLKLK-----------
A0A0K2J6Z0      RQTSTD----------NELM-PANLG-L-TERGI--DNSITLYNDLKLK-----------
B2RKZ8          RQTSTD----------NELM-PANLG-L-TERGI--DNSITLYNDLKLK-----------
A0A212GC82      RQTSTD----------NELM-PANLG-L-TERGI--DNSITLYNDLKLK-----------
A0A254MU12      RQTSTD----------NELM-PANLG-L-TERGI--DNSITLYNDLKLK-----------
R6CQ93          TDPTKS----------RDLI-PSGTG-I-SDASV--EGQINQYNSLKLK-----------
A0A3D1NQW3      LDPTKT----------NELI-PGTLS-I-NSPAI--NSQIEGYNTELQR-----------
B0MT10          LDPTKT----------NELI-PGTLS-I-NSPAI--NSQIEGYNTELQR-----------
R7JGW9          LDPTKT----------NELI-PGTLS-I-NSPAI--NSQIEGYNTELQR-----------
A0A3D2BF46      LNDTKL----------RDLI-PANVA-I-TNVSI--SDQIKNYNELMLR-----------
A0A358R538      RDPAHA----------GELI-PMAAS-V-ASETV--AAQIDRYNEAILT-----------
A0A1Y4AAB8      LDREHA----------GDLI-PAMAA-I-ANSGI--TEQISAYNEGILR-----------
A0A1Y3WWY9      SDPSKA----------GELI-PAMAS-V-TNAAV--SAQIDEYNTSILQ-----------
A0A1Y4U5L4      SDPSKA----------GELI-PAMAS-V-TNAAV--SAQIDEYNTAILQ-----------
A0A1Y3VCJ1      ADPAKS----------GELI-PAMAA-I-SNGAV--TAQIDEYNATILQ-----------
A0A1Y3QTW7      NNPTHA----------GELI-PMVAS-L-TNNGI--VAQITEYNDAILR-----------
R6XWY7          NNPTHA----------GELI-PMVAS-L-TNNGI--VAQITEYNDAILR-----------
A0A4Y1X9Y9      DDPSHA----------GDLI-PMVAS-L-TNNGI--VAQITEYNDAILR-----------
A0A4Y1WM66      DDPSHA----------GDLI-PMVAS-L-TNNGI--VAQITEYNDAILR-----------
A0A6N4GYT3      DDPSHA----------GDLI-PMVAS-L-TNNGI--VAQITEYNDAILR-----------
A0A174AVF1      DDPSHA----------GDLI-PMVAS-L-TNNGI--VAQITEYNDAILR-----------
A0A656Q4F4      DDPSHA----------GDLI-PMVAS-L-TNNGI--VAQITEYNDAILR-----------
A0A1Q6EIY0      NDPSHA----------GDLI-PMVAS-M-TNNGI--VAQISEYNEAILR-----------
A0A5B5VN71      NDPSHA----------GDLI-PMVAS-M-TNNGI--VAQISEYNEAILR-----------
E4M8L3          NDPSHA----------GDLI-PMVAS-M-TNNGI--VAQISEYNEAILR-----------
I3YQ50          NDPSHA----------GDLI-PMVAS-M-TNNGI--VAQISEYNEAILR-----------
R5UEY8          NDPSHA----------GDLI-PMVAS-M-TNNGI--VAQISEYNEAILR-----------
A0A1H4D866      NDPKNA----------GELI-PMMAS-V-TNQGI--SSQIADYNNAILR-----------
A0A5B3G4Y7      NDPKNV----------GELI-PAMAA-AGTNTAI--AKQIEDYNSAILR-----------
A0A374A9J5      NDPKNV----------GELI-PAMAA-AGTNTAI--AKQIEDYNSAILR-----------
A0A5B3GQN5      NDPKNV----------GELI-PAMAA-AGTNTAI--AKQIEDYNSAILR-----------
A0A1Q6E9S3      NDPKNV----------GELI-PAMAA-AGTNTAI--AKQIEDYNSAILR-----------
D4IJ36          NDPKNV----------GELI-PAMAA-AGTNTAI--AKQIEDYNSAILR-----------
A0A414Q925      QDNSKT----------TELV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
A0A415PUS9      QDNSKT----------TELV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
A0A108TCU0      QDNSKT----------TEPV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
A0A413BA42      QDNSKT----------TEPV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
S3Y344          QDNSKT----------TEPV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
A0A7J5LEW3      QDNSKT----------TEPV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
A0A412TGL3      QDNSKT----------TEPV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
A0A413VJ33      QDNSKT----------TEPV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
A0A414L0W6      QDNSKT----------TEPV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
A0A412DP39      QDNSKT----------TEPV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
A0A413ZSE8      QDNSKT----------TEPV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
B0NP84          QDNSKT----------TEPV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
R6AK43          QDNSKT----------TEPV-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
A0A412N2D9      QDNSKT----------TDPI-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
A0A1Y4JYS9      QDNSKT----------TDPI-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
R6LHA4          QDNSKT----------TDPI-PASIG-I-DDMGV--QNLIMEYNTVLTR-----------
A0A3E5HPT8      QDSNKD----------DELI-PSNIG-L-SDLSI--ESQISRYNETLLR-----------
C6IJ48          QDSNKD----------DELI-PSNIG-L-SDLSI--ESQISRYNETLLR-----------
Q8A3U2          QDSNKD----------DELI-PSNIG-L-SDLSI--ESQISRYNETLLR-----------
A0A3R6S1H6      HDPQHE----------RDLI-PSNTG-I-PDVNI--EQSIGKYNEMLLK-----------
A0A3R6SD81      HDPQHE----------RDLI-PSNTG-I-PDVNI--EQSIGKYNEMLLK-----------
A0A354WXN6      IDPSHN----------ADLI-PANTG-V--DVNV--ESDISEYNTMLLK-----------
A0A7G1HW11      SDPVKI----------NDLI-PANTG-I-ESAEI--SGAISEYNQLLLK-----------
R5IP14          SDPVKI----------NDLI-PANTG-I-ESAEI--SGAISEYNQLLLK-----------
A0A316SZX7      SDEKHV----------SELL-PANTG-V-ADLGI--NEQIKEYNTLLLN-----------
A0A1Y4AIY1      SDPQKA----------LDLI-PANT--I-TDVTV--EQQIAAYNEMLLK-----------
A0A0J6CIR2      TDPHKS----------SDLI-PANTG-I-ADVNI--EGQISEYNNLLLK-----------
A0A3D8HG59      VDPSKE----------AELI-PANTG-I-SDSNV--ESQIGEYNALLLK-----------
A0A3R6S408      VDPSKE----------AELI-PANTG-I-SDSNV--ESQIGEYNALLLK-----------
F3ZRU7          IDPANR----------GKLI-PANTG-I-SDNTT--EGQIKEYNTMLLQ-----------
A0A1C5Q1F3      ADPAKS----------GELI-PSNTG-I-SDGTI--ERQIMEYNELMLQ-----------
R7A239          ADPAKS----------GELI-PSNTG-I-SDGTI--ERQIMEYNELMLQ-----------
A0A3R6HIK7      SDPQKA----------LELI-PANT--I-TDMKV--EQQISTYNEMLLK-----------
K5ZVW7          SDPQKA----------LELI-PANT--I-TDMKV--EQQISTYNEMLLK-----------
A0A1Y4D5Z0      SDPHKA----------SDLL-PANT--L-SDVNI--EQQIAEYNTQLLK-----------
A0A413VXJ7      VDPQKN----------ADLI-PANTG-I-SDNSV--ESQISEYNEMLLK-----------
I9RSN9          VDPQKN----------ADLI-PANTG-I-SDNSV--ESQISEYNEMLLK-----------
U6RJK5          VDPQKN----------ADLI-PANTG-I-SDNSV--ESQISEYNEMLLK-----------
A0A1Q6GA32      VDPQKN----------ADLI-PANTG-I-SDNSV--ESQISEYNEMLLK-----------
I9RPU6          TDPQKN----------SDLI-PANTG-I-SDNSV--EAQIKEYNDILLK-----------
I8YFS5          VDPQKS----------SDLI-PANTG-I-SDTSV--EAQIKEYNDMLLK-----------
A0A7J4XCM0      VDPQKG----------SDLI-PANTG-I-SDNSV--ESQIKEYNDMLLK-----------
I8Y597          VDPQKG----------SDLI-PANTG-I-SDNSV--ESQIKEYNDMLLK-----------
A0A1Q6GBF5      TDPLKN----------SDLI-PANTG-I-SDNSV--ESQIKEYNDILLK-----------
I8YFZ3          TDPQKN----------SDLI-PANTG-I-SDNSV--ESQIKEYNDILLK-----------
A0A7J4XFW0      TDPQKS----------SDLI-PANTG-I-SDNSV--ESQIKEYNDVLLK-----------
A0A1Q6GDH2      TDPQKN----------SDLI-PANTG-I-SDNSV--ESQIKEYNDILLK-----------
U6RSB0          TDPQKS----------SDLI-PANTG-I-SDNSV--ESQIKEYNDILLK-----------
I9GXM2          TDPQKS----------SDLI-PANTG-I-SDNSV--EFQIKEYNDILLK-----------
I9SIK1          TDPQKS----------SDLI-PANTG-I-SDNSV--ESQIKEYNDVLLK-----------
A0A7J4XIJ5      TDPQKS----------SDLI-PANTG-I-SDNSV--ESQIKEYNDVLLK-----------
I9TP59          TDPQKS----------SDLI-PANTG-I-SDNSV--ESQIKEYNDILLK-----------
R5S343          TDTRTR----------GKLI-PANTG-L-TDMNM--EGRIGEYNELLLK-----------
A0A1M6K7I9      VDPSKV----------ADLI-PANTG-I-TDAGV--EKQIAEYNEILLK-----------
A0A5M6A8C8      VDPSKI----------ADLI-PANTG-I-TDAGV--EKQIAEYNEILLK-----------
A0A7J4XCJ1      VDPQKN----------SDLI-PANTG-I-SDNSV--ESQIKEYNDMLLK-----------
