BYKdb

Dataset for cluster tadcd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

796 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7V5RJC2      --------------------------------------MDDFYFDEEENHSEGS------
A0A7C1LGX3      --------------------------------------MTETPFNLDYDQKQDR------
A0A1T5MMH4      -------------------------------------MELAKNNIHHQPLPSEG------
A0A2W4R1L8      ----------------------------------------METGTFKSGNSIEG------
A0A7L9BFB6      ----------------------------------------MSTEKTIIQSSAEN------
A0A5C8A5B4      ---------------------------------------------MNVAPSADT------
A0A2E5CV79      ------------------------------------------------------------
A0A2A4G4B1      ---------------------------------------MISSGSPLKHDDEME------
A0A0P7X1V8      ---------------MTDTNGHNTNGYNGRYRGEEIANQYSGQAGLQREDNDDE------
A0A4Y9ITE2      ---------------------------------------MKEINITSNKGKDKK------
A0A3N2M1H3      ----------------------------------------MDNTKTKPEGISGFSD----
A0A4S2G8T2      ----------------------------------------MDNTKTKPEGISGFSD----
A0A212K7W5      ---------------------------------------------MKRNTEEDF------
F5IU11          ---------------------------------------------MKKNTEEDF------
A0A7C1QWC7      ---------------------------------------MSNKNDIRPDT----------
A0A7Z8P8P1      ------------------------------------MEYTQENKEKTAGESGFN------
K0XJ09          ------------------------------------MELIQETKNDKKNEGG--------
R5EUZ0          ------------------------------------MELIQETKNDKKNEGG--------
W0EQS0          ------------------------------------MELIQETKNEKKNEGG--------
A0A1Y3WE15      ------------------------------------MELIQETKNEKKNEGG--------
A0A1Y4GUK3      ------------------------------------MELIQENKNEKKNEGG--------
A0A352Z1R7      ----------------------------------MTSNVSIPPSQPLLRSGEN-------
A0A7X7BZF5      --------------------------------------MSLDNNQNIAEDQNE-------
A0A0A2F501      ----------------------------------MKQEENSRSAQGALAEQDSF------
R5B7P0          -------------------------------------MENNINTDNNTRQQEET------
R5B0L5          --------------------------------------MEEPTEHTPQQLSTTQ------
A0A6I1TEC0      --------------------------------------------MLRRNQGDDF------
A0A3R5XWG1      --------------------------------------------MLRRNQGDDF------
A0A5P0Y910      --------------------------------------------MLRRNQGDDF------
A0A414YFM3      --------------------------------------------MLRRNQGDDF------
A0A6A7UIA7      --------------------------------------------MLRRNQGDDF------
A0A6A7VPS3      --------------------------------------------MLRRNQGDDF------
A0A374THP7      --------------------------------------------MLRRNQADDF------
A0A6G1VND1      ----------------------------MIQNTTPANQPAQVNPLLRRNQADDF------
A0A0A2EVS5      ---------------------------------------MDEKVTTYKRNVEEY------
A0A1T4NAJ7      ---------------------------------------MDEKVTTYKRNVEEY------
A0A255T941      --------------------------------------METNNNNQTNEQNDDF------
A0A4P7VSV0      ------------------------------------MAETIKSEARKSVNAGSA------
A0A7J0AX49      ------------------------------------MAETIKSEARKSVNAGSA------
A0A3N2KCL3      ------------------------------------MAETIKSEARKSVNAGSA------
A0A2V1IJY1      ------------------------------------MAETIKSEARKSVNAGSA------
A0A4P7VXK7      ------------------------------------MAETIKSEVRKSVNAGSA------
A0A1Y4CHN5      -------------------------------------MADNISANNQVKQSEDF------
A0A7Y5JED7      ----------------------------------------MGNRKTNNKPADDF------
A0A1M6I2S6      ---------------------------------------MIEKKTAVGKPADDF------
A0A1Y3V692      ---------------------------------------MIEKKTAVGKPADDF------
F3PXM2          ---------------------------------------MIENKNAVGKPADDF------
A0A174JCE8      ---------------------------------------MIKNRTNAGKPADNF------
A0A3E4JMC4      ---------------------------------------MIKNRTNAGKPADNF------
A0A412SND6      ---------------------------------------MIKNRTNAGKPADNF------
A0A414IEQ9      ---------------------------------------MIKNRTNAGKPADNF------
A0A7K0HNT3      ---------------------------------------MIKNRTNAGKPADNF------
A0A0M1W8D8      ---------------------------------------MIKNRTNAGKPADNF------
A0A3R6GKX5      ---------------------------------------MIKNRTNTGKPTDDF------
A7V4S1          ---------------------------------------MIKNRTNTGKPTDDF------
B0NU19          ---------------------------------------MIKNRTNTGKPTDDF------
D4V601          ---------------------------------------MIKNRTNTGKPTDDF------
A0A4Q0U3M9      ---------------------------------------MIKNRTNTGKPTDDF------
A0A7J5G2G2      ---------------------------------------MIKNRTNTGKPTDDF------
A0A7J5HH13      ---------------------------------------MIKNRTNTGKPTDDF------
A0A397WLT5      ---------------------------------------MIKNRTNTGKPTDDF------
A0A6N8DDD8      ---------------------------------------MIKNRTNTGKPTDDF------
A0A6A2J529      ---------------------------------------MIKNRTNTGKPTDDF------
A0A7S9QIA5      ---------------------------------------MIKNRTNTGKPTDDF------
A0A015XH67      ---------------------------------------MIKNRTNTGKPTDDF------
A0A078RZN2      ---------------------------------------MIKNRTNTGKPTDDF------
A6L0K5          ---------------------------------------MIKNRTNTGKPTDDF------
A7ACT5          ---------------------------------------MIKNRTNTGKPTDDF------
A6KY94          ---------------------------------------MIENRTSVGKSAEDF------
A0A173UQR8      ---------------------------------------MIENRTSVGKSAEDF------
A0A3R6HK75      ---------------------------------------MIENRTSVGKSAEDF------
A0A412B7D1      ---------------------------------------MIENRTSVGKSAEDF------
A0A412VNY9      ---------------------------------------MIENRTSVGKSAEDF------
A0A414LTU9      ---------------------------------------MIENRTSVGKSAEDF------
A0A8B2YHC3      ---------------------------------------MIENRTSVGKSAEDF------
I9Q4U4          ---------------------------------------MIENRTSVGKSAEDF------
A0A373ISF0      ---------------------------------------MIEKKAAAGKPADDF------
U6RF62          ---------------------------------------MIEKKAAAGKPADDF------
A0A662ZZD5      ---------MDQRRFIPHFVGCANIQVTFRKGITLYFYNMTEKKTTASKPADDF------
A0A415NEB6      ---------------------------------------MTEKKTTASKPADDF------
A7AJ60          ---------------------------------------MTEKKTTASKPADDF------
A0A6A2JF01      ---------------------------------------MTEKKTTASKPADDF------
A0A7J5MKN5      ---------------------------------------MTEKKTTASKPADDF------
A0A015UXN7      ---------------------------------------MTEKKTTASKPADDF------
A0A642KJV3      ---------------------------------------MTEKKTTASKPADDF------
A0A6I2NTL0      ---------------------------------------MTEKKTTASKPADDF------
A0A6I2Q447      ---------------------------------------MTEKKTTASKPADDF------
A0A016E4F9      ---------------------------------------MIEKKTIVGKSTDDF------
A0A6N3HG44      ---------------------------------------MIEKKTIVGKPTDDF------
A0A7K0HSP7      ---------------------------------------MIEKKTIVGKPTDDF------
A0A7K1HEJ5      ---------------------------------------MIEKKTIVGKPTDDF------
A0A6H9P0U9      ---------------------------------------MVEKKTPVGKPADDF------
A0A108TH71      ---------------------------------------MVEKKTPVGKPADDF------
I8VXH0          ---------------------------------------MVEKKTPVGKPADDF------
A0A412S0N6      ---------------------------------------MVEKKTPVGKPADDF------
A0A412IIJ0      ---------------------------------------MVEKKTPVGKPADDF------
A0A0P0FM97      ---------------------------------------MVEKKTPVGKPADDF------
R6KTP3          ---------------------------------------MVEKKTPVGKPADDF------
A0A139LU87      ---------------------------------------MVEKKTPVGNPADDF------
A0A1C6B3Y5      ---------------------------------------MVEKKTPVGKPADDF------
A0A6L3KCD1      ---------------------------------------MVEKKTPVGKPADDF------
E2NMQ4          ---------------------------------------MVEKKTPVGKPADDF------
A0A412YDB9      ---------------------------------------MVEKKTPAGKPADDF------
R7DY01          ---------------------------------------MVEKKTPAGKPADDF------
A0A414LGK8      ---------------------------------------MVEKKTPAGKPADDF------
A0A415IPQ4      ---------------------------------------MVEKKTPAGKPADDF------
A0A3E5BRW7      ---------------------------------------MVEKK----KPADDF------
K9DXS6          ---------------------------------------MVEKK----KPADDF------
A0A1M6KFV3      ---------------------------------------MVEKK----KPADDF------
A0A1Q6G7L3      ---------------------------------------MVEKK----KPADDF------
A0A413H235      ---------------------------------------MVEKK----KPADDF------
A0A358R8U0      --------------------------------------MEMTQNTSPAEPMDDS------
R6WSB6          --------------------------------------MEMTQNTSPAEPMDDS------
A0A401LPX7      --------------------------------------MATIQNKSTVQNMQDF------
A0A6G0GNY9      --------------------------------------MATIQNKSTVQNTQDF------
A0A6I1BFM0      --------------------------------------MATIQNKSTVQNTQDF------
A0A3A5Z900      --------------------------------------MATIQNKSTVQNTQDF------
A0A7K0GW19      --------------------------------------MATIQNKSTVQNTQDF------
A0A285TGL6      --------------------------------------MATIQNKSTVQNTQDF------
A0A3A5RFX4      --------------------------------------MATIQNKSTVQNTQDF------
A0A1Q6IUW9      --------------------------------------MATIQNKSTVQNTQDF------
A0A413XDP6      --------------------------------------MATIQNKSTVQNTQDF------
A0A6N8CVT6      --------------------------------------MATIQNKSTVQNTQDF------
K6AP24          --------------------------------------MATIQNKSTVQNTQDF------
A0A6I2NHV3      --------------------------------------MATIQNKSTVQNTQDF------
A0A662ZYI7      --------------------------------------MATIQNKSTVQNTQDF------
A0A078RYI7      --------------------------------------MATIQNKSTVQNTQDF------
C7XEQ8          --------------------------------------MATIQNKSTVQNTQDF------
D7INX6          --------------------------------------MATIQNKSTVQNTQDF------
K5ZG55          --------------------------------------MATIQNKSTVQNTQDF------
A0A7Y5MWI8      -------------------------------------MVATQNNISKPKQADDF------
A0A1M5B2J8      --------------------------------------MATIQKKIQVHNTQDF------
A0A255RCT5      --------------------------------------MATIQKKTQVQNTQDF------
A0A1Y4GLF5      --------------------------------------MAINKDTTKNKQTDDF------
A0A1H3XSC0      --------------------------------------MSINQK--RPTQTDDF------
A6LE40          -------------------------------------MMTINPKNTKPGQQDDF------
A0A4Y1VPX5      -------------------------------------MMTVNQKNIKPGQQDDF------
A0A6N2XMM4      -------------------------------------MMTVNQKNIKPGQQDDF------
A0A7U8L0B4      -------------------------------------MMTVNQKNIKPGQQDDF------
B3JI46          -------------------------------------MMTVNQKNIKPGQQDDF------
A0A3N2N9B8      ---------------------------MAELLDLSSAPASPSATTRKKTAASNT------
A0A3N2NMI0      ---------------------------------MAENNATAPAQRRKKTPESTP------
A0A359I8H7      --------------------------------------MSDNINVTQESEAAEE------
A0A3N2KA63      --------------------------------------MSDNINVTQESEAAEE------
A0A4Q0IMT7      --------------------------------------MSDNINVTQESEAAEE------
A0A7J0B660      --------------------------------------MSDNINVTQESEAAEE------
A0A3B9FAU3      --------------------------------MATNNSLESEKNYSATAENNELENGG--
A0A3C1E5L7      --------------------------------MATNNSLESEKNYSATAENNELENGG--
A0A4Q0UAV1      ---------------------------------------MPTKMQAAPKRPADS------
A0A354SN68      ---------------------------------MYTNMDNNENTSLSTEKVEDE------
A0A6L5XFL0      -------------------------------MAEDYYYGQDQDKNENQS-----------
A0A3N2N595      ----------------------------------MAEVNKI--QSNKKSGAAGA------