A0A7J4XNQ7      IDPQKN----------SDLI-PANTG-I-SDNSV--EAQIKEYNDMLLK-----------
A0A3R5ZMK1      TDPGKS----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
A0A7K1HMX0      TDPGKS----------SELI-PANTG-I-SDVNI--ESQIGEYNEMLLK-----------
A0A1Y3ZIA4      TDPGKN----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
K5Y1A4          TDPGKN----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
A0A7K1HDC0      TDPGKS----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
A0A3R6K8X4      TDPGKS----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
A0A6N8D6C8      TDPGKS----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
A0A3R6BKI7      TDPGKS----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
A0A412M2W1      TDPGKS----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
K5ZX55          TDPGKS----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
A0A415BDM7      TDPGKS----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
A0A1Q6I3T6      TDPGKS----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
A0A414XX40      TDPGKS----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
A7AEU7          TDPGKS----------SDLI-PANTG-I-SDVNI--ESQIGEFNEMLLK-----------
A0A5F0U645      TDPHKG----------ADLI-PANTG-I-SDVSL--ESQISEYNTLLLK-----------
K5ZBN2          TDPHKG----------ADLI-PANTG-I-SDVSL--ESQISEYNTLLLK-----------
A0A0J6CKW3      TDPHKG----------ADLI-PANTG-I-SDVSL--ESQISEYNTLLLK-----------
A0A0F5IQM7      TDPHKG----------ADLI-PANTG-I-SDVSL--ESQISEYNTLLLK-----------
A0A496CDT3      TDPHKG----------ADLI-PANTG-I-SDVSL--ESQISEYNTLLLK-----------
A0A6G1ZKM3      TDPHKG----------ADLI-PANTG-I-SDVSL--ESQISEYNTLLLK-----------
S0GLB0          TDPHKG----------ADLI-PANTG-I-SDVSL--ESQISEYNTLLLK-----------
A0A3R6NLC1      TDPHKG----------ADLI-PANTG-I-SDANV--ESQISEYNALLLK-----------
A0A416WYC9      TDPHKG----------ADLI-PANTG-I-SDANV--ESQISEYNALLLK-----------
A0A0F5IT40      TDPHKS----------SDLI-PANTG-I-ADVNI--EGQISEYNNLLLK-----------
A0A496CX20      TDPHKS----------SDLI-PANTG-I-ADVNI--EGQISEYNNLLLK-----------
A0A5F0UBI0      TDPHKS----------SDLI-PANTG-I-ADVNI--EGQISEYNNLLLK-----------
A0A6G1ZHG0      TDPHKS----------SDLI-PANTG-I-ADVNI--EGQISEYNNLLLK-----------
S0GSI7          TDPHKS----------SDLI-PANTG-I-ADVNI--EGQISEYNNLLLK-----------
K5YB65          TDPHKS----------SDLI-PANTG-I-ADVNI--EGQISEYNNLLLK-----------
A0A0F5IWP9      IDPHKS----------SDLI-PANTG-I-ADVNI--EGQISEYNNLLLK-----------
A0A0F5IZT8      IDPHKS----------SDLI-PANTG-I-ADVNI--EGQISEYNNLLLK-----------
A0A417LKQ2      TDPHKS----------SDLI-PANTG-I-ADVNI--EGQISEYNNLLLK-----------
A0A416TME1      TDPHKS----------ADLI-PANTG-I-ADVNI--EGQISEYNNLLLK-----------
A0A416XPE8      TDPHKS----------ADLI-PANTG-I-ADVNI--EGQISEYNNLLLK-----------
A0A3B0C2S4      LGQSAY-----------GLL-PVDVG-L-ENSGI--NSLVAEYNEMAIE-----------
L8JI02          AEGRFG----------DVVA-PSTFG-L-EDPLL--SSLLIELSKLNQE-----------
A0A4Q5WS95      SAKQRD----------GSLV-PSTLG-I-DDPLL--SGLLEKLYQADLE-----------
A0A501VZX6      IAKEKA----------RGIV-PSTLG-L-NDAVL--SQLLQKLYNAEIE-----------
A0A399SH26      IAKDKS----------AGIV-PSTLG-I-NDPVL--TQLLQKLYDNEIQ-----------
A0A501W1A9      KAKNNT----------AGIV-PATLG-V-NDPVL--SQLLQKLYDAEIQ-----------
A0A0E3ZGV6      VRKNKD----------LGIV-PSTLG-V-SDPVL--SQLLQKLYNSEIQ-----------
A0A1I2N4S1      LSKEEN----------IGIV-PSTLG-V-SDPVL--SQLLQKLYEAEIQ-----------
A0A2T5YE44      LSKEQN----------IGIV-PSTLG-V-SDPVL--SQLLQKLYNAEIQ-----------
A0A1M5BA90      LSKNNQ----------IGIV-PSVVG-V-KDPLL--SSLLQKLYDSQMQ-----------
A0A512B879      QAKDSQ----------IGIV-PSIAG-L-KDPLL--AQLLQRYYDAQMQ-----------
A0A559PPI3      LSKDGG----------GSIV-PSTLG-I-DDPVL--TQLLQKLYNSEIE-----------
A0A1T5CS78      ISKGSA----------GGMV-PSTLG-I-SDPIL--SQLIEKLYNLEVD-----------
A0A0Q9Z8F1      ISKGSA----------GGMV-PSTLG-I-SDPIL--SQLIEKLYNLEVE-----------
A0A2N0U0M7      ISKGSA----------GGMV-PSTLG-I-SDPIL--SQLIEKLYNLEVE-----------
A0A1V9FHD0      NSKDNN----------TETV-PSTMD-I-PDPVL--TDLMQKMYTAKVE-----------
A0A4V4H170      NSNENN----------GNIV-PATLG-I-SDPVL--SELMQKMYNAKVE-----------
A0A1V9F098      NSKENK----------GDII-PATIG-I-SDPVL--TELMQKLYNGKLE-----------
A0A4R2VU64      SSKDNN----------ADML-PATMG-I-TDPLL--TDMMGKLNNAKVE-----------
A0A4S8HY23      KSNENK----------GDVV-PATLG-I-SDPVL--GELMQRMYNAKVE-----------
A0A1V9F383      TSRSNK----------GDLV-PATLG-I-TDPVL--SDLMQKLYNKKVE-----------
G8TRZ6          NQKSNT----------GDLI-PSTLG-I-ADPIL--SDLMSKLYSKRVE-----------
A0A4R5DL69      KKNPNGIIP-------------SSIV-L-QSSDF--TLLTDKYNTVQLS-----------
A0A1M4YED3      TSRNNK----------DGVA-PATLG-L-NDRGL--TSLVERLAEAEAN-----------
A0A2H3NSN0      VNQLNEAESSFRSDVEGE----QSVQ-S-MQNRI--AALDQQIADLEAQ-----------
A0A2P6C324      EDQMERAQPSLRSAVLKE----QEVQ-S-LRTQI--QALEDQIAELKAR-----------
A0A7C2DZI7      ERELQKLEPGLVNELVKS----RQVS-T-LEAQI--DALSRKIAELRVQ-----------
A0A1M6XHU0      EQELQKLEPGLVNELVKS----RQVA-T-LEAQI--DALSKKIAELKVQ-----------
G2SF81          EQELQKLEPGLVDELVKS----RQVS-T-LEAQI--DALSKKIAELKVQ-----------
A0A5S9EYW1      EQELQKLEPGLVDELVKS----RQVS-T-LEAQI--DALSKKIAELKVQ-----------
D0MHQ9          EQELQKLEPGLVDELVKS----RQVS-T-LEAQI--DALSKKIAELKVQ-----------
A0A126PFG0      ---VSTIERTLRDPRPTATV-PTALG-I-TDATL--SSLVEKLTELHAQ-----------
A0A3M1N7Z3      SEKLRRVLDTLRQDPAAEVA-FLPLG-A-LPEVQ--VPLTE-LNQLLEQ-----------
                                                                            

A0A1T5MMH4      --QERLKL----------SYNENTLAY----------------REKQQEIENRTDKTSQQ
A0A2W4R1L8      --FDRLKL----------SYSEVTFAF----------------REREQQIQNLQEQVTKQ
A0A2E5CV79      --NAMIYG-------------ENHSAV----------------IEIQKRVSIMKEKLDEK
A0A2D4ZVH1      --LYLTKNP---------GISENNPEI----------------ARIENEILKVKRQIKDR
A0A0K8QSK7      --KSRLGNV---------RVS---PRL----------------NQINAQIEKLKEALMAN
A0A1V6CN82      --KSKMSDV---------LIS---PRL----------------TQLNDQLGNVKEAMLEN
A0A1M4XZ45      --KSSQTSI---------RKGSEHPTI----------------LRLNAQIESVKNSLREN
A0A399D319      --KSSQTSI---------KRGSQHPII----------------LQLNAQIESVKNSLREN
A0A1V5IPN7      --ARLRTNE---------NYSENHPQM----------------KLLQEELAKTKNTLDTE
A0A1M6GR99      --KDNLIQ----------NNQQRNPIV----------------NRLDIQIKNLKNTVSEN
A6EBM4          --KEELLK----------VYNGDAQAV----------------MRLNRQIQEVRKAAMEN
A0A7C5M4P4      --RERLGL----------SYRQNTYTY----------------RARQKEIDLLQTDLLMQ
A0A1M6TTV4      --RMLKLE----------SYNENTQVI----------------QRLNQRLEISQNSAKFR
A0A4Q8RX32      --KRHLIE----------NRQDKSPQL----------------RELNFQTNNLKKTILVN
K0X1U5          --RMRLLR----------TAKDSNLAL----------------RTLTAQIDVMRENILNT
R5EXK3          --RMRLLR----------TAKDSNLAL----------------RTLTAQIDVMRENILNT
A0A401UAP7      --INELKL----------SYKESTFAY----------------QELQRDIEFAEKALVIQ
A0A1W2GF52      --RALKLN----------SYNENTQVI----------------KRLDQQIEIAKNSANSR
A0A2G5L7B8      --RLLKLD----------TYNENTQII----------------KQLNSRIDLSQKAVHDR
A0A523GAC0      --RELLKI----------SYHKNTFAV----------------IKVDQEITLIQEQLESY
L8JW09          --RDKLRL----------SYNETTFAL----------------TRKEEEIKNSKTALKAQ
A0A364XUP5      --QEKLKL----------SYNETTFAY----------------RELEKEIETHSTRAIEH
A0A1M5RLA9      --QEKLKL----------SYNEATFAY----------------RQRQKDIETLRAKASRQ
A0A385SFR9      --QEKLKL----------SYKEVTFAY----------------RQRQKDIETLRDKSGRQ
A0A5M4A9J4      --LTTLETT---------VIDKNHPTL----------------QQLRSQIEVTKKALIEN
A0A5M4B1C7      --LKTLKTA---------VIDPNHPSV----------------IQLRTQIRVTQKAVVEN
A0A0D3LFR6      --KEVLLE----------HYNENTQAA----------------QMKIKQVSMIKEDLLAA
M7N6D4          --KEILLA----------SQNENTQAV----------------QLRNKKISAVKEELANA
A0A4D7K1D4      --RLQLLE----------KYNENTYAV----------------RKLNNELKIHKQELNDQ
A0A5C7MX19      --RNLVLL----------DVTPDHPKV----------------RLLDKQIQDFKEELNNN
A0A1Q3ZMZ7      --RDILLN----------KVQKSNPEI----------------TIKEKQIDQKIREIKKS
A0A2D8JJW3      --EQEIGK-----------------------------------NDIPKSYELAIKDTLRF
A0A2W2AFF7      --RERMLM----------STTEENPMV----------------RNMDQQSDNLRGDINNS
R7PCR1          --KKNLE-----------QNSTNSPVI----------------RDMNEALKAKRASILAG
A0A2N5YXE2      --KEILLF----------DVTANNHKI----------------VTIDEQIATKKATIVDF
A0A1G9E2A9      --QSTLLVS---------TKP-TTQAY----------------QFGVTEINKLEKSVKEL
A0A098LL25      --RNRLLNS---------QRE-NTLVV----------------KTKNKSIERIKENVLEL
A0A6J4H627      --RAMLATT---------TRE-TTFAF----------------QTKDKQIRLARESASAL
A0A6C0GJI1      --KALALAS---------SKS-TTFAI----------------QSKNQAIEIAKNSISEL
A0A2T2YJE8      --RNLMVQS---------YKT-TTKAY----------------QLLEEEIKFVEQSVRKL
A0A7L7LEW0      --RNLMVQS---------YKT-TTKAY----------------QLLEEEIKFVEESVRKL
A0A127B287      --RRKVLTT---------TRG-NTLSV----------------ELLDQQIKFAQDKVSSL
A0A6P1P2P6      --RRKVLTT---------ARG-NTLSV----------------GLLDQQIKFAQEKINTL
A0A3M9N829      --SRTARMT---------SRG-NTAAD----------------NLREEQLKFTQGRLNAI
A0A0P0CSF9      --QRTRRLT---------SRG-NTLAD----------------NSLEERLEIAQNRLRDV
A0A5M8QQB8      --IRTQSMT---------SRG-NTTAE----------------KLAEEQLRFAQNRIAGI
A0A3M9MNC3      --QRTRKLT---------SRG-NTLAD----------------NALEERLQFAQGRLRDA
A0A5B6TAX2      --LRTVRLT---------SRG-NTTAD----------------NALEEKLAFSQNRIAGI
A0A7L5A132      --LNRLLES---------YRP-TTTAV----------------QLKQEALEYTRRNIRGL
A0A512AYT3      --YKLLKRS---------YKD-STEAV----------------RRYQKEMAFTKDAVNKL
A0A5M6CYN7      --YKLLLRS---------YKP-ETEAV----------------KRAQKEISLTKEAASKL
A0A369QP10      --RSLMMQS---------YKT-TTKAY----------------QLLEEEIDFSEKAVRKL
A0A7G7G7M4      --RSLMMQS---------YKT-TTKAY----------------QLLEEEIDFAEKAVRKL
A0A126PDF2      --QERIRRS---------YT-GATEAV----------------QQKNAQMDYTLSSILRQ
A0A2Z3GKA1      --QERIRRS---------YT-GATEAV----------------QQKNAQMDYTLSSILRQ
A0A502GZP7      --QERVSRS---------YT-GATEAM----------------QQKNALMAYTLSSILRQ
A0A519SBU8      --LRLTLKS---------QT-DKTFAV----------------QRNQAIIRETRVSLQRQ
A0A4Q3JNZ3      --LRLTLKS---------QT-DQTFAV----------------QRDEAVVRETRKSLQRQ
A0A519Q9V3      --LRLTLKS---------QT-DKTFAV----------------QRDQAIIRDTRDLLQHQ
A0A0M3RW20      --LRRVLRS---------ST-EATEAV----------------QQRKAAVEYAKRNVQDA
A0A495VFX4      --LRRVLRS---------NT-EATEAV----------------QQRKAAVEYAKQNVKDA
A0A418R9X5      --LSQLLKS---------YQE-TTTAV----------------KLRRAEIANIKAIIREL
A0A428JSJ3      --LSQLLKS---------YQE-TTTAV----------------KLRRSEIANIKGIIREL
A0A428KI59      --LSQLLKS---------YQE-TTTAV----------------KLRRSEIANVKSIIREL
W8F1I6          --LSQLLKS---------YQE-TTTAV----------------KLRRSEIANVKSIIREL
A0A246FQC0      --LKRALLS---------YQPGATLAM----------------QTKEQNIADLKKIVRQL
A0A372E5P8      --LKRALLS---------YQPGATVAM----------------QIKEQSITNIKKIVRQL
A0A1H3EMW1      --LKRALLS---------YQPGATVAM----------------QIKEQSIADLKKIVRQL
A0A1H9ZSN3      --LKRALLS---------YQPGATLAM----------------QTKEQSIADLKKIVRQL
A0A1S9B3W0      --MRKVLQS---------YQPNATTAV----------------RIKEDQLQKTKSNIQKL
A0A1W1VRL3      --LRRVLRS---------YK-ETTEAV----------------KQRRVQLDFTRSTIRRL
A0A7G6YQJ9      --LQQVLKS---------YK-STTTAV----------------QLRQEAMAFTKKTVQDL
A0A1M6R305      --LRRLSRS---------YK-ETTEAV----------------QQQREALSYVRGNLRRT
A0A7G7W8X3      --LRRLSRS---------YK-ETTEAV----------------QQQREALNYVKGNLRRT
A0A4Z0PHK3      --LRRLLRS---------YN-ETTEAV----------------KQQQAALAYVKNNIRRL
A0A2M9B9H9      --LRRLLRS---------YN-ETTEAV----------------KQQQAQLAYVKNNIRRL
A0A4Z0QCY9      --LRRLLRS---------YN-ETTEAV----------------KQQQAALAYVKNNIRRL
A0A5N1J2M4      --REVVLAS---------NQP-GTFAV----------------TSIETQINKLKKDIREL
A0A519S476      --LRLTLKS---------QTD-KTTAV----------------QLQQAEIRETRAALRRQ
A0A4Q3JRW8      --LRLTLKS---------QTD-KTFAV----------------QRNQALIRDTRELLQRQ
A0A519M923      --LRLTLKS---------QTD-KTLAV----------------QRNEAIIRDTRTSLQRQ
A0A4Z0ENW1      --LRRIRRS---------YQD-RLEAV----------------QGPLTQLKFAQATLQHQ
A0A519UDB4      --LRRVERS---------YTD-KTEAL----------------SQLRAQVQFARAALQKQ
A0A3S0QKV1      --MRKILES---------YQPNATAAV----------------RIREDQLRRTRDGVQKL
A0A328BL48      --LRQVLQS---------YQP-TTTAV----------------QIRQSQLAFTKRSIRRL
A0A5R8WLY4      --LRQVLQS---------YQP-TTTAV----------------QIRQSQLAFTKRSIRRL
A0A1I5WSL8      --LRRISRS---------YTD-KTETV----------------QRTKADIEYARTAVSRL
A0A0U3JVM7      --LRRASRS---------YTD-KTEAI----------------QSKQANIEYTRASIKRL
A0A1G1SSV2      --LRRVSRS---------YNE-STEAV----------------QGIRDDIAYTRASLKRL
A0A1G1SXV7      --LRRVSRS---------YNE-STEAI----------------QGIRDDIAFTRASLKRL
A0A6G8CBJ6      --LRRVLRS---------YKE-TTEAV----------------KQRRVQLDFTKNTIRRL
A0A0W8EDI5      --MNRLLES---------YKP-TTTAV----------------QIRREQLDFTRRSIRRL
A0A3B7RBP8      --LNRVLES---------YKS-TTTAV----------------QIKQEQLDYTRRSIGRL
A0A3R9P8H7      --LKRALLS---------YQPGATTAM----------------QTKEQFVADLKKIVRQL
A0A238WIA7      --LNRASVG---------YKP-TTTAI----------------QVIQDQIAFTKRSIRQL
A0A212UCJ7      --INRVSNS---------YTP-ETQTI----------------KNLQGQITFTKQNINQL
A0A4Z0MQE1      --INRISNS---------YTP-ATQAI----------------KNLQDQIAFVKRNINQL
A0A4Z0PCF4      --INRISNS---------YTP-ETQTI----------------KNLQQQIAFVKRNIMQL
A0A6M6BED0      --INRISNS---------YTP-ETQTI----------------KNLQQQIAFVKRNIIQL
A0A5D6VDG1      --LRRVLRS---------NTE-ATEAV----------------QLRRANVAYAKRNVQES
A0A243WHR7      --LRRILRS---------YQP-TTFTV----------------QQLQADVNLVKKSTQRL
A0A5B8A0P6      --LQRLLRS---------YKE-TTEAV----------------KQQESMLVFIKQNIRRS
A0A076HRT9      --LRRLLRS---------YKE-TTEAV----------------QQQREQLNFVKGNVRRT
A0A4Z0PVM7      --LRRLLRS---------YNE-TTEAV----------------KQQQAALAYVKNNIRRL
A0A1M6DHW8      --LRRILRS---------YTP-ATEAV----------------QQQQSTIAFLKGSIRRQ
A0A4Q5LC61      --LRRILRS---------YTP-ATEAV----------------KQQQSAITYLKNSVRRQ
K0XJ09          --RERLAA----------NSGENNPLV----------------KDLDNNLAAVRVNLTAS
R5EUZ0          --RERLAA----------NSGENNPLV----------------KDLDNNLAAVRVNLTAS
W0EQS0          --RERLVA----------NSGESNPLV----------------RDLDSNLASVRENLSSS
A0A1Y3WE15      --RERLAA----------NSGENNPLV----------------RDLDNNLASVRVNLASS
A0A1Y4GUK3      --RERLAA----------NSGENNPLV----------------RDLDKNLASVRINLASS
A0A2U1FKU2      --YDRLKQ----------SSSENSPAV----------------QEAAMQLVSMRKSINVA