A0A7J0ACS3      ----------------------------------MAEIKEPINKSRKNSIASGT------
A0A0A2DUD9      ---------------------------------MIQNTTTVVEKPAAEGQQENF------
A0A3P1ZBJ5      --------------------------------------MVENEVNAPQNEQTTG------
R5FHS9          ----------------------------------MPNNQIQSQQPQQNQQSDDS------
A0A413TW79      ---------------------------------------MQNAPGRRPQQAEDF------
A0A7K0AAG2      -------------------------------MIQNNQATMQNVPGRRPQQAEDF------
A0A7K0ASF1      ---------------------------------------MQNALGRRPQQAEDF------
A0A3E5E9M7      -------------------------------MIQNNQATMQNVLVRRPQQAEDF------
A0A3E4SK73      -------------------------------MIQNNQATMQNVPGRRPQQAEDF------
A0A415GGC6      -------------------------------MIQNNQATMQNVPGRRPQQAEDF------
A0A413DBH9      -------------------------------MIQNNQATMQNVLVRRPQQAEDF------
A0A495WI87      --------------------------------------MAAVQNNPKSKQSEEF------
A0A354M4S6      --------------------------------------MAAVQNNPKSKQSEEF------
R7DH52          --------------------------------------MAAVQNNPKSKQSEEF------
A0A7J5IAE7      --------------------------------------MTINQKNTKPGQQNDF------
A0A016CWA4      --------------------------------------MAVNQKNTRPGQADDF------
A0A4P8LP09      --------------------------------------MAVNQKNTRPGQADDF------
A0A0M1W0V2      --------------------------------------MAVNQKNTKPGQPDDF------
A0A139KA16      --------------------------------------MAVNQKNTKPGQPDDF------
A0A174VQ92      --------------------------------------MAVNQKNTKPGQPDDF------
A0A1Q6HCG0      --------------------------------------MAVNQKNTKPGQPDDF------
A0A1Y4JYM9      --------------------------------------MAVNQKNTKPGQPDDF------
A0A3A5QW67      --------------------------------------MAVNQKNTKPGQPDDF------
A0A3A5RQE6      --------------------------------------MAVNQKNTKPGQPDDF------
A0A3A6BP07      --------------------------------------MAVNQKNTKPGQPDDF------
A0A3E5E153      --------------------------------------MAVNQKNTKPGQPDDF------
A0A3Q9IP20      --------------------------------------MAVNQKNTKPGQPDDF------
A0A412WV15      --------------------------------------MAVNQKNTKPGQPDDF------
A0A413ICP6      --------------------------------------MAVNQKNTKPGQPDDF------
A0A414KYB9      --------------------------------------MAVNQKNTKPGQPDDF------
A0A5B3FWR2      --------------------------------------MAVNQKNTKPGQPDDF------
A0A7J5QHB9      --------------------------------------MAVNQKNTKPGQPDDF------
E5WX00          --------------------------------------MAVNQKNTKPGQPDDF------
K0X3P3          --------------------------------------MAVNQKNTKPGQPDDF------
A0A1C6H117      --------------------------------------MAVNQKNTKPGQPDDF------
A0A6I1AQV4      --------------------------------------MTVNQKNIKPGQQDDF------
A0A5C6L2P1      --------------------------------------MTVNQKNIKPGQQDAF------
A0A3E4WKT5      --------------------------------------MTVNQKNIKPGQQDDF------
A0A3A5YY33      --------------------------------------MTVNQKNIKPGQQDDF------
A0A1E9CFZ7      --------------------------------------MTVNQKNIKPGQQDDF------
A0A373FYU5      --------------------------------------MTVNQKNIKPGQQDDF------
A0A3A5XBP2      --------------------------------------MTVNQKNIKPGQQDDF------
A0A3A6MEG9      --------------------------------------MTVNQKNIKPGQQDDF------
A0A3E4JP35      --------------------------------------MTVNQKNIKPGQQDDF------
A0A3E4KP40      --------------------------------------MTVNQKNIKPGQQDDF------
A0A3E4NX82      --------------------------------------MTVNQKNIKPGQQDDF------
A0A3E4XFU8      --------------------------------------MTVNQKNIKPGQQDDF------
A0A412RG70      --------------------------------------MTVNQKNIKPGQQDDF------
A0A412TD37      --------------------------------------MTVNQKNIKPGQQDDF------
A0A413GAA4      --------------------------------------MTVNQKNIKPGQQDDF------
A0A414M7I4      --------------------------------------MTVNQKNIKPGQQDDF------
A0A496BTA0      --------------------------------------MTVNQKNIKPGQQDDF------
A0A496D2V6      --------------------------------------MTVNQKNIKPGQQDDF------
A0A5C6KCA6      --------------------------------------MTVNQKNIKPGQQDDF------
A0A5M5AHM5      --------------------------------------MTVNQKNIKPGQQDDF------
A0A6I0Y5K7      --------------------------------------MTVNQKNIKPGQQDDF------
A0A6I1BFB8      --------------------------------------MTVNQKNIKPGQQDDF------
A0A6I2P5W5      --------------------------------------MTVNQKNIKPGQQDDF------
A0A6N8DC51      --------------------------------------MTVNQKNIKPGQQDDF------
A0A7J5HGP0      --------------------------------------MTVNQKNIKPGQQDDF------
A0A7J5HVL8      --------------------------------------MTVNQKNIKPGQQDDF------
A0A7J5JHD3      --------------------------------------MTVNQKNIKPGQQDDF------
A0A8B3EKM1      --------------------------------------MTVNQKNIKPGQQDDF------
E5UZA2          --------------------------------------MTVNQKNIKPGQQDDF------
A0A069SMG6      --------------------------------------MTVNQKNIKPGQQDDF------
C3RFN5          --------------------------------------MAINQKNIKPGQQDDF------
A0A3A5Z014      --------------------------------------MTINQKNIKPGQQDDF------
A0A7J5GD93      --------------------------------------MAINQKNIKPGQQDDF------
A0A7K0HGR5      --------------------------------------MAINQKNIKPGQQDDF------
A0A078S3Q8      --------------------------------------MAINQKNIKPGQQDDF------
A0A069SJV7      --------------------------------------MAINQKNIKPGQQDDF------
A0A3E5DXI5      --------------------------------------MAINQKNIKPGQQDDF------
A0A3E5EM98      --------------------------------------MAINQKNIKPGQQDDF------
A0A6N2YYD4      --------------------------------------MAINQKNIKPGQQDDF------
I9T3G6          --------------------------------------MAINQKNIKPGQQDDF------
A0A3E4SYU0      --------------------------------------MAINQKNTKPGQPDDF------
A6LGY1          --------------------------------------MAINQKNIKPGQQDDF------
K5ZSH4          --------------------------------------MAINQKNIKPGQQDDF------
A0A6A2RTB3      --------------------------------------MTVNQKNIKPGQQDDF------
A0A7J5PEN4      --------------------------------------MTVNQKNIKPGQQDDF------
A0A1M4YZ07      --------------------------------------MSINQKNTKPGQPDDF------
A0A7J5I238      --------------------------------------MTVNQKNIKPGQQDDF------
A0A0P0FQW1      --------------------------------------MTVNQKNIKPGQQDDF------
A0A7K0I229      --------------------------------------MTVNQKNIKPGQQDDF------
A0A5M5C0W6      --------------------------------------MTVNQKNIKPGQQDDF------
A0A642NJ89      --------------------------------------MTVNQKNIKPGQQDDF------
A0A6L3JTQ2      --------------------------------------MTVNQKNIKPGQQDDF------
A0A7J5FQU6      --------------------------------------MTVNQKNIKPGQQDDF------
A0A7J4YLH7      --------------------------------------MTVNQKNIKPGQQDDF------
A0A6N3AEV2      --------------------------------------MTVNQKNIKPGQQDDF------
A0A6G0G4T5      --------------------------------------MTVNQKNIKPGQQDDF------
A0A6L3KG29      --------------------------------------MTVNQKNIKPGQQDDF------
A0A1Y4PQK7      ---------------------------------------MTIQNNTKPGQADDF------
A0A1Y4IH41      ---------------------------------------MAIQNNTKPGEADDF------
A0A3A6AAP4      ---------------------------------------MAIQNNTKPGQADDF------
A0A6I0ZRD2      ---------------------------------------MAIQNNTKPGQADDF------
A0A1Y4DYA7      ---------------------------------------MNENNTKSDLFLQES------
A0A1Y3X4I9      --------------------------------------MSTLSDKETELFLDELEKSSSS
A0A1Y4FNK8      --------------------------------------MATQNNPARPKQADDL------
A0A355FD59      -------------------------------------MALSQNNNVKQKQPEDF------
A0A359CEZ9      -------------------------------------MALSQNNNVKQKQPEDF------
A0A353Q7B4      -------------------------------------MALSQNNNVKQKQPEDF------
F8X3A5          -------------------------------------MTSVQHNKTERKQTEDL------
A0A1M3KVR9      -------------------------------------MTPVQHNKTEQKQTEDL------
A0A4Y9IJS3      -------------------------------------MTSVQHNKTEQKQTEDL------
A0A416GA42      ---------------------------------------MEQQNKQNVSGSGLE------
A0A1T3IYP5      ------------------------------------MDTIKQKNYIIENKKEQS------
A0A7Z6RZU4      ----------------------------------------MNDSYKVNDLQNGD------
A0A4D7K1D4      ------------------------------------------------------------
A0A846MP44      --------------MKEEELKSIAHYQ----------SHTYEFESPSHKQEEAS------
A0A1G9E2A9      ----MV---------EPTEIQHLGRPI----------------DNEEEESFLSV------
A0A098LL25      ----MSLL-------EDEDKRSLNGSG---------QRVSFADDSEEEDDVFGD------
A0A6J4H627      ----MSAF--------------------NGRSMDFPESVSSPGNQEEEDDVLGG------
A0A6C0GJI1      ----MSINNGKGPDVEEPQMISFNRQA----------------EQEEEDTLLGG------
A0A839GQ17      ----MSVK-------TANDLDELDQRL-------------VSADAEVEEDSGAS------
A0A127B287      ----MSVK-------TGNNLDELDYHT-------------SNADIE-EEDSGSS------
A0A6P1P2P6      ----MSVK-------AGNNLDELDYHT-------------GNAELE-EEDSGSS------
A0A2T2YJE8      ----MTNK-------ESIVLEELENNY-------------AAAVEVEEDSGGSD------
A0A7L7LEW0      ----MANK-------ESIVLEDLENNY-------------TTAVEVEDDNGGSD------
A0A3M9N829      ----MSVK-------AANDLDELDHRL--------------GSDEGEEEDGGAS------
A0A0P0CSF9      ----MSVK-------TVNDLDELDHRL--------------GSGEDEDDDGGTS------
A0A5M8QQB8      ----MSVK-------TANDLDELDHRL--------------GSGEDEEDDGGTS------
A0A3M9MNC3      ----MSVR-------TVNDLDELDHRL--------------GGVEDEEDDGGAN------
A0A5B6TAX2      ----MSVK-------TVNDLDELDHRL--------------GGVEDEEDDGGTS------
A0A7L5A132      ----MAVD-------KDAELEELIRTA--------------GGEEGTEDDAGAG------
A0A512AYT3      ----MALE-------KFADIDEL-NSR--------------VADTESEEEGGSD------
A0A5M6CYN7      ----MALE-------KFADIDEL-NSR--------------VTDTDSEEEGGSD------
A0A369QP10      ----MANK-------ESIVLEELDNSN------------YASTIEVEEESRGSD------
A0A7G7G7M4      ----MANK-------ESIVLEELDNSN------------YASTIEAEEENRGGD------
A0A126PDF2      ----MAVN-------ENAELEALIRNAIDG---GTEPPTAATVGAAADDEADGG------
A0A2Z3GKA1      ----MAVN-------ENAELEALIRNAIDG---GTEPPTAATVGAAADEEADDG------
A0A502GZP7      ----MAIN-------ENAELESLIRNAIDG---GAEQPAAATAGGAADEEGSEG------
A0A0M3RW20      ------------------------------------MNT--PEPESETE--GSG------
A0A495VFX4      ----MAKN-------ENTELEDLIRNSLGN---QPTVSV--PEPESETE--NSG------
A0A246FQC0      ----MATK-------EDAELEELIRNA-GG------------EEVEEDD--GGG------
A0A372E5P8      ----MAVK-------EDAELEELIRQA-GG---G-------EPTEDEDD--GGG------
A0A7Y7PLY0      ----MAVK-------EDAELEELIRQA-GG---G-------EPAEDEDD--GGG------
A0A1H3EMW1      ----MAAK-------EDAELEELIRNA-GR------------ESEEQED--GGG------
A0A1H9ZSN3      ----MAAK-------EDAELEELIRNA-GG------------EPEEEDD--GGG------
A0A7W9SXN1      ----MAAK-------EEAELEELIRNAGGG------------EAEEADE--GEG------
A0A418R9X5      ----MAAK-------EDAELEELIRNA-GG------------EPEEEEE--GGG------
A0A428JSJ3      ----MAAK-------EDAELEELIRSA-GG------------EPEEEED--GGG------
A0A428KI59      ----MAAK-------EDAELEELIRNA-GA------------EPEEEEE--GGG------
W8F1I6          ----MAAK-------EDAELEELIRNA-GA------------EPEEEEE--GGS------
A0A1S9B3W0      ----MAVN-------ENAELEELIRNA-TS---GGVNTPAPPASESDDDNVGGG------
A0A1W1VRL3      ----MAAK-------EETELEELIRNA-NG---I-------ETEDKEDE--GDG------
A0A7G6YQJ9      ----MAAK-------EEVELEELIRNA-GG---G-------EAESEEDE--GTG------
A0A1M6R305      ----MAVN-------ENAELEELIRNA-TG---SGGASTVSAESEVVEE--GGG------
A0A7G7W8X3      ----MAVN-------ENAELEELIRNA-TG---SGGVSTVPTDAEAADE--GGG------
A0A4Z0PHK3      ----MAVN-------ENAELEELIRNA-GG---T-------ETNAAEDE--GDG------
A0A2M9B9H9      ----MAVN-------ENAELEELIRSA-GG---A-------EPNAVEDE--GGG------
A0A4Z0QCY9      ----MAVN-------ENAELEELIRNA-GG---A-------EPNAAEDE--DGG------
A0A7Y0AH93      ----MAVS-------ENAELEELIRQATATGNADATPSSTGQTVTEEETEAGEG------
A0A519SBU8      ----MALS-------ENAELEELIRRATGE-TASQLPPT-GAAAAADEEDLGGG------
A0A4Q3JNZ3      ----MALS-------ENAELEELIRRATGE-TAGQLPPTQGPTVGDEPEDLGGG------
A0A519Q9V3      ----MAVS-------ENAELEELIRKATGD-TAGQLPPTSGPVLAAEQDDTGSS------
A0A5N1J2M4      ----MMPT-------QSTELDELE--------------VKPAIVDAEEESSGSD------
A0A519S476      ------------------------------------------------------------
A0A4Q3JRW8      ----MAVS-------ENAELEELIRKA-TGEAAVQLPPTASSASTPELEDIGGG------
A0A519M923      ----MALS-------ENAELEELIKRA-TSDTAGQLPAAQNQPQSAEPEDLGGG------
A0A4Z0ENW1      ----MAST-------ENAELEELIRRA-SASGET--TPPTGPSFAEEEAEDGDN------
A0A519UDB4      ----MAMS-------ENAELEELIRRT-TTGADS--SSSISAATSEEEAE--DS------
A0A3S0QKV1      ----MAVN-------ENAELEELIRNA-TGGSGA----AAPTASAPEAEEAGSG------
A0A328BL48      ----MAVN-------ENAELEELIRNA-TSGGAA----PTAPAAESEDDSVGGG------
A0A5R8WLY4      ----MAVN-------ENAELEELIRNA-TSGGAA----PTAPAAESEDDSVGGG------
A0A1I5WSL8      ----MAIN-------ENTELEELIRNA-TGGSAA--PPETPASSGADPEDDSAS------
A0A0U3JVM7      ----MAIN-------ENTELEELIRNA-TGGTAS--PPEAPSASGGDADDDAPG------
A0A1G1SSV2      ----MATN-------ENRELEELIRNA-TGGTAS--LPEAPTVGASEPEDESAS------
A0A1G1SXV7      ----MATN-------ENRELEELIRNA-TGGTAF--PSEAPAVGTGETEEESAS------
A0A6G8CBJ6      ----MAAK-------EETELEEMIRNA-GGM-------EAEE-----KEDAGDG------
A0A0W8EDI5      ----MAVN-------KEAELEELIRAS-G---------EET------DDVAESS------
A0A3B7RBP8      ----MAID-------KEAELEELIRSA-GST-------EGQ------EEETDTA------
A0A3R9P8H7      ----MAAN-------EDAELEEMIRNA-GGN-------ESD------GEDDGGG------
A0A238WIA7      ----MAVN-------EEVELEDLVRNA-GGE-------A--------DEDDGGG------
A0A212UCJ7      ----MAVN-------EDIELEELIRGA-GGD-------A--------EEDQGGG------
A0A4Z0MQE1      ----MALN-------EEADLEELVRGA-GGE-------A--------DEDQGGG------
A0A4Z0PCF4      ----MALN-------EEAELEDLVRSA-GGE-------A--------DEDQGGG------
A0A6M6BED0      ----MALN-------EEAELEELVRNA-GGE-------A--------DEDEGGG------
A0A5D6VDG1      ----MAIN-------ENAELEDLIRNS-GGT-------PPVE---VQAEEENTG------
A0A243WHR7      ----MAVN-------ENAELEELIRNA-GGN-------EAEV-----EDDEGAG------
A0A5B8A0P6      ----MALK-------EEAELEELIRNS-GGV-------DAEA-----ADEDSEG------
A0A076HRT9      ----MAVN-------ENAELESLIRNA-TGG-------VSAVPVESEPADDGGG------
A0A4Z0PVM7      ----MAVN-------ENAELEELIRSA-GGA-------EPTA-----EDEDG-G------
A0A1M6DHW8      ----MAIN-------ENAELEELIRNA-GGG-------DTEA-----EGEEGSG------
A0A4Q5LC61      ----MAVN-------ENAELEDLIRNA-GGG-------DVEA-----EGEDDPG------
A0A060RD97      ----------------------------------------MVENKINNEQDPKS------
A0A350IHV0      -----------------------------MALENNNIDNRPALRNANGEEDGDI------
A0A2A8CVM9      MNDKNLSRFDSGDMTPAPLRNGHASNRMNGSAHHGGGSSGSSS------EANAG------
R5RVP0          --------------------------------MPIDNNLDNRPSQVRNEEENDL------
A0A2L2WX98      ----------------------------------------MENTNNAT-IEKEE------
A0A2E3R1D0      ---------------MIDQPY--PTAADRGAPGAPVRGEDPF---YYGDR--DG------
A0A800J826      ----------------MASPYQTPPRPPVERPDSPILVEEPV---YVRDSRAGD------
A0A2T2USC0      -----------------------MNGQVGGM----------------PAPQEDE------
A0A2T2V0F3      MHDGSAPSGNGHSNRWNSMNPVNGQSQPSGE----------------HGARDDE------
A0A2T2S682      --------------MPRSSSFEYAGDGHPGNGRSAPDDEPSLYDSAPDGPTGVD------
A0A840DJZ8      MAHLQRRDPDQNGQGDIIRSWEGGGGGAPG---------------SPAGAGGIK------
D5H561          MAHLQRRDPDQNGQGDIVRSWEGGTNGAAG---------------PSSGRQGIK------
A0A2H3NWA9      -------------MASPSLPPNGQNGRHDAAPTPWPAQGQLYDEVY-HPEGNGV------
A0A2A8CVB6      ------------MSPSSNMSSNGHRP--AGGPVNGIAGASLF---Y-DDNPQRG------
A0A2P6C1S6      -----------------MASTNGHPG-----SSQSVSVEDLL---YEDTTSRRS------
A0A2T2UTM4      -----------------MASTNGYPSGEEGPGSRSLAVEDLL---Y-DNSDRRS------
R6A0L2          --------------------------------------METKSINPQE-QQDEE------
R7LG80          ---------------------------------------MNNVPDTFK-RDEEE------
A0A7W5UEN4      -----------------------------------------MSGSVQNTNKEED------
G5GD56          -----------------------------------------MSGSVQNKNKEED------
R5KD55          --------------------------------------METNPVTQQTEETTEE------
A0A174QNT3      ------------------------------------METNKTTDLKRTEN---V------
A0A4S2FGS1      ------------------------------------METKKTTTSSPKEN---V------
A0A7K3KG59      ------------------------------------METKKTTISSSKEN---V------
R9I0H0          ------------------------------------METKKTTTSSPKEN---V------
K5BUT9          ------------------------------------MEYIQENERTLKKDEG-G------
A0A174FPA3      ------------------------------------MEYIQENERTPKKDEG-G------
R6S9Y6          ------------------------------------MEYIQENERTPKKDEG-G------
A0A7J4YSB2      ------------------------------------MEYIQENERTPKKDEG-G------
C9KX15          ------------------------------------MEYIQENERTPKKDEG-G------
A0A6H0KRK1      ------------------------------------MEYTQENNEKTVKESGFN------
R6DAG6          ------------------------------------MEYTQENNEKTVKESGFN------
A0A3L8AAP1      ------------------------------------MEYTQENNEKTVKESGLN------
A0A4S2AYX2      ------------------------------------MEYTQENNEKTVKESGLN------
A0A7J0A2L4      ------------------------------------MEYTQENNEKTVKESGLN------
A0A7K3MN31      ------------------------------------MEYTQENNEKTVKESGLN------
R6CQ93          -----------------------------------------MQNNNLSGKNEQS------
A0A3D1NQW3      -------------------------------MTPNNINPNSANSDTKQ-EEHIT------
B0MT10          -------------------------------MTPNNINPNSANSDTKQ-EEHIT------
R7JGW9          -------------------------------MTPNNINPNSANSDTKQ-EEHIT------
A0A3D2BF46      --------------------------------MEE-NRNVNNVPAEGN-EDSIN------
A0A358R538      --------------------------------MTE-RTINPQ---PAE-ETTGN------
A0A1Y4AAB8      --------------------------------MIEQTPNTQHAPQNET-SEAGM------
A0A1Y3WWY9      --------------------------------MIEQQPNNIPQQAFND-DQAGT------
A0A1Y4U5L4      --------------------------------MIEQQPNNIPQQAFND-DQAGA------
A0A1Y3VCJ1      --------------------------------MAE-IQFNTQTRDKIH-DQTPA------
A0A1Y3QTW7      --------------------------------MTEYNNQQQHLQNDEN-ENGSG------
R6XWY7          --------------------------------MTEYNNQQQHLQNDEN-ENGSG------
A0A4Y1X9Y9      --------------------------------MTEYNNQQQHLQNDEN-ENGSG------
A0A4Y1WM66      --------------------------------MTEYNNQQQHLQNDEN-ENGSG------
A0A6N4GYT3      --------------------------------MTEYNNQQQHLQNDEN-ENGSG------
A0A174AVF1      --------------------------------MTEYNNQQQHLQNDEN-ENGSG------
A0A1Q6EIY0      --------------------------------MTE-QNINPHLLNGES-ENTNG------
A0A5B5VN71      --------------------------------MTE-QNINPHLLNEES-ENTNG------
E4M8L3          --------------------------------MTE-QNINPHLLNEES-ENTNG------
I3YQ50          --------------------------------MTE-QNINPHLLNEES-ENTNG------
R5UEY8          --------------------------------MTE-QNINPHLLNEES-ENTNG------
A0A1H4D866      --------------------------------MTE-QQINSPQQQGND-EMTGA------
A0A5B3G4Y7      --------------------------------MAE-QQINSQIQTNNE-ELTNT------
A0A374A9J5      --------------------------------MAE-QQINSQIQTNNE-ELTNT------
A0A5B3GQN5      --------------------------------MAE-QQINSQIQTNNE-ELTNT------
A0A1Q6E9S3      --------------------------------MAE-QQINSQIQTNNE-ELTNT------
D4IJ36          --------------------------------MAE-QQINSQIQTNNE-ELTNT------
A0A414Q925      ------------------------------MGKDRFEDLDFIDFNDSR-RQEGT------
A0A415PUS9      ------------------------------MGKDRFEDLDFIDFNDSR-RQEGT------
A0A108TCU0      ------------------------------MGKDRFEDLDFIDFNDNR-RQEGT------
A0A413BA42      ------------------------------MGKDRFEDLDFIDFNDSR-RQEGT------
S3Y344          ------------------------------MRKDRFEDLDFIDFNDSR-RQEGT------
A0A7J5LEW3      ------------------------------MGKDRFEDLDFIDFNDSR-RQEGT------
A0A412TGL3      ------------------------------MGKDRFEDLDFIDFNDSR-RQEGT------
A0A413VJ33      ------------------------------MGKDRFEDLDFIDFNDSR-RQEGT------
A0A414L0W6      ------------------------------MGKDRFEDLDFIDFNDSR-RQEGT------
A0A412DP39      ------------------------------MGKDRFEDLDFIDFNDSR-RQEGT------
A0A413ZSE8      ------------------------------MGKDRFEDLDFIDFNDSR-RQEGT------
B0NP84          ------------------------------MGKDRFEDLDFIDFNDSR-RQEGT------
R6AK43          ------------------------------MGKDRFEDLDFIDFNDSR-RQEGT------
A0A412N2D9      ------------------------------MGKDRFEDLDFIDFNDSR-QQEST------
A0A1Y4JYS9      ------------------------------MGKDRFEDLDFIDFNDSR-QQEST------
R6LHA4          ------------------------------MGKDRFEDLDFIDFNDSR-QQEST------
A0A3E5HPT8      --------------------------------------------MALT-EEEKS------
C6IJ48          --------------------------------------------MALT-EEEKS------
Q8A3U2          --------------------------------------------MALT-EEEKS------
A0A3R6S1H6      ----------------------------------------MKNEELIE-DGTNA------
A0A3R6SD81      ----------------------------------------MKNEELIE-DGTNA------
A0A354WXN6      ----------MVVCSIRLGGCSLLNCHIIQQITQSTVMEQQENNKNIE-QEEQE------
A0A7G1HW11      ----------------------------------MAKEQQEIYGQQVEESTDNG------
R5IP14          ----------------------------------MAKEQQEIYGQQVEESTDNG------
A0A316SZX7      ------------------------------------MSEQNINQPQQNAPAEEE------
A0A1Y4AIY1      ------------------------------------MKVENPSNGPRWNEANSG------
A0A0J6CIR2      --------------------------------------------MNLR-REENE------
A0A3D8HG59      ------------------------------------MEPNQELENLQQ-QEENE------
A0A3R6S408      ------------------------------------MEPNQELENLQQ-QEENE------
F3ZRU7          ------------------------------------MEQQNLDNKIQQEHTEQE------
A0A1C5Q1F3      -----------------------MDLRDFGFNFNCHLNIGCEMTNRKNTQSDHT------
R7A239          -----------------------MDLRDFGFNFNCHLNIGCEMTNRKNTQSDHT------
A0A3R6HIK7      ------------------------------------MSTEYNPENNIRIEEESV------
K5ZVW7          ------------------------------------MSTEYNPENNIRTEEEST------
A0A1Y4D5Z0      ----------------------------------MIDNRENTQRDYAQ-ENENT------
A0A413VXJ7      ------------------------------MSTEQNINKESKT-SKNS-KQEEE------
I9RSN9          ------------------------------MSTEQKINKESKA-SKSS-EKEEE------
U6RJK5          ------------------------------MSTEQKINKESKA-SKSS-EKEEE------
A0A1Q6GA32      ------------------------------MSTEQKINKESKA-SKSS-EKEEE------
I9RPU6          ------------------------------------MNTEYKN-NDVR-KQEPE------
I8YFS5          ------------------------------------MSIESQN-SELR-EKESE------
A0A7J4XCM0      ------------------------------------MSIESQN-SELR-EKESE------
I8Y597          ------------------------------------MSIESQN-SELR-EKESE------
A0A1Q6GBF5      ------------------------------------MNTEQKN-NNNP-GQESE------
I8YFZ3          ------------------------------------MSAEYKN-NDIR-KQESE------
A0A7J4XFW0      ------------------------------------MNTEYKN-NDAR-KQESE------
A0A1Q6GDH2      ------------------------------------MNTEYKN-TDVR-KQEPE------
U6RSB0          ------------------------------------MNTEYKN-NDVR-KQEPE------
I9GXM2          ------------------------------------MNTEYKN-NDVR-KQESE------
I9SIK1          ------------------------------------MNTEYKN-NDVR-KQESE------
A0A7J4XIJ5      ------------------------------------MNTEYKN-NDVR-KQESE------
I9TP59          ------------------------------------MNTEYKN-NDAR-KQESE------
R5S343          -----------------------------------MKNTEQDL-FEFE-EEKSG------
A0A1M6K7I9      ------------------------------------MNEEQKVQSNMT-AQEEQ------
A0A5M6A8C8      ------------------------------MKSEQQMNEEQKVQTNMA-VQEEQ------
A0A7J4XCJ1      ------------------------------------MNTESQNNNDIR-EQDLE------
A0A7J4XNQ7      ------------------------------------MNTEPQNNNEIR-DQESE------
A0A3R5ZMK1      ------------------------------------MNTEQET-N-TR-VEESE------
A0A7K1HMX0      ------------------------------------MNTEQET-N-TR-VEENE------
A0A1Y3ZIA4      ------------------------------------MNTEQET-N-TR-VEESE------
K5Y1A4          ------------------------------------MNTEQET-N-TR-VEESE------