A0A0A2F954      --YERLKQ----------SSSENSPAV----------------QEVGMQLVAMRKSINAA
A0A0A2FW91      --YDRLKQ----------SSSESNPLV----------------QEMAMQLVAMRKSINAA
A0A2D2N2N1      --YDRLKQ----------SSSENSPAV----------------QEVGMQLVAMRKSINAA
Q7MWZ2          --YDRLKQ----------SSSENSPAV----------------QEVGMQLVAMRKSINAA
T2NDT6          --YDRLKQ----------SSSENSPAV----------------QEVGMQLVAMRKSINAA
W1R7P9          --YDRLKQ----------SSSENSPAV----------------QEVGMQLVAMRKSINAA
A0A1R4AFZ0      --YDRLKQ----------SSSENSPAV----------------QEVGMQLVAMRKSINAA
A0A1R4DVZ7      --YDRLKQ----------SSSENSPAV----------------QEVGMQLVAMRKSINAA
A0A7C0WKI7      --IEYKIE----------GVNENFPNM----------------KKMKKDINALKKELKGE
A0A2A8CVM9      TDRIETEFP---------QLADLLERI----------------NGLEKRKRSLTNQLVAE
A0A5M4B212      --LTTLSAT---------VKDPEHPRM----------------RQLSIQMETTKRTLLEN
A0A3D1KEX9      --YTRLSA----------NSSNSSSVI----------------QDYEKSLVAMRSAIKVS
A0A358Y7S2      --KEELLK----------DVTLENEAI----------------KRIEIKIQNKISNIRRS
A0A1X7J248      --YQLSKT----------RYKKESQVL----------------LQRKIEINVLKDRINNY
E4TQD2          --YQMAKT----------RYKKESQVL----------------LQRNLEINALKDRINNY
A0A2J6HHN3      --RQEYLI----------TMTENSTVI----------------ESIDKQISYQKRMIHQS
A0A1Y3WMT8      --RMRLLR----------TAKDSNLSL----------------RTLTAQIDAMRDNILNT
A0A1Y4GQU1      --RMRLLR----------TAKDSNLSL----------------LTLTAQIDAMRENILNT
A0A6A0R272      --KATLGV----------NFTIDSKKA----------------RELDSQIIETINSIRES
A0A1V5W8T5      --KEQLLI----------TVTPDNHKV----------------KVIDQQILEQKKLLLDF
A0A2T8HKA9      --RNRLLE----------GNNSNNPYV----------------QELDQYLSSNRQNIERA
A0A2I0QZ80      --KEDLSY----------KVTQNNDII----------------QKLEKRITIRKESITRI
A0A3E1F1A3      --KEDLLF----------QVTPQNEKI----------------SKLEGRIQVRKENIDEV
A0A2U2XBJ3      --KEDLLY----------QVTPQNENI----------------KKLEMRIQIRKENIDEV
A0A4Q4KU94      --KEDLLY----------QVTPENENI----------------KKLIMRIQVRKENIDEI
A0A3B8INU3      --LDQLLL----------SHDPRTLIV----------------RRTQQSLQILRDELLDA
A0A2W1NDY9      --QEDASY----------RMTMENDGL----------------KNLESNIINQTETINRT
A0A5C8AQR5      --KEDLLF----------DVKPDNSVI----------------VNLNQRIEGKIQAIKRS
A0A1G0CI31      --KEDLLF----------DVTENNTEI----------------KNINIQIQSKIQSIRRS
A0A556N0M0      --KEELLT----------NVSENNSEL----------------KNLNSRIQSKVQSIRRS
F2IKD6          --KEELLT----------NVTENNSEL----------------KNLNTRIQSKIQYIRRS
A0A1I7BM74      --RENLLY----------TVTEESRTI----------------TQLDKKISADIEITNKI
A0A2G2FJ17      --KEDLLY----------KVTPENDMI----------------KKIETRVDNRIQNINKI
A0A2E3R1D0      --DTNPPA----------NIARLRTEL----------------ARVEADQERIARQLSAQ
A0A2T2USC0      D-SSPKAR----------EFARLEEKS----------------RQLSREADSLAQQYVQQ
A0A2T2V0F3      G-TSPKAR----------EFARLKERA----------------RQLDREADSLAQKYVSE
A0A2T2S682      A-STARAK----------NLRQLQRRA----------------DRLERQADSLADAYVEK
D5H561          P-TPADSA----------QAAQIDRRI----------------QKLRARIQRLSDRYVEE
A0A2H3NWA9      PNGNALER----------ELARTQERI----------------DRLDTQAQDIAARYVDQ
A0A2A8CVB6      --GGTLQR----------DLRRMKERV----------------SRLQERADSLASKYVNE
A0A2P6C1S6      --TSQLGR----------ELQRMKTRA----------------QTLARRTDSLANRYVEE
A0A2T2UTM4      --TSRLGQ----------ELQRMKARA----------------ATLDRKTDSLASRYVRE
A0A414ZBF2      --KNKLMA----------NSSANNPIV----------------REMNASLVSMRASISKA
A0A1Q3Q573      --REIKLL----------ERTEDHPEV----------------RLLDKQIFSSKNQLLKR
A0A662BAY3      --KSSMTS----------VKNTEHPKL----------------KRLNAQIENAKSNLLEN
A0A4U3L369      --RDRVSL----------NYPDTNPLL----------------QNIDMQLSNLRRDMINN
A0A357YNR3      --RNRLAR----------IASSSNQSM----------------IDLNYQLTSMLNSVKSS
A0A5E8AX52      --REVLLG----------SYNENTHAV----------------SRMTQRLETLKKNVRGI
F4KK08          --RDQLQA----------NSSSQNPLV----------------QELNTQLAAQRLSIITS
A0A6B5PK86      --KEDVLF----------RLTPESSEV----------------KRIDKKIQEKIKQILRS
A0A2G2F510      --KEDLLY----------RVTPENSEV----------------KLLDRKVKAKTNLIQRS
A0A316JZ08      --KEDLLV----------SLTPNNEKV----------------ALVQKRIDTKINTILRS
A0A496LCF9      --LL--------------DLGAKNPQY----------------EVVSGQIAQIKNQLNEL
A0A5P2G2A9      --KERYAT----------TNTSENPGM----------------IALDSQIGKARKELIGN
A0A3C0ZQC7      --AQNPTYV---------GQDIYTQKL----------------KEIDVQINALREKLRKR
A0A3N2N6F7      --RDQLLS----------TTGENSPLV----------------KDRDNSLASIRAALASS
A0A419VXB7      --KETLSY----------SVHSKNPGI----------------QVIDKELEYVKKSLVEN
A0A0B0BTJ4      --RMRLGT----------ETSDDNPVI----------------REMNAQIISMQHSLKKS
A0A3B9CNN6      --RMRLGT----------ETSDDNPVI----------------REMNAQIISMQHSLKKS
R5X290          --RMRLGT----------ETSDDNPVI----------------REMNAQIISMQHSLKKS
A0A1Q6E6I7      --RMRLGT----------ETSDDNPVI----------------REMNAQIISMQHSLKKS
C3J7R8          --RDQLIA----------NAETQNPVV----------------ETLEKQLASMHVAVVKS
A0A1G8BVM8      --RNKLLA----------NSTSNNPII----------------NDLQTSLVSMRSSILSS
A0A1I1FXP9      --KEMMSY----------TAKEGTLAA----------------RLRDKKIGSMGEDLLKI
A0A4P7VVU7      --RDKLSN----------STGDTNPLL----------------QDYDKNLRSMRSALVSS
A0A2V1ILM4      --RDKLSN----------STGDTNPLL----------------QDYDKNLRSMRSALVSS
A0A3N2L0E8      --RDKLSN----------STGDTNPLL----------------QDYDKNLRSMRSALVSS
A0A3N2LFC5      --RDKLSN----------STGDTNPLL----------------QDYDKNLRSMRSALVSS
A0A7K3KWJ8      --RDKLSN----------STGDTNPLL----------------QDYDKNLRSMRSALVSS
A0A3N4H5N3      --RQRLSR----------VVQPNNQQI----------------LSLNEQISSLRSNIIQN
A0A2P8EAX2      --RQRISR----------IVQPNNQQL----------------ISLNEQLSSLKSNILQN
A0A4V2F6N9      --RQRISR----------IVQPNNQQL----------------IALNEQLSSLKSNILQN
A0A3B9FXJ0      --KANLML----------SLPPTDPKV----------------KLVTGQIDEVKKNFKEA
R5GSU5          --RNRLAP----------NTGENSPVM----------------NDLNQKLIATNEAIRAS
A0A2A3UE91      --KENLLY----------AVTPNSENI----------------KQVNYQLENQRKLLLES
A0A0A2G557      --REQLLS----------ESGQTNPLI----------------ETQQKQLESLRKAIIKS
A0A2N2WFW8      --KQDLLV----------HITENSTAV----------------ESVNSQIDFQKRIIRES
A0A1F3IU95      --KQELLL----------RVTENSTAI----------------ESINAQIEFQNKIIRES
A0A3D0VUF6      --KQELLL----------RVTENSTAI----------------ESINAQIEFQNKIIRES
A0A1T4PT95      --RERLLS----------ESGQTNPLI----------------ETQQKQLESLQKAIIKS
A0A6I6JYY3      --KSSLTSV---------RANSQHPAI----------------VRLNAQIESVKNSLLEN
A0A2A4PYG9      --KEEILY----------TATKESEAV----------------KGVNYQISVQKKLLIGS
A0A1F3K695      --KEVLLN----------DVTNNNHQI----------------KVVDKQIENQKMILTEF
A0A353KZR1      --KEVLLN----------DVTNNNHQI----------------KVVDKQIENQKMILTEF
A0A2N2WYB5      --KEQLLN----------DVTPNNLKI----------------KQLDKQISNQKNLLIDF
A0A1F3K4G0      --KEQLLN----------DITRDNLKI----------------KLLEKQIDNQKDLLLEF
A0A356H8Y3      --KEQLLN----------DITRDNLKI----------------KLLEKQIDNQKDLLLEF
A0A351HSA6      --KEQLLN----------DITRDNLKI----------------KLLEKQIDNQKDLLLEF
A0A1F3Q014      --KEEMLY----------DVKPNSEAT----------------RLIDYQIEIQKKLLKES
A0A2D5KD44      --KQELLF----------TMRENSNRI----------------QEIDYQIDIQKKLISES
A0A6N9NIX1      --KQNQLY----------SNTASSDQV----------------KNINYRIEVQKKLLLTT