A0A7K1HDC0      ------------------------------------MNTEQET-N-IR-MEENE------
A0A3R6K8X4      ------------------------------------MNIEQET-N-IR-MEENE------
A0A6N8D6C8      ------------------------------------MNIEQET-N-IR-MEENE------
A0A3R6BKI7      ------------------------------------MNTEQET-N-TR-VEESE------
A0A412M2W1      ------------------------------------MNTEQET-N-TR-VEESE------
K5ZX55          ------------------------------------MNTEQET-N-TR-VEESE------
A0A415BDM7      ------------------------------------MNTEQET-N-IR-MEENE------
A0A1Q6I3T6      ------------------------------------MNTEQET-N-IR-MEENE------
A0A414XX40      ------------------------------------MNTEQET-N-IR-MEENE------
A7AEU7          ------------------------------------MNTEQET-N-IR-MEENE------
A0A5F0U645      ------------------------------------MNPEQET-NMLR-EEENE------
K5ZBN2          ------------------------------------MNPEQET-NMLR-EEENE------
A0A0J6CKW3      ------------------------------------MNPEQET-NMLR-EEENE------
A0A0F5IQM7      ------------------------------------MNPEQET-NMLR-EEENE------
A0A496CDT3      ------------------------------------MNPEQET-NMLR-EEENE------
A0A6G1ZKM3      ------------------------------------MNPEQET-NMLR-EEENE------
S0GLB0          ------------------------------------MNPEQET-NMLR-EEENE------
A0A3R6NLC1      ------------------------------------MNPEQET-NMLR-AEENE------
A0A416WYC9      ------------------------------------MNPEQET-NMLR-AEENE------
A0A7W7AX81      ------------------------------------MNPEQET-NMLR-AEENE------
A0A0F5IT40      ------------------------------------MNSEQET-INLR-REENE------
A0A496CX20      ------------------------------------MNSEQET-INLR-REENE------
A0A5F0UBI0      ------------------------------------MNSEQET-INLR-REENE------
A0A6G1ZHG0      ------------------------------------MNSEQET-INLR-REENE------
S0GSI7          ------------------------------------MNSEQET-INLR-REENE------
K5YB65          ------------------------------------MNSEQET-INLR-REENE------
A0A0F5IWP9      ------------------------------------MNSEQET-TYLR-GEENE------
A0A0F5IZT8      ------------------------------------MNSEQET-TYLR-GEENE------
A0A417LKQ2      ------------------------------------MNSEQET-TYLR-EEENE------
A0A416TME1      ------------------------------------MNSEQET-TYLR-EKENE------
A0A7W7F3X3      ------------------------------------MNSEQET-TYLR-EKENE------
A0A416XPE8      ------------------------------------MNSEQET-TYLR-EKENE------
A0A3B0C2S4      ------------------MPILGCLFKIVSVFLPHIFNLKKRMAESPFSLDYDE------
A0A5M8NYX7      ----------------------------------------METTNMQAEQSGEE------
A0A1M6GR99      -------------------------------------------MNQQKLPEQNI------
A0A7C5M4P4      ---------------------------------MKLNPAESEAPLSSNVEAQQA------
A0A1W2GF52      --------------------------MNPRNVHIPQDIRSHHNPENDGAFENFD------
A0A2G5L7B8      ----------------------------MRPIHGGQN----HNQSEGDPLSNID------
A0A2D8JJW3      ----------------------------------------------MATQSNKQ------
A0A6B5PK86      -----------------------------------------MAENQNSFIINKS------
A0A2G2F510      -------------------------------------------MSNKSFIINKN------
A0A316JZ08      -------------------------------------------MAKQKLFINTS------
A0A2W1NDY9      ------------------------------------MNNFHINNENAISSLNKD------
A0A5C8AQR5      -----------------------------------------MGSSERKIIINKE------
A0A1G0CI31      ----------------------------------------MNGAQQPSLLINRE------
A0A556N0M0      -----------------------------------------MNSSNSSIFINKD------
F2IKD6          -----------------------------------------MNNSNTSIFINKD------
A0A1I7BM74      -----------------------------------------MNSSKNRFFVNTE------
A0A2G2FJ17      -----------------------------------------MEKRNNSIYVNTN------
A0A1H4ADG3      --------------------------------------MQTTTLDQLVPVKETK------
A0A5B8VUR8      --------------------------------------MHTNTLDRLVPIKESK------
A0A1V5IPN7      ---------------------------------------MDQNNQPSTVPQPEE------
A0A7G7G5F9      --------------------------------------MVNREVLPF---ETEP------
A0A2N3U785      --------------------------------------MNKKDIFL---AEPEN------
A0A0D3L8Q3      --------------------------------------MTDQDNLLL--EDSEQ------
A0A519U664      --------------------------------------MDNKELFPLSSEQPES------
A0A519MA34      -------------------------------------MDNNKELFPLSSEQPES------
A0A519UCX0      -------------------------------------MDNNKELFPLASEQPES------
A0A5B6TJH8      ----------------------------------MQRLAGTEELFPLKAEKKDN------
A0A7Y0AA98      --------------------------------------MTNDELFPLAPEQSNL------
A0A0E3ZG78      --------------------------------------MMDKELFPLSSERAGE------
A0A1I6BRK6      --------------------------------------MDSQELFSSDLSQAKA------
A0A243WAB1      --------------------------------------MNTRELFPLNSEQVEE------
A0A6G8C8X6      --------------------------------------MENKELFPLSSEQTEA------
A0A4R5DL69      ----------------------------------MASYLENITSIESGSTVNHT------
A0A1M4YED3      -----------------------------------------MSAPKHTQEPQEE------
A0A7T9DAA2      ---------------------------------------------MSKEAVGDS------
A0A7Y5V8S3      --------------------------------------------MAAQSGTAET------
A0A126PFG0      ----------------------------------MEPFNGQVSTFYTAATASQP------
A0A7V5VRT5      ------------------------------------------------MEYKSA------
A0A3M1N7Z3      ------------------------------------------------MPIQQE------
A0A7V1R2A1      ------------------------------------------------MPIQQE------
A6EBM4          --------------------------------------MTGESRKGQRGPSHRE------
A0A7X8C760      ------------------------------------MNPETDNINQNFTEEESS------
A0A501VZX6      ------------------------------------------------MPSSEN------
A0A399SH26      -----------------------------------------MSSSINNAPNNEE------
A0A501W1A9      --------------------------------------------MDKNKSTKED------
A0A0E3ZGV6      --------------------------------------------MDKNKVNAED------
A0A1I2N4S1      --------------------------------------------MDKNKTNSED------
A0A2T5YE44      --------------------------------------------MDKNKTNSED------
A0A4Q8RX32      ----------------------------------------------MALYDGQI------
A0A1M6TTV4      ---------------------------MNFSPEHNVLNQTNNQNADSSGSPLDD------
K0X1U5          -----------------------------------------MEEKYTSERKNDN------
R5EXK3          -----------------------------------------MEEKYTSERRNDN------
A0A401UAP7      -------------------------------------------MDKGFTNESET------
A0A523GAC0      -----------------------------MTNQTFDIEKDNFVVRGQHSYLGGE------
L8JW09          --------------------------------------MENKNIYSDTEKPTEG------
A0A364XUP5      -----------------------------------MMLESNKIGPPVALPNTEG------
A0A1M5RLA9      ------------------------------------MLETPKNIQPQQSQANEA------
A0A385SFR9      ------------------------------------MLEIPKNIPPQQSPANEP------
A0A5M4A9J4      ---------------------------------MKEQQPQPQPVFMPFFEQEEK------
A0A5M4B1C7      -----------------------------------MKEKQPQLVSVPFFEEEEK------
A0A0D3LFR6      -----------------------------MKEDTTYVEYTDAPDEQPEGGPLQS------
M7N6D4          -----------------------------MKEETTYVEYTEGQDTK-GWLPIHN------
A0A5C7MX19      ------------------------------------------------------------
A0A1M5BA90      -----------------------------------------MEPKRHAT-EKEK------
A0A512B879      -----------------------------------------MEAKRPIILKKEK------
A0A559PPI3      -------------------------------------------MSYNNKSAKNE------
A0A1T5CS78      -------------------------------------------MKYNSNTGKED------
A0A0Q9Z8F1      -------------------------------------------MKYNSKTGKED------
A0A2N0U0M7      -------------------------------------------MKYNSKTGKED------
A0A1Q3ZMZ7      ------------------------------------------------------------
A0A7Y3KMD1      ---------------------------MAATEEELIPESTKRRKPKKLSTFDEE------
A0A3C1ITV0      -----------------------------------MKEDYNSIGAAETEDQKNE------
R7HN19          -----------------------------------MKEDYNSIGAAETEDQKNE------
A0A2W2AFF7      ----------------------------------MQDKNYTNHIVAAEQQEEGS------
A0A845PZ37      -------------------------------------MTNQQNQIVNDPKKEQL------
A0A077ENE7      ------------------------------------MNTINQKGYTIGDKKEHS------
A0A854FRG7      ------------------------------------MNMASQKINMTKESKEQF------
T0NN57          ------------------------------------MNMASQKINMTKESKEQF------
R7PCR1          -----------------------------------MANNTVSSTVNQAELKEES------
A0A2N5YXE2      -------------------------------------------MENKIPIFNQK------
A0A2U1FKU2      ---------------------------MPTEEKRITPYGGASRS--ESGEDISF------
A0A0A2F954      ---------------------------MNLNEGSQNTFTRQGRSYISDTEDTAF------
A0A0A2FW91      ---------------------------MNLNEGSQNTFTRQGRSYISDTEDTAF------
A0A2D2N2N1      ---------------------------MNLNEDSKNTFTRQSRSYISDTEDTAF------
Q7MWZ2          ---------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF------
A0A212FSE5      ---------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF------
T2NDT6          ---------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF------
A0A1R4AFZ0      ---------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF------
A0A1R4DVZ7      ---------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF------
A0A1V9FHD0      --------------------------------------------MQTHKKTGNE------
A0A4V4H170      --------------------------------------------MQTNKKTGNE------
A0A1V9F098      --------------------------------------------MQTNKKTGNE------
A0A4R2VU64      --------------------------------------------MQTNKKTGSE------
A0A0K8QSK7      ---------------------------------MEDPRLEIPGLPFFPEFEQSE------
A0A7C0WKI7      ----------------------------------------------MQESWNNQ------
A0A1T5K9D4      ------------------------------------------MENGNNQKNSGQ------
A0A5M4B212      ------------------------------------MDALNSNSANQMTTIVRQ------
A0A3D1KEX9      -----------------------------------MAEQYIEGAQQLQQEENEE------
A0A358Y7S2      ----------------------------------------MSTGPIKKRVLNKE------
A0A2J6HHN3      -------------------------------------------MKQKIAKFNDE------
A0A1Y3WMT8      -----------------------------------------MEENYTSERRNDS------
A0A1Y4GQU1      -----------------------------------------MEENYTSERRNDS------
A0A6A0R272      ---------------------------------------------MNKNILADK------
A0A1V5W8T5      -------------------------------------------------MFNDS------
A0A2T8HKA9      ----------------------------------------MLKDTNIAGAEDKS------
A0A1X7J248      ---------------------------MSNQQTRYQRNLEGNNSHRPQNQETEV------
E4TQD2          ---------------------------MSNQQTRYQRNLEGNTSQKPQNQESEV------
A0A2I0QZ80      -----------------------------------------MEVNKKKLFVNTT------
A0A3E1F1A3      -----------------------------------------MINQKGKIFVNTT------
A0A2U2XBJ3      -----------------------------------------MINQRGKIFVNTT------
A0A4Q4KU94      -----------------------------------------MNSQKGKIFVNTT------
A0A3B8INU3      ---------------------MAETNQEDYRARIQGGYPGERLEPFGNSSVLDK------
A0A7V6V2N8      -----------------------------------------MDEKPKIPKYNNE------
A0A414ZBF2      --------------------------------MRKDKFEDFDFIDFNESRSEES------
A0A7X9D3Q8      -------------------------------MSKRDIYDEMDFVSLNDRSDREG------
A0A1Q3Q573      -----------------------------MENKLDLTGSGGSAPKGQQTNFAEG------
A0A662BAY3      ---------------------------------MTNNDNSGPVLRNLSSQTSED------
A0A4U3L369      ------------------------------MEYNLNGNGAASNGSISHTDDADI------
A0A4S8HY23      --------------------------------------------MITNKKTGNE------
A0A1V9F383      ------------------------------------------MQPNIN--TKNE------
G8TRZ6          ------------------------------------------MQTNINSKSKSE------
A0A357YNR3      ------------------------------------MSMYSEVEYEFNKLADKP------
A0A7X6YKE8      ------------------------------------MSMYSEVEYEFNKLADKP------
A0A5E8AX52      ------------------------------MTENSNTSGSGLGADVNESDAFND------
A0A1V6CN82      ---------------------------------MTEYNDTDRTQDSAAQEELPV------
A0A1M4XZ45      ---------------------------------MTQSEINKN-NQINSSSDDDT------
A0A399D319      ---------------------------------MTQMDINKNGHQINQSQDDDS------
A0A7Y1YS85      ---------------------------------------MNNRSLEGGTEEDIQ------
F4KK08          ---------------------------------MEYQTASTQQEPIRSSEEVST------
A0A7V5VE02      -----------------------------------MNFSGDRENRIMEEKLERE------
A0A496LCF9      ---------------------------------MKNINSDNHSNPIFDEEDNPS------
A0A5P2G2A9      ------------------------------------MAENLLSNSGKGENAEEA------
A0A3C0ZQC7      -----------------------------------MNIGKGDIERIHRDGISQE------
A0A3N2N6F7      --------------------------MQNNTQQPLSQQMPVYQAAPVVSEEEDS------
A0A419VXB7      ------------------------------------MDRKEELLKLLLQKEEQP------
A0A1Q6E6I7      -----------------------------------MTENNQDIIDGRKEEENKS------
A0A3B9CNN6      -----------------------------------MTENNKDIIDGRKEEENKS------
R5X290          -----------------------------------MTENNKDIIDGRKEEENKS------
C3J7R8          ----------------------------MEYRESETKSIEQELKRPSLVEAASF------
A0A1G8BVM8      ---------------------------------MSKNSEQFDFVDFNDGNSNDN------
A0A1I1FXP9      ----------------------------MLQNAEAINNALVELEEEEELRAEKG------
A0A4P7VVU7      ------------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS------
A0A2V1ILM4      ------------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS------
A0A3N2L0E8      ------------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS------
A0A3N2LFC5      ------------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS------
A0A7K3KWJ8      ------------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS------
A0A3N4H5N3      --------------------------------------MYMKRVLGNKMGNEEP------
A0A2P8EAX2      ----------------------------------------MNQNKARNKGAGEP------
A0A4V2F6N9      ----------------------------------------MSHNRTKNKGAGEP------
A0A838T9G8      ------------------------------------MSEKPTILSPLQRLLGED------
A0A3B9FXJ0      ---------------------------------MSNNAKFQAAPQQESTSGSSG------
A0A848SUJ0      -------------------------------------MQNKEPNQESVRTLIDD------
A0A847ALW2      ---------------------------------MDLNGNNNIQKYLNNKLEDDT------
B2RKZ8          ----------------------------MNLIEDSKNTLAESRSRIYTKEETSF------
A0A0K2J6Z0      ----------------------------MNLIEDSKNTLAESRSRIYTKEETSF------
A0A212GC82      ----------------------------MNLIEDSKNTLAESRSRIYTKEETSF------
A0A0E2M2Y7      ----------------------------MNLIEDSKNTLAESRSRIYTKEETSF------
A0A829KSZ7      ----------------------------MNLIEDSKNTLAESRSRIYTKEETSF------
R5GSU5          ------------------------------------MANQNYINPPAVQQETED------
A0A7X8I6A2      ------------------------------------------MTNRKLPILNDT------
A0A0A2G557      -------------------------------MNNNLYTNPEEGFIENNLSEEQM------
A0A1T4PT95      -----------------------------MNSNPYSNSSDVIMEKHQEIPEENM------
A0A6I6JYY3      -----------------------------------MTTQRFQNNGIEHNNDEDS------
A0A651GU15      ----------------------------MIDENISKVNQSYEGYKERLTNFGSQ------
A1ZKR2          --------------------------------MTDQSNIPNINTPSEDDDFLNA------
A0A1Q3GX01      --------------------------------MEEQNHILPNNNSSENDDFFSS------
A0A349DQI4      --------------------------------MEERNHILPTNNDSENDDFLSN------
A0A4P5TMD1      ------------------------------------MLEKKIILSPMQKILGED------
A0A3Q9FR88      ---------------------------------MTDFDKEWDDLNNEGDNLSNN------
A0A553GEX3      ---------------------------------MTDFDKEWDDHDNDGDNLSNN------
A0A150ADJ9      ---------------------------------MTDFDKEFDDFDREDGNIADS------
A0A7X9P1P7      ---------------------------------MTDFDKEFDDFDREDGNIADS------
A0A7X8SM94      ---------------------------------MNDFDKEWEDFDNNDDSSTNN------
A0A1S1Z228      ---------------------------------MSDFEKEWEDLDNNEESSAND------
A0A1B1FWQ4      ---------------------------------MSDFEKEWEDLENNEESSAND------
A0A7X9Y5D2      ---------------------------------MSDFEKEWEDLENNEESSTND------
A0A7X8ISG0      ------------------------------------------MKKQISNINNEE------
A0A2N3IIZ0      -------------------------MAQYLTEEERFRRLLQTDDIDSGESPLEA------
A0A7X8Q7Q7      ------------------------------------------MSKNKKDSFIEE------
A0A2N2WFW8      ------------------------------------------MAEYKKSKLNDD------
A0A1F3IU95      ------------------------------------------MTDSRKIKFNDE------
A0A3D0VUF6      ------------------------------------------MTDSRKIKFNDE------
A0A7K3WUF2      ----------------------------MYNEDINKLNSNFDSYRERLTNFSNE------
A0A497D5Z2      ---------------------------------MTPPNQRNNKPVSGKSASNED------
A0A662B170      ---------------------------------MTPPNQRNNKPVSGKSASNED------
A0A7X7FWB7      ---------------------------------------MEKKSSNINNTNNEE------
A0A7X8DM61      ---------------------------------------MEKK---ISTLNNEE------
A0A3M1CDV2      -------------------------------MLVANTDNEYHSYKQRLENFSNN------
A0A1F3SJM1      ------------------------------------------MSNKKSLIINKS------
A0A2G2EB96      -------------------------------------------MSSKGIIINTS------
A0A2G6PRA9      -------------------------------------------MNNKGLIINKS------
A0A7Y7A9N2      -------------------------------------------MNNKGLIINKS------
A0A6C1QGZ7      ---------------------------------------MTNPSLKKISTINDE------
A0A7W1EH85      --------------------------------MYNPDVQSNNQLKDITERLNNS------
A0A2E3XZI5      ----------------------------MKQENFVQTEENINRYKENITSLTQD------
A0A6I7QXV0      ------------------------------------MSRGNSILSILQNFLGKD------
A0A7Y3V126      -----------------------------MKFNEELNNPKPVEDTEIVNSLSSD------
A0A7Y5C3U1      -----------------------------MKFNEELNNPKPIEDTEIVNSLSSD------
A0A2M7NLQ9      ---------------------------MSDFDENPFINPAQAADASNEENFLAD------
I4AFR0          ---------------------------MSDFDENPFINTVPTAETSNEENMLAD------
A0A2N2Y3E5      ------------------------------------------MEERRIPILNET------
A0A2D9D7T6      ----------------------------------------MSSLNQRKLIVNKD------
A0A1F3PPL5      -------------------------------------------MQKKIPLINET------
A0A357QK06      -------------------------------------------MQKKIPLINET------
A0A7X9JJJ8      ------------------------------------------MERRKIPILNEK------
A0A522EYA6      ----------------------------MLADQFSNSSNSFSQYKERVSNLSQE------
A0A662AEA4      ------------------------------------------MQQNKIPIINEK------
A0A0S2HYK8      ------------------------------------------MQNRKIPIINDT------
A0A2N5ZWN6      ------------------------------------------MQKNKIPIINDT------
A0A2E0FJ09      ----------------------------MIEEEISKRNDSFERYRERLTNFSSE------
A0A1F3FZ62      -------------------------------------------MAAKISQINTE------
A0A1F3K211      -------------------------------------------MAAKISQINTE------
A0A7Y1UDU0      ------------------------------------------MPKKKITPLNEE------
A0A1V6I2U9      ------------------------------------------MDENKTSLFNQK------
A0A2H0B957      ------------------------------------------MEQKNIPILNEK------
A0A1F3CFW6      ------------------------------------------MEQKRIPILNEK------
A0A2M7E2T8      ------------------------------------------MEQKRIPILNEK------
A0A2M7NC69      ------------------------------------------MEQKRIPILNEK------
A0A1F3KLL5      ----------------------------------------MKQQQRLIPVINDK------
A0A359D1M1      ----------------------------------------MKQQQRLIPVINDK------
A0A0F2NS19      -----------------------------MQEDQFAH------KKEVVSNFNTE------
A0A2A5H8X6      -----------------------------MQEDQFAH------KKEVVSNFNTE------
A0A2H0GAU8      -----------------------------MEEEQFSN------KREPISNFNTE------
A0A2M8FTK1      -----------------------------MEEEQFSN------KREPISNFNTE------
A0A2A5B3B0      -----------------------------MEENNSSNNINEE-KTRKRSNLNTE------
A0A5C6RXM7      -----------------------------MESNNQINSNQDVIKNRKHSTFNTE------
A0A7W1FWM4      ----------------------------MLQEDITKSNDSFERYKERLSNFSGE------
A0A7T9QP55      ----------------------------MLNDDVSNNAAQLDSYRERITNFSNE------
A0A7V9MK11      -----------------------------MYTGNLHDDDNLGRYKERLSNFSKE------
A0A1F3C1M2      ------------------------------------------MSEKKIPLINEK------
A0A1F3DS87      ------------------------------------------MTEKKIPLINEK------
A0A7Y5QSG1      ----------------------------MLSEDVSQRNITLDSYRERITNFSNE------
A0A7Y2EX06      ---------------------------MYSGDEIGKFNENFERYKERITNFSNE------
A0A7Y7NV14      ------------------------------------------MAIRKISNINDE------
A0A6A0R6K9      ----------------------------MYNQIEKNEIENVNRYKDRLSNINKD------
A0A2E7CT70      ----------------------------MIPEEIKNTEDNLLRYRERIANFSKD------
A0A2D5V560      ----------------------------MESENFKXVEXNFQRYKENVADLTQE------
A0A2D7K5A8      ------------------MVNHYSNQSIMGAEEFKGAEENIQRYKENVSDLTQE------
A0A2E1XQ82      ------------------MVNHYSNKSIMGVEDFKGTEDSIQRYKENVADLTQE------
A0A1F3K695      ------------------------------------------MEEKKIPLINEK------
A0A353KZR1      ------------------------------------------MEEKKIPLINEK------
A0A2N2WYB5      ------------------------------------------MYQGKIPLINDK------
A0A1F3K4G0      ------------------------------------------MYQGKIPIINDK------
A0A356H8Y3      ------------------------------------------MYQGKIPIINDK------
A0A351HSA6      ------------------------------------------MYQGKIPIINDK------
A0A2A4PYG9      -----------------------------MYNQTTSGTDNVNAYQDRMSNFSQE------
A0A350JJ90      --------------------------------------MTEETNTNNLGVHSSQ------
A0A2A4YXP3      ------------------------------MEENTSSNNLNEERARKRSNLNTE------
A0A1F3R158      ----------------------------------MSEEYRDKQNNEAISNFNTE------
A0A2M8ADX2      ----------------------------------MNDEFNNKENKETVSNFNTE------
A0A1J5B2H0      ------------------------------------------MQPKKFSIINEE------
A0A1V5N756      ------------------------------------------MANIKISYLNDE------
A0A4P5U6G4      -----------------------------------MQEEKKIILSPLQKLIGSD------
A0A2E2TFD1      ----------------------------MIQDAREEQNESLDLYKERLTKFSQD------
A0A2E4ELE6      ----------------------------MIHEDTSRNNENLDKYKERLTNFSQE------
A0A2A3UE91      ----------------------------MFNPQVESANN---QLKDITEKFNSG------
A0A7V9SRJ9      ----------------------------MLDPQVESTNN---QLKDITERFNTN------
A0A2E6SYP1      ------------------------------------------MEKEKLSILNDE------
A0A2E5RLE8      ------------------------------------------MEKEKLSILNDE------
A0A2E7TQF6      ------------------------------------------MEKEKLSILNDE------
A0A2E6GVY9      ------------------------------------------MEKEKLSILNDE------
A0A2A5FYT6      ----------------------------METSSFSNNNE-----HNAFAKQQSD------
A0A6N9NIX1      ------------------------------------MDENSNLSSPNTVNSSNE------
A0A1F3Q014      ----------------------------MLQEDISKTNDNFERYKERISNFSGE------
A0A2D5KD44      ----------------------------MQEQLSPHELEKLKQSQSSLSSFNTD------
A0A7Y2F301      ----------------------------MRQEEISSFNESFERYRDRITNFSNE------
A0A0E3V905      -----------------------------------MSANTYTYTQHQLVESDGL------
A0A553ETH6      -----------------------------------MNSINENNQEYEGIDLDKA------
A0A2D4ZVH1      ------------------------MHFNGNSSNGYNSGYSPLENETDSYIEKEI------
A0A6P1P355      -------------------------------------------MTDNNQTTQEE------
A0A3D0MYJ7      ----------------------------------MNKNQDIFIDETKSGTETTI------
A0A4Q5WS95      --------------------------------------------MINRPDQKST------
A0A7V9RTA1      ------------------------------------------MNNAQKPENSES------
A0A5C8KAD6      ------------------------------------------------------------
A0A5N1J695      -----------------------------------------MLQVNKDIPNSEE------