A0A2A4YXP3      --KENLQF----------EVTKDSEII----------------KSLDHKIKVQKKILFES
A0A1F3R158      --RQKILN----------EATKESDLI----------------KFHDQQIEVQKEVLFKT
A0A2M8ADX2      --RQKMLT----------EATKESDLI----------------KIQDQQIELQKEVLFKT
A0A1J5B2H0      --REQLLY----------EVTLNSSQI----------------ESINYQINIQKKLLIES
A0A1V5N756      --KEELLY----------NVTAYNSQI----------------KQINYKLDIQKKLFAES
A0A651GU15      --KEEMGF----------NVKGNHGAV----------------KNIEYQVEIQKRLILEA
A0A3Q9FR88      --ALRIKD----------SYTSNTIAS----------------NAKLELYKKLRYEVAES
A0A553GEX3      --ALRIKE----------SYTSNTIAS----------------NAKLELYKKLRYEVAES
A0A150ADJ9      --ANRIKN----------SYTERTVAS----------------NAKLELYKKLRYEVAES
A0A1B1FWQ4      --ALRIRE----------SYTSNTVAS----------------NSTLELYKKLRYEVAES
A0A1S1Z228      --ALRIKE----------SYTSNTVAS----------------NSTLELYKKLRFEVAES
A1ZKR2          --KKILAL----------KATGSSIVV----------------KDINQKLELQRTQVQKL
A0A1Q3GX01      --KKLLDL----------KVNNSSMVF----------------KDVNKKLDIQKEKATRI
A0A349DQI4      --KKLLDL----------RATSSSMII----------------QNINQQLNTQKAKANRL
A0A4P5TMD1      --KREKLL----------KLKPANPQI----------------INIDKQIDEVKTNIIQN
A0A2N3IIZ0      --RQNQEL----------SETSATYSY----------------QVLDIKINNLQKNITES
A0A7K3WUF2      --REEIQY----------DLKETSSRI----------------QSLDYSINIQKNLIVES
A0A1F3SJM1      --KEDLLY----------NVTEENEEV----------------VALTKKIKAKILLIQHS
A0A2G2EB96      --KEDLLF----------EVTEANSEI----------------AIINQKIASKLRIIQRS
A0A2G6PRA9      --KEDLLF----------EVTENNSEI----------------EIINQRITSKLNIIQRS
A0A497D5Z2      --KSSLTS----------VKNMEHPKL----------------KRLNAQIESVKSSLLEN
A0A662B170      --KSSLTS----------VKNMEHPKL----------------KRLNAQIESVKSSLLEN
A0A2A5FYT6      --KEEMLY----------SETEKSEKI----------------KSIDYQISIQKNLLLES
A0A2E6SYP1      --RRELSF----------RVTEESYEV----------------KEIDFQIKLQLNDLKEV
A0A2E5RLE8      --KRSLSF----------RITEESYQV----------------KEIDFQINLEIQDLLEV
A0A2E7TQF6      --KRSLSF----------RITEESYQV----------------KEIDFQINLEIQDLLEV
A0A2E6GVY9      --KRSLSF----------RITEESYQV----------------KEIDFQINLEIEDLLEV
A0A350JJ90      --RNRLLG----------GATMDNPNI----------------RVYDQQISVQKNLVIKS
A0A3M1CDV2      --KENLLY----------QVTPNSEQI----------------KIINYQIENQKKILIET
A0A6C1QGZ7      --RERLLY----------EVTAESRQI----------------EALNYQIEIQKRILAES
A0A4P5U6G4      --KRYFLL----------SKTANNPEV----------------INIEKQIDDLKLNIKEN
A0A2E2TFD1      --KDQSLY----------EVTQSSGRV----------------QNLDYQVRIQKKLLFES
A0A2E4ELE6      --REQSLY----------EVTADNGRV----------------KNLEYQISIQKKLLVES
A0A522EYA6      --REELLY----------QVTPTSEKI----------------KSIEFQIEVQKKLLLES
A0A2E3XZI5      --RDLLLK----------EVTKNNKNF----------------IQLNRQIEEEILYIKKA
A0A6I7QXV0      --KNALLL----------NVKSNHPQV----------------LLIEENIEMLKRELFEN
A0A2M7NLQ9      --KKFMLD----------RLTKQTAAY----------------QQKEKKIELLKKEVDKF
I4AFR0          --KKFMLD----------RVTKQTGAY----------------QQKAKRIDLLKKEVDKF
A0A2N2Y3E5      --KEKAMN----------NLTTQSFQI----------------KSIDKQIDNQREILKEF
A0A2D9D7T6      --KENLLT----------GLTPQNKEI----------------EILDQKIDARIVSIRKS
A0A1F3PPL5      --KDMLLN----------DVTNNNHKI----------------KIVDKQIENLRKTMIDF
A0A357QK06      --KDMLLN----------DVTNNNHKI----------------KIVDKQIENLRKTMIDF
A0A662AEA4      --KQQLLN----------DVTSNNYQI----------------TTIDKQINNQRQLIIEL
A0A0S2HYK8      --KNQLLN----------DVTENNMRI----------------KIIDKQIANQKKLIIDF
A0A2N5ZWN6      --KNQLLN----------DVTENNMRI----------------KLIDNQIENQRRLIIDF
A0A2E0FJ09      --YEDLIS----------ERTGDHEEI----------------KKIRSQIDVQTKLISEG
A0A1F3FZ62      --KEKMLY----------EITPDNRQI----------------NALEYQLGIQKKIMFET
A0A1F3K211      --KEKMLY----------EITPDNRQI----------------NALEYQLGIQKKIMFET
A0A1V6I2U9      --KEVLLF----------DLTSNSHKI----------------QTLDEQIKSKKETIIDF
A0A2H0B957      --RDAYLN----------NQTKNSYQI----------------KVIEKQIETQKQTLIDL
A0A1F3CFW6      --RDLYLN----------NQTQNSFQI----------------KVIEKQIETQKQTIIDL
A0A2M7E2T8      --RDLYLN----------NQTQNSFQI----------------KVIEKQIETQKQTIIDL
A0A2M7NC69      --RDLYLN----------NQTQNSFQI----------------KVIEKQIETQKQTIIDL
A0A1F3KLL5      --REQMLS----------DVTANNYKI----------------KVIDKQIVTKKGILVEF
A0A359D1M1      --REQMLS----------DVTANNYKI----------------KVIDKQIVTKKGILVEF
A0A0F2NS19      --KQNLLS----------EVTVNSGSV----------------KSLENQIDVQKQILFTT
A0A2A5H8X6      --KQNLLS----------EVTVNSGSI----------------KSLENQIDVQKQILFTT
A0A2H0GAU8      --KQNLLG----------EVTVSSEAS----------------KSLDRKIEIQKEVLFAT
A0A2M8FTK1      --KQNLLG----------EVTVSSEAS----------------KSLDRKIEIQKEVLFAT
A0A2A5B3B0      --QENLQY----------EVTKNNEVV----------------KSLKHQINVQKKVLFES
A0A5C6RXM7      --KENMLY----------EVTDNSGAI----------------NSMNYKIDVQKKLLTES
A0A1F3C1M2      --KEILLN----------DVTKNNHQI----------------QVIDKQVQNQKEILIEF
A0A1F3DS87      --KEILLN----------DVTKNNHQI----------------QVIDKQVQNQKQILIEF
A0A6A0R6K9      --KQKLLF----------SNKEDNSLL----------------KELDFQIDIQKKLIVSS
A0A2E7CT70      --RDELLR----------DVTESNENV----------------ILLNYQIEEEIIYISKA
A0A2D5V560      --RDQLLK----------DITPNNKNI----------------IILNGEIEESVVYIKKA
A0A2D7K5A8      --RDELLK----------DITPNNKNI----------------ILLNGQIEESVLYIKKA
A0A2E1XQ82      --RDELLK----------DITPNNKNI----------------ILLNGQIEESILYIKKA
A0A5C8A5B4      --LAAQNLS---------TGARSNPTV----------------IAMERKLNNLKSSLAQT
A0A7C1LGX3      ---RNKLLQ---------TVGIQHPSL----------------IAISTQLEVAKVNIIKT
A0A4Y9ITE2      ---RMKLVN---------NAKTNNNAAL---------------RTISSQLDAMRENINAT
A0A5M8NYX7      ---KNRATL---------GLKPTNSIV----------------REYEERIALLRTNLLKG
A0A0E3V905      ---RDHLLH---------TTSELNPLL----------------ETVDSQIKITKNNMAST
A0A553ETH6      ---REQLRL---------SYSETTFAL----------------TKKEQEIQSLKTAISKN
A0A640Q161      ---VSELSN---------VYGPKHPRM----------------IAANAELSSIRETLNGQ
A0A640QU49      ---VSELSK---------VYGPKHPRM----------------IAANAELSSIRDTLSSQ
A0A1Q3PII2      ---RVKALS---------QLSPGHPDF----------------ILLEEQISVLRNSLFDA
A0A351BXT2      ---RD--VE---------ASIPNDEKLREKTLAEYNRKIAPLRETLEEKIEVMRSSLFAS
A0A2K8Z965      ---RDQMAR---------TTSEQHPML----------------ETINSQIRTAENNMAGN
A0A418M8U8      ---RSQLAR---------TTSDQNPLL----------------QTIDTQINSLKGNMEDN
I2GTA4          ---RSQLVR---------TTSEQNPLI----------------QTIDTQINSLKGNMEDN
A0A2K8ZAJ2      ---REDLLK---------TTSSGSPLI----------------ESLDSQLKNTNAAISEN
A0A368JPA3      ---RTVLLR---------NSPEPSAVL----------------RSLDDQIFATRASIGET
A0A5N1JI29      ---RTVLLR---------NSPEPSPVL----------------RSLDDQIFATRASISET
A0A7K0EGC9      ---RNVLAR---------NSPESNPVL----------------RSLNDQISATKSSINET
A0A3P1BT12      ---RSLLVR---------NSSDSNPVL----------------RSLDDQISATKTSINET
A0A3P1CI15      ---RNLLAR---------NSSESSPLL----------------RSLDDQIATTRASLAET
A0A4R8CUK1      ---RDRLVR---------TTSEANPIV----------------QSITHQIDATKSSASET
A0A3D0MYJ7      ---RDIELS---------T--VENPQVYAKVESDYNKKISTLKSQYDKYYEEFVIGITSL
A0A662AH13      ---RDIALS---------DTTVSDASK-PILKAEADRRIGELKTELDNELAKYKASIFAA
A0A5C7QA01      ---QADLVV---------KYTDDHPAM----------------REINAQI----------