L8JI02          -------------------------------------------------MNDKI------
A0A1Q3PII2      -------------------------------------MLATKIPSTDLALSRDW------
A0A351BXT2      -----------------------------MNKPSLNGKSNHTAVNSPELRESKD------
A0A2K8Z965      ----------------------------------MTNESNYSYTTHQVVESEGL------
A0A418M8U8      ----------------------------------MNNQFQHSYVPYKMMEPEEL------
I2GTA4          ----------------------------------MNNQFNHSYVPYKMMEPEEL------
A0A2K8ZAJ2      -----------------------------------MNMNPNVYTPYQTADVESK------
A0A368JPA3      ----------------------------------MKSSNMYSYPMYPQGEINSS------
A0A5N1JI29      ----------------------------------MKSSNMYSYPMYPQGEINSS------
A0A7K0EGC9      ----------------------------------MKSSHMYSYPTYPQGEISSS------
A0A3P1BT12      ----------------------------------MKSSNMYGYPMYPQGEITSS------
A0A3P1CI15      ----------------------------------MKSANMYNYPMYPQGEMSSS------
A0A4R8CUK1      ------------------MHTNPINLRRKISSSDG-------------------------
A0A7Y6XX71      ----------------------------------MSSNGIMQTDNKSIDQDDAI------
A0A2H3NSN0      --------------------MNTNDQNALDIRRKKVEQIGLSRSDNSDTESNAV------
A0A800J4N3      ------------------MLTARLTSPALMAAHPS-FPPDTSPASPQEAEYSRT------
A0A2P6C324      --------------------MNDTSQNLTPYRKQA-EKIGLQSSNSGS-DDNTL------
A0A7V2F6E1      --------------------MARYRHHSLIVARGG-QAGGLHPNGAERHDEGRI------
A0A1M6XHU0      --------------------MAHYRHHSLIVARGG-QRGGLPPASSETRDEGRI------
G2SF81          --------------------MAHYRHHSLIVARGG-QRGGLPPASGETRDEGRI------
A0A5S9EYW1      --------------------MAHYRHHSLIVARGG-QRGGLPPASDEKRDEGRI------
D0MHQ9          --------------------MAHYRHHSLIVARGG-QRGGLPPASDEKRDEGRI------
A0A662AH13      ------------------------------------MNSGYNNNNSGFEIEETN------
A0A5C7QA01      -----------------------------------------MNQNQNTHTEDTI------
A0A3D3LS70      -----------------------------------MSDKSNNIPSVLKKDKEID------
A0A1G1TM36      ------------------------------------------------------------
A0A1G7ZF38      -------------------------------------MLANKTQIAD---FQDW------
C6VS52          -------------------------------------MLTTKGPTNDYPPFQDW------
                                                                            

A0A7V5RJC2      -FD---------------FTRYWK---------AIINKWWLWSATTLIVSVPWVLYVKK-
A0A7C1LGX3      -FD---------------LGEILK----K----YIKYWPWFAASFLLTLAFAV-FYLLS-
A0A1T5MMH4      -ID---------------FNKLKV----I----VRNNLVWIALIFLVINLTAY-LIIRY-
A0A2W4R1L8      -ID---------------FSKLRT----I----IRNNRLWILAIFVVINLLTYLLFIRY-
A0A7L9BFB6      -ID---------------FSKLKI----I----VRTNFIWIVLIFLLTNAAAY-FYLRY-
A0A5C8A5B4      -ID---------------LRAIFG----K----IRSRWWWFLITVPLALAVAI-AYVKT-
A0A2E5CV79      -------------------MELMG---------ILRFHYKLILTITLFGIMIF-TYRTYT
A0A2A4G4B1      -ID---------------LQELLG----F----VLSQWKKMVLGGLIGALLAF-GYLKT-
A0A0P7X1V8      -ID---------------LLQIFG----L----LWHNKWIIITLTLLGGVSAY-IYAQS-
A0A4Y9ITE2      -ID---------------IIELLR----F----YSTKWKAILISVIIFMILGG-IYAYT-
A0A3N2M1H3      -FS---------------IKDYIQ----A----CKSRWQWILLSLIICVGAGV-LYILC-
A0A4S2G8T2      -FS---------------IKDYIQ----A----CKSRWQWILLSLIICVGAGV-LYILC-
A0A212K7W5      -IQ---------------IQDLWK----M----SVEKWHWFAISLTICLIFAF-LYIAI-
F5IU11          -IR---------------IQDLWK----M----SVEKWHWFVISLGICLISAS-LYIAI-
A0A7C1QWC7      -FN---------------VKEFIA----K----AFSYKFFYILCILLLVAGAY-LYNRF-
A0A7Z8P8P1      -IT---------------LRDVVE----L----IIANWYWFAISVIVCVSAAY-LYTRT-
K0XJ09          -VT---------------LRDIVE----L----VFDNWYWIVLSVVICMSVAW-FYLAM-
R5EUZ0          -VT---------------LRDIVE----L----VFDNWYWIVLSVVICMSVAW-FYLAM-
W0EQS0          -IT---------------LRDIVE----L----IFDNWYWIVLSIAVCVSVAW-LYLAM-
A0A1Y3WE15      -IT---------------LRDIVE----L----IFDNWYWIVLSVAVCVLVAW-LYLAK-
A0A1Y4GUK3      -IT---------------LRDIVE----L----IFDNWYWIVLSVAVCVSVAW-FYLAM-
A0A352Z1R7      -AH---------------IYDYLS----V----ILRRRKLFTLAFCAVFFSVV-LYTYL-
A0A7X7BZF5      -LS---------------FKDLFF----L----FLKNWYWFVLSFIVVMSAAL-FFVLR-
A0A0A2F501      -LS---------------LRDLWA----M----CWARKFWFVLSLGLFLGGAI-LYILI-
R5B7P0          -VQ---------------IGQLVR----R----CLSRWYWFALSLAVCLALGA-LYILR-
R5B0L5          -VK---------------ISDVIF----I----TLKRWPWILLSLAICVGCAV-LYVLR-
A0A6I1TEC0      -LR---------------LQDLFY----L----CLARWKWFVLSLFVTMGAAG-YYLLS-
A0A3R5XWG1      -LR---------------LQDLFY----L----CLARWKWFVLSLFVTMGAAG-YYLLS-
A0A5P0Y910      -LR---------------LQDLFY----L----CLARWKWFVLSLFVTMGAAG-YYLLS-
A0A414YFM3      -LR---------------LQDLFY----L----CLARWKWFVLSLFVTMGAAG-YYLLS-
A0A6A7UIA7      -LR---------------LQDLFY----L----CLARWKWFVLSLFVTMGAAG-YYLLS-
A0A6A7VPS3      -LR---------------LQDLFY----L----CLARWKWFVLSLFVTMGAAG-YYLLS-
A0A374THP7      -IR---------------LQDLFY----L----CLAKWRWFILSLAVTLGIAT-YYILT-
A0A6G1VND1      -IR---------------LQDLFY----L----CLAKWRWFILSLAVTLGIAT-YYILT-
A0A0A2EVS5      -FS---------------LKEIFR----L----CLIRWKWILLSLLITVGAAT-AYLMI-
A0A1T4NAJ7      -FS---------------LKEIFR----L----CLIRWKWILLSLLITVGAAT-AYLMI-
A0A255T941      -LR---------------LQDLWG----L----CLPRWRWFVLSVLICASAAV-LYLLR-
A0A4P7VSV0      -VP---------------LTDILY----R----TLHHWPWVLLSLVVCVGAAV-VYLLC-
A0A7J0AX49      -VP---------------LTDILY----R----TLHHWPWVLLSLVVCVGAAV-VYLLC-
A0A3N2KCL3      -VP---------------LTDILY----R----TLHHWPWVLLSLVVCVGAAV-VYLLC-
A0A2V1IJY1      -VP---------------LTDILY----R----TLHHWPWVLLSLVVCVGAAV-VYLLC-
A0A4P7VXK7      -VP---------------LTDILY----R----TLHHWPWVLLSLVVCVGAAV-VYLLC-
A0A1Y4CHN5      -IS---------------IQDFLY----M----CLSKWYWFAISLVVLIALAL-IYIMR-
A0A7Y5JED7      -IR---------------IQDLWG----M----FLPKWHWFALSLVVTLSVAV-LYILS-
A0A1M6I2S6      -IR---------------IQDLWG----M----FVPRWHWFALSLFAALAIAA-FYLLS-
A0A1Y3V692      -IR---------------IQDLWG----M----FVPRWHWFALSLFAALAVAA-FYLLS-
F3PXM2          -IR---------------IQDLGS----M----FVPRWRWFALSLAVALSAAA-LYLLR-
A0A174JCE8      -IR---------------IQDLWG----M----FIPKWYWFALSLFVALATAS-LYLLS-
A0A3E4JMC4      -IR---------------IQDLWG----M----FIPKWYWFALSLFVALATAS-LYLLS-
A0A412SND6      -IR---------------IQDLWG----M----FIPKWYWFALSLFVALATAS-LYLLS-
A0A414IEQ9      -IR---------------IQDLWG----M----FIPKWYWFALSLFVALATAS-LYLLS-
A0A7K0HNT3      -IR---------------IQDLWG----M----FIPKWYWFALSLFVALATAS-LYLLS-
A0A0M1W8D8      -IR---------------IQDLWG----M----FIPKWYWFALSLFVALATAS-LYLLS-
A0A3R6GKX5      -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A7V4S1          -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
B0NU19          -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
D4V601          -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A0A4Q0U3M9      -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A0A7J5G2G2      -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A0A7J5HH13      -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A0A397WLT5      -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A0A6N8DDD8      -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A0A6A2J529      -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A0A7S9QIA5      -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A0A015XH67      -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A0A078RZN2      -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A6L0K5          -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A7ACT5          -IR---------------IQDLWG----M----FIPKWYWFATSLFVALATAS-LYLLS-
A6KY94          -IR---------------LQDLWG----M----FFQKWYWFALSLFVALATAS-LYLLS-
A0A173UQR8      -IR---------------LQDLWG----M----FFQKWYWFALSLFVALATAS-LYLLS-
A0A3R6HK75      -IR---------------LQDLWG----M----FFQKWYWFALSLFVALATAS-LYLLS-
A0A412B7D1      -IR---------------LQDLWG----M----FFQKWYWFALSLFVALATAS-LYLLS-
A0A412VNY9      -IR---------------LQDLWG----M----FFQKWYWFALSLFVALATAS-LYLLS-
A0A414LTU9      -IR---------------LQDLWG----M----FFQKWYWFALSLFVALATAS-LYLLS-
A0A8B2YHC3      -IR---------------LQDLWG----M----FFQKWYWFALSLFVALATAS-LYLLS-
I9Q4U4          -IR---------------LQDLWG----M----FFQKWYWFALSLFVALATAS-LYLLS-
A0A373ISF0      -IR---------------IQDLWG----L----FVPKWHWFVLSLFVTMSVAV-LRLMS-
U6RF62          -IR---------------IQDLWG----L----FVPKWRWFVLSLFVTMSVAV-LRLMS-
A0A662ZZD5      -IR---------------IQDLWG----I----FMPRWHWFALSLFVTLATAA-LYLLG-
A0A415NEB6      -IR---------------IQDLWG----I----FMPRWHWFALSLFVTLATAA-LYLLG-
A7AJ60          -IR---------------IQDLWG----I----FMPRWHWFALSLFVTLATAA-LYLLG-
A0A6A2JF01      -IR---------------IQDLWG----I----FMPRWHWFALSLFVTLATAA-LYLLG-
A0A7J5MKN5      -IR---------------IQDLWG----I----FMPRWHWFALSLFVTLATAA-LYLLG-
A0A015UXN7      -IR---------------IQDLWG----I----FMPRWHWFALSLFVTLATAA-LYLLG-
A0A642KJV3      -IR---------------IQDLWG----I----FMPRWHWFALSLFVTLATAA-LYLLG-
A0A6I2NTL0      -IR---------------IQDLWG----I----FMPRWHWFALSLFVTLATAA-LYLLG-
A0A6I2Q447      -IR---------------IQDLWG----I----FMPRWHWFALSLFVTLATAA-LYLLG-
A0A016E4F9      -IR---------------IQDLWG----M----FVPRWHWFVLSLFAALAVAT-FYLLS-
A0A6N3HG44      -IR---------------IQDLWG----M----FVPRWHWFALSLFAALAVAT-FYLLS-
A0A7K0HSP7      -IR---------------IQDLWG----M----FVPRWHWFALSLFAALAVAT-FYLLS-
A0A7K1HEJ5      -IR---------------IQDLWG----M----FVPRWHWFALSLFAALAVAT-FYLLS-
A0A6H9P0U9      -IR---------------IQDLWS----M----FVPKWYWFAISLFITLTIAV-LYLLS-
A0A108TH71      -IR---------------IQDLWS----M----FVPKWYWFAISLFITLTIAV-LYLLS-
I8VXH0          -IR---------------IQDLWS----M----FVPKWYWFAISLFITLTIAV-LYLLS-
A0A412S0N6      -IR---------------IQDLWS----M----FVPKWYWFAISLFITLTIAV-LYLLS-
A0A412IIJ0      -IR---------------IQDLWS----M----FVPKWYWFAISLFITLTIAV-LYLLS-
A0A0P0FM97      -IR---------------IQDLWS----M----FVPKWYWFAISLFITLTIAV-LYLLS-
R6KTP3          -IR---------------IQDLWS----M----FVPKWYWFAISLFITLTIAV-LYLLS-
A0A139LU87      -IR---------------IQDLWS----M----FVPKWYWFAISLFITLTIAV-LYLLS-
A0A1C6B3Y5      -IR---------------IQDLWS----M----FVPKWYWFAISLFITLTIAV-LYLLS-
A0A6L3KCD1      -IR---------------IQDLWS----M----FVPKWYWFAISLFITLTIAV-LYLLS-
E2NMQ4          -IR---------------IQDLWS----M----FVPKWYWFAISLFITLTIAV-LYLLS-
A0A412YDB9      -IR---------------IQDLWS----M----FVPKWYWFAVCLFITLAIAV-LYLLS-
R7DY01          -IR---------------IQDLWS----M----FVPKWYWFAVCLFITLAIAV-LYLLS-
A0A414LGK8      -IR---------------IQDLWS----M----FVPKWYWFAVCLFITLAIAV-LYLLS-
A0A415IPQ4      -IR---------------IQDLWS----M----FVPKWYWFAISLFITLTIAV-LYLLS-
A0A3E5BRW7      -IR---------------IQDLWG----M----FVPKWHWFAGSLLITLAIAV-LYLLS-
K9DXS6          -IR---------------IQDLWG----M----FVPKWHWFAGSLLITLAIAV-LYLLS-
A0A1M6KFV3      -IR---------------IQDLWG----M----FVPKWYWFAGSLFVTLTIAA-LYLLS-
A0A1Q6G7L3      -IR---------------IQDLWG----M----FVPKWYWFAGSLFVTLTIAA-LYLLS-
A0A413H235      -IR---------------IQDLWG----M----FVPKWYWFAGSLFVTLTIAA-LYLLS-
A0A358R8U0      -IQ---------------IKDLLY----L----CLAKWKWFILSLLVTLSLAF-LYLLK-
R6WSB6          -IQ---------------IKDLLY----L----CLAKWKWFILSLLVTLSLAF-LYLLK-
A0A401LPX7      -IT---------------IQDLFY----L----CLNKWHWFVISLVLCLGGAT-FYLLR-
A0A6G0GNY9      -IT---------------IQDLFY----L----CLNKWHWFVISLVLCLGVGT-FYLLK-
A0A6I1BFM0      -IT---------------IQDLFY----L----CLNKWHWFVISLVLCLGGAT-FYLLK-
A0A3A5Z900      -IT---------------IQDLFY----L----CLNKWHWFAISLALCLGVAT-FYLLR-
A0A7K0GW19      -IT---------------IQDLFY----L----CLDKWHWFAISLALCLGVAT-FYLLR-
A0A285TGL6      -IT---------------IQDLFY----L----CLDKWHWFAISLALCLGVAT-FYLLR-
A0A3A5RFX4      -IT---------------IQDLFY----L----CLDKWHWFAISLALCLGVAT-FYLLR-
A0A1Q6IUW9      -IT---------------IQDLFY----L----CLNKWHWFAISLALCLGVAT-FYLLR-
A0A413XDP6      -IT---------------IQDLFY----L----CLNKWHWFAISLALCLGVAT-FYLLR-
A0A6N8CVT6      -IT---------------IQDLFY----L----CLNKWHWFAISLALCLGVAT-FYLLR-
K6AP24          -IT---------------IQDLFY----L----CLNKWHWFAISLALCLGVAT-FYLLR-
A0A6I2NHV3      -IT---------------IQDLFY----L----CLNKWHWFAISLALCLGVAT-FYLLR-
A0A662ZYI7      -IT---------------IQDLFY----L----CLNKWHWFAISLALCLGVAT-FYLLR-
A0A078RYI7      -IT---------------IQDLFY----L----CLNKWHWFAISLALCLGVAT-FYLLR-
C7XEQ8          -IT---------------IQDLFY----L----CLNKWHWFAISLALCLGVAT-FYLLR-
D7INX6          -IT---------------IQDLFY----L----CLNKWHWFAISLALCLGVAT-FYLLR-
K5ZG55          -IT---------------IQDLFY----L----CLNKWHWFAISLALCLGVAT-FYLLR-
A0A7Y5MWI8      -IR---------------IQDLFY----L----CLNKWYWFVISLAVTVGVAV-VYLLT-
A0A1M5B2J8      -IR---------------IQDLLY----L----CLAKWHWFVLSLAVCLGVAI-AYLLR-
A0A255RCT5      -IR---------------IQDLLY----M----CLAKWYWFVLSLAVCLGVAI-AYLLR-
A0A1Y4GLF5      -LR---------------IQDLFY----L----CLAKWKWFVISLVVTCGIAV-LYLLR-
A0A1H3XSC0      -IR---------------VQDLLY----L----CLSKWKWFVLSLAVTVGIAV-FYLLR-
A6LE40          -LR---------------IQDLLF----L----CLAKWQWFVLSLVVTVGAAT-VHLLR-
A0A4Y1VPX5      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A6N2XMM4      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A7U8L0B4      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
B3JI46          -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A3N2N9B8      -LP---------------ISDILF----L----TLRKWPWIILSLTICVGAAL-TYILR-
A0A3N2NMI0      -VP---------------IVDIIF----L----TLRKWPWILLSLIVCVGAAM-IYILR-
A0A359I8H7      -FS---------------LKDFLA----R----CLSKWRWFAVSIVLFCCLGV-LYVLR-
A0A3N2KA63      -FS---------------LKDFLA----R----CLSKWRWFAVSIVLFCCLGV-LYVLR-
A0A4Q0IMT7      -FS---------------LKDFLA----R----CLSKWRWFAVSIVLFCCLGV-LYVLR-
A0A7J0B660      -FS---------------LKDFLA----R----CLSKWRWFAVSIVLFCCLGV-LYVLR-
A0A3B9FAU3      -FN---------------LRMLLD----I----VLGNWFWILQSVILFGAAGW-YYLKI-
A0A3C1E5L7      -FN---------------LRMLLD----I----VLGNWFWILLSVILFGAAGW-YYLKI-
A0A4Q0UAV1      -IN---------------IKELLY----Y----FLSKWYWFVISVAVCVAFAS-YKLMS-
A0A354SN68      -FV---------------LKDFLF----A----CLAQWKLFALSVAVCVGATM-LYLSS-
A0A6L5XFL0      -LN---------------IQDFLY----L----CAAKWYWFLISFIVMLGLAC-LYILC-
A0A3N2N595      -VP---------------LSDIIY----R----TLHYWPLVLLSLFICVGAAV-MYLLC-
A0A7J0ACS3      -VP---------------LSDIFF----M----TLRRWPWILLSVLVCVGAAY-VYLLR-
A0A0A2DUD9      -FS---------------LQDLWR----L----VCIRWYVIAISILLALGVAV-LYILR-
A0A3P1ZBJ5      -VD---------------IQDILY----L----CLSKWYWFLLSLILSLALGV-LIILR-
R5FHS9          -VV---------------ITDFLY----L----CLRKWWWFAIALIIAFGVAI-AYILR-
A0A413TW79      -IR---------------LQDLMY----L----CLVRWRWFVISLVVTLGIAT-YYLLS-
A0A7K0AAG2      -IR---------------LQDLMY----L----CLARWRWFAISLAVTLGIAT-YYLLS-
A0A7K0ASF1      -IR---------------LQDLMY----L----CLVRWRWFVISLVVTLGIAT-YYLLS-
A0A3E5E9M7      -IR---------------LQDLMY----L----CLVRWRWFVISLVVTLGIAT-YYLLS-
A0A3E4SK73      -IR---------------LQDLMY----L----CLVRWRWFVISLVVTLGIAT-YYLLS-
A0A415GGC6      -IR---------------LQDLMY----L----CLVRWRWFVISLVVTLGIAT-YYLLS-
A0A413DBH9      -IR---------------LQDLMY----L----CLVRWRWFVISLVVTLGIAT-YYLLS-
A0A495WI87      -MR---------------IQDLLY----L----CASNWYWFALSLMITLGAAF-LYIKV-
A0A354M4S6      -MR---------------IQDLLY----L----CASNWYWFALSLMITLGAAF-LYIKV-
R7DH52          -MR---------------IQDLLY----L----CASNWYWFALSLMITLGAAF-LYIKV-
A0A7J5IAE7      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTLGIAT-FYILR-
A0A016CWA4      -LR---------------IQDLLY----L----CLAKWKWFVLSLVVTTGVAA-VYLLR-
A0A4P8LP09      -LR---------------IQDLLY----L----CLAKWKWFVLSLVVTTGVAA-VYLLR-
A0A0M1W0V2      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A139KA16      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A174VQ92      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A1Q6HCG0      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A1Y4JYM9      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A3A5QW67      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A3A5RQE6      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A3A6BP07      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A3E5E153      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A3Q9IP20      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A412WV15      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A413ICP6      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A414KYB9      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A5B3FWR2      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A7J5QHB9      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
E5WX00          -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
K0X3P3          -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A1C6H117      -LR---------------IQDLLY----L----CLARWKWFVLSLAITTGVAA-VYLLC-
A0A6I1AQV4      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A5C6L2P1      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A3E4WKT5      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A3A5YY33      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A1E9CFZ7      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A373FYU5      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A3A5XBP2      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A3A6MEG9      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A3E4JP35      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A3E4KP40      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A3E4NX82      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A3E4XFU8      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A412RG70      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A412TD37      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A413GAA4      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A414M7I4      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A496BTA0      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A496D2V6      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A5C6KCA6      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A5M5AHM5      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A6I0Y5K7      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A6I1BFB8      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A6I2P5W5      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A6N8DC51      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A7J5HGP0      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A7J5HVL8      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A7J5JHD3      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A8B3EKM1      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
E5UZA2          -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A069SMG6      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
C3RFN5          -LR---------------IQDLLY----L----CLARWKWFVLSLVVTIGVAT-VYLLR-
A0A3A5Z014      -LR---------------IQDLLY----L----CLARWKWFVLSLAITVGAAT-VHLLR-
A0A7J5GD93      -LR---------------IQDLLY----L----CLARWKWFVLSLVVTVGAAT-VHLLR-
A0A7K0HGR5      -LR---------------IQDLLY----L----CLARWKWFVLSLAITVGAAT-VHLLR-
A0A078S3Q8      -LR---------------IQDLLY----L----CLARWKWFVLSLAITVGAAT-VHLLR-
A0A069SJV7      -LR---------------IQDLLY----L----CLARWKWFVLSLAITVGAAT-VHLLR-
A0A3E5DXI5      -LR---------------IQDLLY----L----CLARWKWFVLSLAITVGAAT-VHLLR-
A0A3E5EM98      -LR---------------IQDLLY----L----CLARWKWFVLSLAITVGAAT-VHLLR-
A0A6N2YYD4      -LR---------------IQDLLY----L----CLARWKWFVLSLAITVGAAT-VHLLR-
I9T3G6          -LR---------------IQDLLY----L----CLARWKWFVLSLAITVGAAT-VHLLR-
A0A3E4SYU0      -LR---------------IQDLLY----L----CLARWKWFVLSLVVTIGVAT-VYLLR-
A6LGY1          -LR---------------IQDLLY----L----CLARWKWFVLSLVVTIGVAT-VYLLR-
K5ZSH4          -LR---------------IQDLLY----L----CLARWKWFVLSLVATIGVAT-VYLLR-
A0A6A2RTB3      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A7J5PEN4      -LR---------------IQDLLY----L----CLARWKWFVLSLAVTIGAAT-AYLLR-
A0A1M4YZ07      -LR---------------IQDLLY----L----CLARWQWFVLSLVVTVGAAT-VHLLR-
A0A7J5I238      -LR---------------IQDLLY----L----CLARWQWFVLSLAVTIGAAT-AYLLR-
A0A0P0FQW1      -LR---------------IQDLLY----L----CLARWQWFVLSLAVTIGAAT-AYLLR-
A0A7K0I229      -LR---------------IQDLLY----L----CLARWQWFVLSLAVTIGAAT-AYLLR-
A0A5M5C0W6      -LR---------------IQDLLY----L----CLARWQWFVLSLAVTIGAAT-AYLLR-
A0A642NJ89      -LR---------------IQDLLY----L----CLARWQWFVLSLAVTIGAAT-AYLLR-
A0A6L3JTQ2      -LR---------------IQDLLY----L----CLARWQWFVLSLAVTIGAAT-AYLLR-
A0A7J5FQU6      -LR---------------IQDLLY----L----CLARWQWFVLSLAVTIGAAT-AYLLR-
A0A7J4YLH7      -LR---------------IQDLLY----L----CLARWQWFVLSLAVTIGAAT-AYLLR-
A0A6N3AEV2      -LR---------------IQDLLY----L----CLARWQWFVLSLAVTIGAAT-AYLLR-
A0A6G0G4T5      -LR---------------IQDLLY----L----CLARWQWFVLSLAVTIGAAT-AYLLR-
A0A6L3KG29      -LR---------------IQDLLY----L----CLARWQWFVLSLAVTIGAAT-AYLLR-
A0A1Y4PQK7      -LR---------------IQDLFY----L----CAAKWKWFVLSLLVAFGIGY-YYLLK-
A0A1Y4IH41      -LS---------------IQDLFY----L----CAAKWQWFVLSLLVAFGIGY-YYLLK-
A0A3A6AAP4      -LR---------------IQDLFY----L----CAAKWQWFVLSLLVAFGIGY-YYLLK-
A0A6I0ZRD2      -LR---------------IQDLFY----L----CAAKWQWFVLSLLVAFGIGY-YYLLK-
A0A1Y4DYA7      -LN---------------LKDLLF----S----LLKKWYWFVISILISITIAI-FYIMC-
A0A1Y3X4I9      GIN---------------FKDLMY----L----CLAKWYWFVISLVVLLGFTA-LHLLT-
A0A1Y4FNK8      -IR---------------IQDLFY----L----CLNKWYWFVISLAVTIGVAV-VYLLT-
A0A355FD59      -IR---------------IQDLFY----L----CLAKWRWFVLSLFVTLGIAV-LYLLT-
A0A359CEZ9      -IR---------------IQDLFY----L----CLAKWRWFVLSLFVTLGIAV-LYLLT-
A0A353Q7B4      -IR---------------IQDLFY----L----CLAKWRWFVLSLFVTLGIAV-LYLLT-
F8X3A5          -IR---------------LQDLLY----L----CLFRWRWFVISLFITLSIAT-FYILT-
A0A1M3KVR9      -IR---------------LQDLLY----L----CLFRWRWFVISLFITISIAT-FYILT-
A0A4Y9IJS3      -IR---------------LQDLLY----L----CLFRWRWFVISLFITISIAT-FYILT-
A0A416GA42      -LN---------------PMDLLH----V----ALKKWYYYVGAVVCCLLFAY-IYLHR-
A0A1T3IYP5      -IN---------------VLDLLK----Y----LLHHWKWFTLSILIFGGFFY-YQYSK-
A0A7Z6RZU4      -FN---------------IRAIVD----I----LKAKWYWFAFSIFVCLGVAW-FYYQI-
A0A4D7K1D4      -MD---------------WEKLAS----I----SRKSIPFIILIFALTISAAI-FYVRY-
A0A846MP44      -VD---------------WAKLRL----I----LRRHWWSIFLFPLLGLLGGY-FFLRY-
A0A1G9E2A9      -ID---------------WPKLLS----I----VNRSIVWVLLFVALGVLAAW-ISLRY-
A0A098LL25      -FD---------------FAKLLV----I----ANKSLVWVILLVVLSITGAF-LYVRY-
A0A6J4H627      -LD---------------FIKILS----I----VRKNIIWILLIPALCLFGGY-MYLRY-
A0A6C0GJI1      -LD---------------LIRLYH----I----LKRNIFWLILIPMISLLGGY-LYLRY-
A0A839GQ17      -ID---------------FVTLWH----V----IRRSIPWVILLVLLGLAASY-MFLRY-
A0A127B287      -ID---------------LVTLWH----V----VRRSIPWVILLVLLGLTGSY-LFLRY-
A0A6P1P2P6      -ID---------------LVTLWH----V----VRRSIPWVLLLVLLGLTGSY-LFLRY-
A0A2T2YJE8      -ID---------------FIMLLS----I----IRKSLIWVSLLIVLGLIGAF-LFLRY-
A0A7L7LEW0      -ID---------------FIMLLS----L----IRKSLIWVGLLIVVGLIGAF-LFLRY-
A0A3M9N829      -ID---------------FVTLLD----V----VKRSILWVVLLILLGGAGAY-LYLRY-
A0A0P0CSF9      -ID---------------FVTLLH----V----AKRSIPWIILLVLLGIGGSY-LYLRY-
A0A5M8QQB8      -ID---------------FVTLLH----V----VKRSIPWVLLLILLGAGGSY-LYLRY-
A0A3M9MNC3      -ID---------------FVTLLH----V----VRRSIPWVLLLVLLGVSASY-VYLRY-
A0A5B6TAX2      -ID---------------FVTLLH----V----VRRSIPWVLLLVLLGGSASY-LYLRY-
A0A7L5A132      -LD---------------LATLLM----V----TRRSLPWMVFLILLGVTAAW-LYLRY-
A0A512AYT3      -VD---------------FVILLA----V----ARKSLIWVVLLIMLGLAASY-LFLRY-
A0A5M6CYN7      -VD---------------FVTLLA----V----ARKSLVWVILLILLGLTASY-LFLRY-
A0A369QP10      -ID---------------FIMLLS----L----VRKSLIWVALLIVLGLIGSF-LFLRY-
A0A7G7G7M4      -ID---------------FIMLLS----L----VRKSLIWVALLIVMGLIGAF-LFLRY-
A0A126PDF2      -LD---------------LSTLAL----V----ARRSLLWLLLLLALGGSAAW-LYLRY-
A0A2Z3GKA1      -LD---------------LSTLAL----V----ARRSLLWLLLLLALGGSAAW-LYLRY-
A0A502GZP7      -LD---------------LSTLAL----V----ARRSLLWVLLLLVLGGSASW-LYLRY-
A0A0M3RW20      -LD---------------LSTLVM----V----VRKSLPWMLLFILLGLLTSW-TYLRY-
A0A495VFX4      -LD---------------VSTLVM----V----VRKSLPWMILFILLGLLTSW-TYLRY-
A0A246FQC0      -LD---------------LTTLLM----V----VRKSLPWMVLLIALGLTASW-LFLRY-