A0A3D3LS70      ---RDMELT---------I--PKDPKLIEKVKNEYDAKITALKKSLDEKVELLKTGIYAG
A0A1G1TM36      ---RETLLT---------TTPAGNPLF----------------KPLDSEIQTTQLAIRTS
A0A1G7ZF38      ---LTRALA---------SLAPGHPEV----------------QSMEKQIGVLRTSLADA
C6VS52          ---RVKALT---------TLAPNHPAV----------------TTLDSQIAAARGNLFDA
A0A2A4G4B1      ---KNQLLE---------SASENHPTI----------------LTMNERLTELQKGIAIS
A0A0P7X1V8      ---RETQRTLLLSRNPQLRNTPDDPSL----------------IEINQQIEGLREEIARL
A0A6P1P355      ---YQRLLS---------TTAENNPIL----------------LALASEIDRIRPSILEN
A0A5C8KAD6      ---YQKLKN---------TTAENNPIL----------------ISLAEEIGKVKPGIIEN
A0A5N1J695      ---YNNLKN---------TTAENNPIL----------------LALADEIQKVRPGILEN
A0A3N2M1H3      ---RNNLVS---------NSSERNPLV----------------EDYDSQLNGLRESITRS
A0A4S2G8T2      ---RNNLVS---------NSSERNPLV----------------EDYDSQLNGLRESITRS
A0A212K7W5      ---RNTLLA---------NSSDNNPLV----------------LDIKQSLLFVREAIISS
F5IU11          ---RNTLQA---------NSSDNNPLV----------------LDMKQSLLFMREAIISS
A0A7C1QWC7      ---RSAILS---------NNAEKNLFL----------------DQIENKINLQKKTIIEN
A0A352Z1R7      ---KRTLLT---------DYTENHPAV----------------RTIQGQIDEIQKKIRST
A0A0A2F501      ---RNSLRA---------NSSDENPIV----------------QDLTTQIGAMRSIILSS
R5B7P0          ---RNNLVA---------NSGEENVLV----------------KDLDQALASMRGSISRS
R5B0L5          ---RNQLAA---------NSSHTHPMV----------------VDMDNRLASMRSTILSS
A0A6I1TEC0      ---RNNIVA---------NSSEQNPLV----------------ADYDQNLNAMRRSITAS
A0A3R5XWG1      ---RNNIVA---------NSSEQNPLV----------------ADYDQNLNAMRRSITAS
A0A5P0Y910      ---RNNIVA---------NSSEQNPLV----------------ADYDQNLNAMRRSITAS
A0A414YFM3      ---RNNIVA---------NSSEQNPLV----------------ADYDQNLNAMRRSITAS
A0A6A7UIA7      ---RNNIVA---------NSSEQNPLV----------------ADYDQNLNAMRRSITAS
A0A6A7VPS3      ---RNNIVA---------NSSEQNPLV----------------ADYDQNLNAMRRSITAS
A0A374THP7      ---RNNLVA---------NSSEQNPLV----------------ADYDQSLGSMRKSITAS
A0A6G1VND1      ---RNNLVA---------NSSEQNPLV----------------ADYDQSLGSMRKSITAS
A0A0A2EVS5      ---LNRLLS---------NSSEKNPLV----------------IDMDRTLTAMRRSILLS
A0A1T4NAJ7      ---LNRLLS---------NSSEKNPLV----------------IDMDRTLTAMRRSILLS
A0A255T941      ---RNRLIS---------NSSEANPLV----------------QDLTSSLQSMQKTIVQS
A0A4P7VSV0      ---RNSLLA---------KSSDKNPLV----------------VQLNEQMDQMRHAILAS
A0A7J0AX49      ---RNSLLA---------KSSDKNPLV----------------VQLNEQMDQMRHAILAS
A0A3N2KCL3      ---RNSLLA---------KSSDKNPLV----------------VQLNEQMDQMRHAILAS
A0A2V1IJY1      ---RNSLLA---------KSSDKNPLV----------------VQLNEQMDQMRHAILAS
A0A4P7VXK7      ---RNSLLA---------KSSDKNPLV----------------VQLNEQMDQMRHAILAS
A0A1Y4CHN5      ---RNNLVA---------NSSDENPLV----------------KDMDNALKSMREAIITS
A0A1M6I2S6      ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRTIIQS
A0A1Y3V692      ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRTIIQS
F3PXM2          ---RNRLAA---------NSSEKNPLV----------------VDLTASLRNLHHTVVQS
A0A174AHH7      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A174JCE8      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A3E4JMC4      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A412SND6      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A414IEQ9      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A7K0HNT3      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A0M1W8D8      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A3R6GKX5      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A7V4S1          ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
B0NU19          ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
D4V601          ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A4Q0U3M9      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A7J5G2G2      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A7J5HH13      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A397WLT5      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A6A2J529      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A6N8DDD8      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A015XH67      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A078RZN2      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A6M4L7F4      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A6L0K5          ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A7ACT5          ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A6KY94          ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A173UQR8      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A3R6HK75      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A412B7D1      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A412VNY9      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A414LTU9      ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
I9Q4U4          ---RNRLIA---------NSSEKNPLV----------------KDLGNSMQSMKRTILQS
A0A373ISF0      ---RNRLID---------NSSEKNPLV----------------KDLASSLQSMQRTIIQS
U6RF62          ---RNRLIA---------NSSEKNPLV----------------KDLANSLQSMQRTIIQS
A0A662ZZD5      ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRTIIQS
A0A3A5TI83      ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRTIIQS
A0A415NEB6      ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRTIIQS
A7AJ60          ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRTIIQS
A0A7J5MKN5      ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRTIIQS
A0A6A2JF01      ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRTIIQS
A0A7J4Y8G3      ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRTIIQS
A0A015UXN7      ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRTIIQS
A0A6I2NTL0      ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRTIIQS
A0A6I2Q447      ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRTIIQS
A0A016E4F9      ---RNRLIA---------NSSEKNPLA----------------KDMANSLQSMQRIIIQS
A0A6N3HG44      ---RNRLIA---------NSSEKNPLV----------------KDMANSLQSMQRTIIQS
A0A7K0HSP7      ---RNRLIA---------NSSEKNPLV----------------KDMANSLQSMQRTIIQS
A0A7K1HEJ5      ---RNRLIA---------NSSEKNPLV----------------KDMANSLQSMQRTIIQS
A0A6H9P0U9      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A108TH71      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
I8VXH0          ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A412S0N6      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A412IIJ0      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A0P0FM97      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
R6KTP3          ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A139LU87      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A1C6B3Y5      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A6L3KCD1      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
E2NMQ4          ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A412YDB9      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
R7DY01          ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A414LGK8      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A415IPQ4      ---RNRLIA---------NSSEKNPLV----------------SNMANSLQSMQRTIIQS
A0A3E5BRW7      ---RNRLIA---------NSSEKNPLV----------------KNMANSLQSMQRTIIQS
K9DXS6          ---RNRLIA---------NSSEKNPLV----------------KNMANSLQSMQRTIIQS
A0A1M6KFV3      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A1Q6G7L3      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A413H235      ---RNRLIA---------NSSEKNPLV----------------KNMASSLQSMQRTIIQS
A0A1M5B2J8      ---RNNLVS---------KSSVKNPLV----------------VEMDASLAAMRKALVSS
A0A255RCT5      ---RNNLVS---------KSSDKNPLV----------------VEMDASLASMRKALVSS
A0A1Y4GLF5      ---RNNLVA---------NSSTDNPLV----------------VDMDQALKSMRKAIIGS
A0A1H3XSC0      ---RNSLVA---------NSSTQNPLV----------------VDMDQALTAMRHAIVQS
A6LE40          ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A4Y1VPX5      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A6N2XMM4      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
B3JI46          ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A358R8U0      ---RNSLVA---------NSSTQNPLV----------------VDMDQALSEMRRAIITS
R6WSB6          ---RNSLVA---------NSSTQNPLV----------------VDMDQALSEMRRAIITS
A0A401LPX7      ---RNSLVS---------HSSVKNPLV----------------REMDKSLDDMRSALITS
A0A6G0GNY9      ---RNSLVS---------HSSVKNPLV----------------REMDKLLEDMRSALITS
A0A6I1BFM0      ---RNSLVS---------HSSVKNPLV----------------REMDKLLEDMRSALITS
A0A3A5Z900      ---RNSLVS---------HSSAKNPLV----------------REMDKSLDDMRSALITS
A0A7K0GW19      ---RNSLVS---------HSSAKNPLV----------------REMDKSLDDMRSALITS
A0A285TGL6      ---RNSLVS---------HSSAKNPLV----------------REMDKSLDDMRSALITS
A0A3A5RFX4      ---RNSLVS---------HSSAKNPLV----------------REMDKSLDDMRSALITS
A0A1Q6IUW9      ---RNSLVS---------HSSVKNPLV----------------REMDKSLDDMRSALITS
A0A413XDP6      ---RNSLVS---------HSSVKNPLV----------------REMDKSLDDMRSALITS
A0A6N8CVT6      ---RNSLVS---------HSSVKNPLV----------------REMDKSLDDMRSALITS
K6AP24          ---RNSLVS---------HSSVKNPLV----------------REMDKSLDDMRSALITS
A0A6I2NHV3      ---RNSLVS---------HSSVKNPLV----------------REMDKSLDDMRSALITS
A0A078RYI7      ---RNSLVS---------HSSVKNPLV----------------REMDKSLDDMRSALITS
A0A7I0QD01      ---RNSLVS---------HSSVKNPLV----------------REMDKSLDDMRSALITS
C7XEQ8          ---RNSLVS---------HSSVKNPLV----------------REMDKSLDDMRSALITS
D7INX6          ---RNSLVS---------HSSVKNPLV----------------REMDKSLDDMRSALITS
K5ZG55          ---RNSLVS---------HSSVKNPLV----------------REMDKSLDDMRSALITS
A0A662ZYI7      ---RNSLVS---------HSSVKNPLV----------------REMDKSLDDMRSALITS
A0A3N2N9B8      ---RNSLVE---------KSSESNPLV----------------ISMDGQLAAMRNAIITT
A0A3N2NMI0      ---RNALVE---------KSSDTNPLV----------------VTIDQQLAALRNAIVAT
A0A359I8H7      ---RNTLAA---------SSSDTNPLV----------------VDYDGQIKGLREAIVNA
A0A3N2KA63      ---RNTLAA---------SSSDTNPLV----------------VDYDGQIKGLREAIVNA
A0A4Q0IMT7      ---RNTLAA---------SSSDTNPLV----------------VDYDGQIKGLREAIVNA
A0A7J0B660      ---RNTLAA---------SSSDTNPLV----------------VDYDGQIKGLREAIVNA
A0A3B9FAU3      ---RNSLIA---------NSSERNPIV----------------SDYDEQLAQIRKVILEG
A0A3C1E5L7      ---RNSLIA---------NSSERNPIV----------------SDYDEQLAQIRKVILEG
A0A4Q0UAV1      ---RNRMLA---------TSSDNNPLV----------------QDRTNTLNTLRKTMVQS
A0A354SN68      ---RNNIVS---------NSSESNPLI----------------KDIDTGLGTLREAILSS
A0A6L5XFL0      ---RNNLVA---------NSSASNPLV----------------VDLDQSLQAMKVSIMTS
A0A3N2N595      ---RNSLVD---------KSSDKNPLV----------------VSIDAQLSSIRSVILKS
A0A7J0ACS3      ---RNSLVA---------KSSEKNPLV----------------AQIDRQLDAQRQAVVHT
A0A0A2DUD9      ---RNNLVK---------NSSESNPLV----------------VDLDANLNDLKSVIVAS
A0A3P1ZBJ5      ---RNRLIM---------NSSEKSPTV----------------IELEARISKQRQAIIAS
R5FHS9          ---RNQLLA---------NSSEANPLV----------------KDLDQSLRLQRSSIITS
A0A413TW79      ---RNNLVA---------NSSEQNPLV----------------ADYDQSLASMRHSIVTS
A0A7K0AAG2      ---RNNLVA---------NSSEQNPLV----------------ADYDQNLASMRHSIVTS
A0A7K0ASF1      ---RNNLVA---------NSSEQNPLV----------------ADYDQSLASMRHSIVTS
A0A3E5E9M7      ---RNNLVA---------NSSEQNPLV----------------ADYDQSLASMRHSIVTS
A0A3E4SK73      ---RNNLVA---------NSSEQNPLV----------------ADYDQSLASMRHSIVTS
A0A415GGC6      ---RNNLVA---------NSSEQNPLV----------------ADYDQSLASMRHSIVTS
A0A413DBH9      ---RNNLVA---------NSSEQNPLV----------------ADYDQSLASMRHSIVTS
A0A495WI87      ---RNSLVA---------NSSDQNPLV----------------IDLDHALAAMRKAIVAS
A0A354M4S6      ---RNSLVA---------NSSDQNPLV----------------IDLDHALAAMREAIIAS
R7DH52          ---RNSLVA---------NSSDQNPLV----------------IDLDHALAAMREAIIAS
A0A7J5IAE7      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIVRS
A0A016CWA4      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A4P8LP09      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A0M1W0V2      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A139KA16      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A174VQ92      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A1Q6HCG0      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A1Y4JYM9      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3A5QW67      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3A5RQE6      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3A6BP07      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3E5E153      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3Q9IP20      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A412WV15      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A413ICP6      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A414KYB9      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A5B3FWR2      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A7J5QHB9      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
E5WX00          ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
K0X3P3          ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A1C6H117      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A6I1AQV4      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A5C6L2P1      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A412MJT7      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3E4WKT5      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3A5YY33      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A1E9CFZ7      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A373FYU5      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3A5TZ72      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3A5XBP2      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3A6MEG9      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3E4JP35      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3E4KP40      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3E4NX82      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A3E4XFU8      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A412RG70      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A412TD37      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A413GAA4      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A414M7I4      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A496BTA0      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A496D2V6      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A5C6KCA6      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A5M5AHM5      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A6I0Y5K7      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A6I1BFB8      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A6I2P5W5      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A6N8DC51      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A7J5HGP0      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A7J5HVL8      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A7J5JHD3      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
E5UZA2          ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A069SMG6      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
C3RFN5          ---RNSLVA---------NSSAENPLV----------------MDMDQALASMRGAIIRS
A0A3A5Z014      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A7J5GD93      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A7K0HGR5      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A078S3Q8      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A069SJV7      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A3E5DXI5      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A3E5EM98      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A6N2YYD4      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
I9T3G6          ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A3E4SYU0      ---RNSLVA---------NSSAENPLV----------------MDMDQALASMRGAIIRS
A6LGY1          ---RNSLVA---------NSSAENPLV----------------MDMDQALASMRGAIIRS
K5ZSH4          ---RNSLVA---------NSSAENPLV----------------MDMDQALASMRGAIIRS
A0A6A2RTB3      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A7J5PEN4      ---RNSLVA---------NSSTENPLV----------------VDMDQALASMRGAIIRS
A0A1M4YZ07      ---RNSLVA---------NSSAENPLV----------------MDMDQALASMRGAIIRS
A0A7J5I238      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A0P0FQW1      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A7K0I229      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A5M5C0W6      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A642NJ89      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A6L3JTQ2      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A7J5FQU6      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A7J4YLH7      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A6N3AEV2      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A6G0G4T5      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A6L3KG29      ---RNSLVA---------NSSAENPLV----------------VDMDQALASMRGAIIRS
A0A1Y4PQK7      ---RNNLVA---------NSSEQNPLV----------------MDIDQSLATIREAIISS
A0A1Y4IH41      ---RNNLVA---------NSSEQNPLV----------------MDLDQSLATIRGAIISS
A0A3A6AAP4      ---RNNLVA---------NSSEQNPLV----------------MDLDQSLATIRGAIISS
A0A6I0ZRD2      ---RNNLVA---------NSSEQNPLV----------------MDLDQSLATIRGAIISS
A0A7L4SP06      ---RNNLVA---------NSSEQNPLV----------------MDLDQSLATIRGAIISS
A0A1Y4DYA7      ---RNNLVA---------NSSVNNPLV----------------ADMDQSLQNMRNAIISS
A0A1Y3X4I9      ---RNNLVA---------NSSESNPLV----------------VDLDQSLQNMRRAIISS
A0A1Y4FNK8      ---RNDLVA---------NSSEKNPLV----------------IDMDQSLENMRHAIVTS
A0A355FD59      ---RNNLLA---------NSSEQNPLI----------------KDLDQSLESMRKAIVSS
A0A359CEZ9      ---RNNLLA---------NSSEQNPLI----------------KDLDQSLESMRKAIVSS
A0A353Q7B4      ---RNNLLA---------NSSEQNPLI----------------KDLDQSLESMRKAIVSS
F8X3A5          ---RNNLVS---------NSSEQNPLV----------------VDLDQSLQSMRKAIVSS
A0A1M3KVR9      ---RNNLVS---------NSSEQNPLV----------------VDLDQSLQSMRKAIVSS
A0A4Y9IJS3      ---RNNLVS---------NSSEQNPLV----------------VDLDQSLQSMRKAIVSS
A0A1H4ADG3      ---KERVLL---------SATPDHPVV----------------KNLDNQIKGLRSDMLSG
A0A5B8VUR8      ---KERALL---------SATADHPVV----------------KNLDNQIRSLRSDMLSG
A0A0D3L8Q3      ---RQRLLL---------TNKPNNPLV----------------MNLSEQLTDLRQNILEN
A0A7G7G5F9      ---RQRMLR---------TTQLDNPLV----------------QNINEQLANLQTTMLEN
A0A2N3U785      ---RQGLLR---------TMQPNNPLV----------------VNLNDQLSNLEVNILEN
A0A5B6TJH8      ---RERMLR---------TTNPNNPLI----------------QNINEQLANLRVNLLEN
A0A519U664      ------------------------------------------------------------
A0A519MA34      ---RERMLR---------TNESTSFLI----------------KNIDEQITNLQNNILEN
A0A519UCX0      ---RESILR---------TSQANSFLI----------------NNTNEQIANLRANILEN
A0A0E3ZG78      ---RERMLR---------TAQPKSPII----------------KNLNEQLANIRSSILEN
A0A1I6BRK6      ---RQRMLR---------TMQPTSVLI----------------QNTNEQLADLRVNILET
A0A243WAB1      ---RERTLR---------TTQPSSLLV----------------QNLNEQLANLRINILEN
A0A6G8C8X6      ---RERILR---------TTQPNNPLV----------------LNLNEQLDNLRTNILEN
A0A416GA42      ---CDKMES---------TTAVENPVV----------------QDLQQAMLSLRESILRT
A0A1T3IYP5      ---RNRLAE---------GGNNLNPVV----------------LDLDDALSAMRNNISRA
A0A1T5K9D4      ---RDRLEK---------ASSSVSPAV----------------MQIEDAMISMKQNILGT
A0A077ENE7      ---RNRLAE---------GGNSSNPVV----------------LDLDDALGAMRTNISRA
A0A7H1Z2Z7      ---RNRLAE---------GGNSSNPVV----------------LDLDDALGAMRTNISRA
A0A6I5UW06      ---RNRLAE---------GGNSSNPVV----------------LDLDDALGAMRTNISRA
T0NN57          ---RNRLAE---------GGNTSNPVV----------------MDLDEALGAMRNNIGRA
X5K347          ---RNRLAE---------GGNTSNPVV----------------MDLDEALGAMRNNIGRA
A0A060RD97      ---LDKMLE---------SSGENNPLV----------------VDGRTQLSALKMTIIQA
A0A3C1ITV0      ---RQRLVA---------NSSDSNPLV----------------SDINNQLRMMRSTILRS
R7HN19          ---RQRLVA---------NSSDSNPLV----------------SDINNQLRMMRSTILRS
A0A350IHV0      ---RDRYMS---------DSSSDNPLV----------------GDLNNSISALKVAISRS
R5RVP0          ---RDRFAN---------ESSDNNPLV----------------SDLNTSIAALKIAINRS
R6A0L2          ---RNTMVA---------NSSENQAVV----------------REMDRQLAQMRQAIASS
R7LG80          ---RNQMAN---------NSSDDHAVV----------------RELDKQLHQMRQSIKAS
A0A2L2WX98      ---RNRIAG---------NTSETSPTI----------------REIDNRLASMRSSLLAS
G5GD56          ---RNKNAA---------NSSGQSPLV----------------RDLDKQLAAQRTSILSS
R5KD55          ---RNSLMA---------NGGKNNPLV----------------KDIDKALNQLRRSVISS
A0A174QNT3      ---RNRLVS---------NSGESNPVV----------------QNMNKNLVAMRSTIAGS
A0A4S2FGS1      ---RNRLVT---------NSGENNPVV----------------QNMNRNLDAMRKTIAGS
A0A7K3KG59      ---RNRLVT---------NSGENNPVV----------------QNMNRNLDAMRKTIAGS
R9I0H0          ---RNRLVT---------NSGENNPVV----------------QNMNRNLDAMRKTIAGS
K5BUT9          ---RNRLKE---------SSGEKNPVV----------------QAADKNLEGMRATISGS
A0A174FPA3      ---RNRLKE---------SSGEKNPVV----------------QAADKNLEGMRATISGS
R6S9Y6