A0A372E5P8      -LD---------------LTTLLT----V----ARRSLPWIILLVALGLTAAW-LFLRY-
A0A7Y7PLY0      -LD---------------LTTLLA----V----ARKSLPWVLLLVALGLTAAW-LFLRY-
A0A1H3EMW1      -LD---------------LTTLLA----V----ARKSLPWMVLLIGLGLTAAW-LFLRY-
A0A1H9ZSN3      -LD---------------LTTLLT----V----ARRSLPWMVLLVVLGLTASW-LFLRY-
A0A7W9SXN1      -LD---------------LTTLLM----V----VRKSLPWMLLLILLGLTASW-LFLRY-
A0A418R9X5      -LD---------------LTTLLM----V----ARRSLPWMVLLIMIGLTASW-LFLRY-
A0A428JSJ3      -LD---------------LSTLLM----V----ARKSLPWMLLLIALGVTASW-LFLRY-
A0A428KI59      -LD---------------LTTLLM----V----ARKSLPWMLLLIALGVTASW-LFLRY-
W8F1I6          -LD---------------LTTLLM----V----ARKSLPWMLLLIVLGVTASW-LFLRY-
A0A1S9B3W0      -LD---------------LPLLLS----V----TRRSLPWMILLILLGLGASW-TYLRY-
A0A1W1VRL3      -LD---------------ITTLLQ----V----ARKSLPWIALLIALGLTSSW-LFLRY-
A0A7G6YQJ9      -LD---------------LTTLLM----V----ARKSLPWVILLIGLGLTASW-LFLRY-
A0A1M6R305      -LD---------------FDTLLM----V----VRRSLIWLLLLIGLGITGSW-LFLRY-
A0A7G7W8X3      -LD---------------FDTLLL----V----ARRSLLWLLLLIGLGLTGSW-LFLRY-
A0A4Z0PHK3      -ID---------------ITTLLL----V----ARRSLLWIVLLIALGLSASW-LLLRY-
A0A2M9B9H9      -LD---------------LTTLLL----V----ARRSILWIILLIALGLSASW-LLLRY-
A0A4Z0QCY9      -LD---------------IATLLL----V----ARRSLLWIVLLIALGLSASW-LLLRY-
A0A7Y0AH93      -LD---------------LTTLVL----V----ARRSLLWVMLLLIVGITGSW-LYLRY-
A0A519SBU8      -FD---------------IGTLVM----V----ARRSLVWVALLLALGFTASW-LFLRY-
A0A4Q3JNZ3      -LD---------------LNTLVM----V----ARRSLVWVALLLALGFTSSW-LFLRY-
A0A519Q9V3      -LD---------------LNTLVL----V----ARQSLVWVVLLLALGFTGAW-LFLRY-
A0A5N1J2M4      -FD---------------LVTLVQ----V----TRKSLVWVLLLIMLGLFGAY-MVIRY-
A0A519S476      -----------------------M----V----ARRSLIWVVLLLALGFTSSW-LFLRY-
A0A4Q3JRW8      -LD---------------LNTLVM----V----ARRSLVWMLLLLALGFTASW-LILRY-
A0A519M923      -LD---------------LNTLVL----V----ARRSLVWVVLLLALGFTASW-LFLRY-
A0A4Z0ENW1      -FD---------------LSTLVL----V----ARRSLLWVIVLLALGITASW-LYLRY-
A0A519UDB4      -FD---------------ISTLVL----A----VRRSLPWAALLILLGLTSSW-LYLRY-
A0A3S0QKV1      -LD---------------LPLLLS----V----TRRSLPWMLLLLLLGLAASW-TYLRY-
A0A328BL48      -LD---------------LPLLLS----V----ARRSLPWMILLVLIGLAASW-SYLRY-
A0A5R8WLY4      -LD---------------LPLLLS----V----ARRSLPWMILLVLIGLAASW-SYLRY-
A0A1I5WSL8      -LD---------------ISTLVL----V----ARRSLLWLILLIALGLTASW-LYLRY-
A0A0U3JVM7      -LD---------------IATLVL----V----ARRSLLWMLLLVGLGVTASW-LYLRY-
A0A1G1SSV2      -LD---------------ITTLVL----V----ARRSLLWMLLLIMLGTTASW-LYLRY-
A0A1G1SXV7      -LD---------------ITTLVL----V----ARRSLLWMLLLITLGLTASW-LYLRY-
A0A6G8CBJ6      -LD---------------LTTLLQ----V----ARKSLPWIALLIALGLTGAW-LFLRY-
A0A0W8EDI5      -FD---------------VATLLM----V----TRRSLPWMVLLIALGLTAAW-LYLRY-
A0A3B7RBP8      -FD---------------ISTLLM----V----VRRSLPWMILLVLLGVTAAW-LYLRY-
A0A3R9P8H7      -ID---------------FTTLLT----V----ARKSLPWMLLLIALGLTAAW-LFLRY-
A0A238WIA7      -LD---------------LTTLIM----V----ARKSLPWVLLLVMLGLLTSW-LFLRY-
A0A212UCJ7      -LD---------------LTTLLM----V----ARKSLPWVLLLISLGLLASW-LFLRY-
A0A4Z0MQE1      -LD---------------LTTLVM----V----ARKSLPWVLLLVILGLLSSW-LFLRY-
A0A4Z0PCF4      -LD---------------LTTLVM----V----ARKSLPWVLLLVILGLLSSW-LFLRY-
A0A6M6BED0      -LD---------------LTTLAM----V----ARKSLPWVLLLVALGLLCSW-LFLRY-
A0A5D6VDG1      -ID---------------TTTLLM----V----ARRSLPWMMLLILLGLAAAW-TFLRY-
A0A243WHR7      -LD---------------LVTLLL----V----ARRSLIWVVLLIVLGLTGSW-LYLRY-
A0A5B8A0P6      -FD---------------ITTLLT----V----ARKSLPWIVLLIALGLTGSW-LFLRY-
A0A076HRT9      -LD---------------FDTLLM----V----VRRSLLWLLLLIGLGLTGSW-LFLRY-
A0A4Z0PVM7      -LD---------------IATLLL----V----ARRSLLWIILLIALGLSASW-LMLRY-
A0A1M6DHW8      -LD---------------IATLLL----V----ARRSLIWIVLLIALGLTASW-LFLRY-
A0A4Q5LC61      -FD---------------IATLLL----V----ARRSLIWIVLLIALGLTASW-LFLRY-
A0A060RD97      -LT---------------ARQVVE----L----VLANWYWFAVSLLVALLLGG-YLYVK-
A0A350IHV0      -LS---------------LTEIWA----M----IWNNKWWYVLSLVVCIFMAG-FVIYR-
A0A2A8CVM9      -ID---------------VAEILD----M----LRRGKWIIAATTIVVVALVG-AYTYT-
R5RVP0          -LN---------------LADLWS----M----IWDNKWWYVLSVAICLCFSV-FYLYR-
A0A2L2WX98      -AQ---------------LIPLLR----LCLGQLKAHWVWFLFSVIACAALGF-LYLQC-
A0A2E3R1D0      -ID---------------LRALLD----I----LLRGKWIILGAVLALTIPVM-VYSML-
A0A800J826      -ID---------------LREIID----L----AIRGKWIVLGTLVALLIPTT-LFTMW-
A0A2T2USC0      -IT---------------LQEIIG----M----LWGGKWVILATFVVVVALGA-AYTFT-
A0A2T2V0F3      -IT---------------LQELVG----M----LWGGKWVILATFAVVLALGA-AYTFS-
A0A2T2S682      -R----------------LRALLS----T----LWGGKWILLTVFVLVVGTVA-VYTYT-
A0A840DJZ8      -RQ---------------IEELLD----L----LLRRKWLIVLVLVLTTVGAA-LHSYS-
D5H561          -GQ---------------IEELLD----L----LRRRKWLIVLVCLATVAGAA-LYTYT-
A0A2H3NWA9      -SQ---------------LREMAG----L----LWAHKWIILGVFVVVMAAAG-VYTYT-
A0A2A8CVB6      -SQ---------------LHELLG----T----LWRGKWIILGVLIVVLAAGT-AYTLS-
A0A2P6C1S6      -SQ---------------LHDLIQ----T----LWEGKWIILGVVTAVVLAAA-AYMYT-
A0A2T2UTM4      -SQ---------------LHDLIQ----M----LWDRKWIILGIVAVAVLSAA-VYTYT-
R6A0L2          -MQ---------------LIPLLK----LCYHQFINHWAWFALSAVVCGCIGW-YYQQC-
R7LG80          -MQ---------------IIPLLK----LCINQLLRNWYWFLLSIVICLGLGW-IYRQS-
A0A7W5UEN4      -IQ---------------LIPLFK----MCWALFLANLKWFILSVILCLVLGY-LYQAR-
G5GD56          -IQ---------------LIPLFK----MCWALFLANLKWFVLSVILCLVLGY-LYQAR-
R5KD55          -IS---------------IRDILI----S----CASHWRWYVATVVVALAVAV-LYIKK-
A0A174QNT3      -VT---------------LRDLLE----L----FLNNWYWFIASILFCVGGAW-LYLSA-
A0A4S2FGS1      -IT---------------LRDIVE----L----FLNNWYWFAASAVACVAMAW-IYLSA-
A0A7K3KG59      -IT---------------LRDIVE----L----FLNNWYWFVVSAVACVAMAW-VYLSA-
R9I0H0          -IT---------------LRDIVE----L----FLNNWYWFAASAVACVAMAW-IYLSA-
K5BUT9          -IN---------------LRDVVE----L----IIANWYWFVLSVLVCVGSAY-FYVLT-
A0A174FPA3      -IN---------------LRDVVE----L----IIANWYWFVLSVLVCVGSAY-FYVLT-
R6S9Y6          -IN---------------LRDVVE----L----IIANWYWFVLSVLVCVGSAY-FYVLT-
A0A7J4YSB2      -IN---------------LRDVVE----L----IIANWYWFVLSVLVCVGSAY-FYVLT-
C9KX15          -IN---------------LRDVVE----L----IIANWYWFVLSVLVCVGSAY-FYVLT-
A0A6H0KRK1      -IN---------------LRDIVE----L----IIANWYWFALSVFICLSVAY-LYTRT-
R6DAG6          -IN---------------LRDIVE----L----IIAKWYWFALSVFICVSAAY-LYTRT-
A0A3L8AAP1      -IN---------------LRDIVE----L----LIAKWYWFALSVFICVSAAY-LYTRT-
A0A4S2AYX2      -IN---------------LRDIVE----L----LIAKWYWFALSVFICVSAAY-LYTRT-
A0A7J0A2L4      -IN---------------LRDIVE----L----LIAKWYWFALSVFICVSAAY-LYTRT-
A0A7K3MN31      -IN---------------LRDIVE----L----LIAKWYWFALSVFICVSAAY-LYTRT-
R6CQ93          -IN---------------LVDLFV----Y----LLSKWKWFVLSILFFGGLAW-YYYAQ-
A0A3D1NQW3      -FS---------------VHDLIQ----T----VIANWYWFVISVFVCVGCGY-IYILR-
B0MT10          -FS---------------VHDLIQ----T----VIANWYWFVISVFVCVGCGY-IYILR-
R7JGW9          -FS---------------VHDLIQ----T----VIANWYWFVISVFVCVGCGY-IYILR-
A0A3D2BF46      -FS---------------IHDLIQ----M----VIGNWFWFLLSTVVCLSCAL-FYIYT-
A0A358R538      -VT---------------LHDILR----M----VAANWYWFVISAAVCLGAAY-YYLAS-
A0A1Y4AAB8      -FS---------------LHDLIQ----M----ILANWYWFAISVIVCLGAGY-LYLAR-
A0A1Y3WWY9      -IN---------------LHDIIR----M----ILMNWYWFVLSVLVCLGVAY-YYLAK-
A0A1Y4U5L4      -IN---------------LHDIIR----M----ILMNWYWFVLSVLVCLGVAY-YYLAK-
A0A1Y3VCJ1      -ID---------------LHDIIR----M----VIANWYWFILSILVCVGAAY-YYLAK-
A0A1Y3QTW7      -LT---------------LHDLLQ----M----VLANWYWFALSVLICLGMAY-YYLAS-
R6XWY7          -LT---------------LHDLLQ----M----VLANWYWFALSVLICLGMAY-YYLAS-
A0A4Y1X9Y9      -LT---------------LHDLLQ----M----VLANWYWFALSVLICLGVAY-YYLAS-
A0A4Y1WM66      -LT---------------LHDLLQ----M----VLANWYWFALSVLICLGVAY-YYLAS-
A0A6N4GYT3      -LT---------------LHDLLQ----M----VLANWYWFALSVLICLGVAY-YYLAS-
A0A174AVF1      -LT---------------LHDLLQ----M----VLANWYWFALSVLICLGVAY-YYLAS-
A0A1Q6EIY0      -IT---------------LHDLIQ----M----VLANWYWFALSAIICLGTAY-YYLAS-
A0A5B5VN71      -IT---------------LHDLIQ----M----VLANWYWFALSAIICLGTAY-YYLAS-
E4M8L3          -IT---------------LHDLIQ----M----VLANWYWFALSAIICLGTAY-YYLAS-
I3YQ50          -IT---------------LHDLIQ----M----VLANWYWFALSAIICLGTAY-YYLAS-
R5UEY8          -IT---------------LHDLIQ----M----VLANWYWFALSAIICLGTAY-YYLAS-
A0A1H4D866      -VT---------------LHDIIR----M----VIANWYWFVLSALVCLSLAY-YYLAS-
A0A5B3G4Y7      -IT---------------LHDIIR----M----VIANWYWFVLSTVCCLCAAY-YYLAS-
A0A374A9J5      -IT---------------LHDIIR----M----VIANWYWFVLSTVCCLCAAY-YYLAS-
A0A5B3GQN5      -IT---------------LHDIIR----M----VIANWYWFVLSTVCCLCAAY-YYLAS-
A0A1Q6E9S3      -IT---------------LHDIIR----M----VIANWYWFVLSTVCCLCAAY-YYLAS-
D4IJ36          -IT---------------LHDIIR----M----VIANWYWFVLSTVCCLCAAY-YYLAS-
A0A414Q925      -V----------------IADMLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
A0A415PUS9      -V----------------IADMLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
A0A108TCU0      -V----------------IADMLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
A0A413BA42      -V----------------IADMLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
S3Y344          -V----------------IADMLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
A0A7J5LEW3      -V----------------IADMLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
A0A412TGL3      -V----------------IADMLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
A0A413VJ33      -V----------------IADMLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
A0A414L0W6      -M----------------IADMLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
A0A412DP39      -V----------------IADVLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
A0A413ZSE8      -V----------------IADMLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
B0NP84          -V----------------IADMLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
R6AK43          -V----------------IADMLS----A----VYRNRKWFILSVAVCVLIGF-LYLKS-
A0A412N2D9      -V----------------IADMLS----A----VYRNRKWFILSVVVCVLIGF-LYLKS-
A0A1Y4JYS9      -V----------------IADMLS----A----VYRNRKWFILSVVVCVLIGF-LYLKS-
R6LHA4          -V----------------IADMLS----A----VYRNRKWFILSVVVCVLIGF-LYLKS-
A0A3E5HPT8      -IN---------------IVDLFI----Y----LIAHWKWFVLSILLFGGYFW-YSYCE-
C6IJ48          -IN---------------IVDLFI----Y----LIAHWKWFVLSILLFGGYFW-YSYCE-
Q8A3U2          -IN---------------IVDLFI----Y----LIAHWKWFVLSILLFGGYFW-YSYCE-
A0A3R6S1H6      -LN---------------LIDLWY----M----FKRYWYWFVLSVMVFLGGAV-YYVKS-
A0A3R6SD81      -LN---------------LIDLWY----M----FKRYWYWFVLSVMVFLGGAV-YYVKS-
A0A354WXN6      -LN---------------ILDLVK----I----AWANWYWFVISIVLCLSIAF-VYLKW-
A0A7G1HW11      -LS---------------LRDILE----I----GLANWKWFALSVIVCLSIAY-VYVQT-
R5IP14          -LS---------------LRDILE----I----GLANWKWFALSVIVCLSIAY-VYVQT-
A0A316SZX7      -IN---------------LRDILD----L----LISQWKWFALSICICLGIAF-LYLKQ-
A0A1Y4AIY1      -VT---------------LGDIFQ----I----VKAKWYWFALSIGICLGIAY-IYLLQ-
A0A0J6CIR2      -LN---------------LSDLFH----I----VLANWYWFVLSVLVCAGVAV-LYLKW-
A0A3D8HG59      -LN---------------LGDIIQ----I----VRANWYWFALSVVVCMSAAF-VYLQW-
A0A3R6S408      -LN---------------LGDIIQ----I----VRANWYWFALSVVVCMSAAF-VYLQW-
F3ZRU7          -ID---------------LVEIGT----M----LMRHWLWYIVAVALALVLGF-LYIKS-
A0A1C5Q1F3      -LH---------------VGDWLH----I----ALANWKWFVLSLVVCMGASF-WYIKR-
R7A239          -LH---------------VGDWLH----I----ALANWKWFVLSLVVCMGASF-WYIKR-
A0A3R6HIK7      -LN---------------LWDLFQ----I----FKANWYWFVLSVILCVGAGY-LYLLQ-
K5ZVW7          -LN---------------LWDLFQ----I----FKANWYWFVLSVILCVGAGY-LYLLQ-
A0A1Y4D5Z0      -LN---------------LWDLLQ----I----LKANWYWFVLSVVACLGLAY-LYLKQ-
A0A413VXJ7      -IS---------------IADILQ----L----IWSNRYWFALSIILCIGIAF-FYIQS-
I9RSN9          -IN---------------IADILQ----L----IWSNRYWFILSIFLCVGIAF-FYLQS-
U6RJK5          -IN---------------IADILQ----L----IWSNRYWFILSIFLCVGIAF-FYLQS-
A0A1Q6GA32      -IN---------------IADILQ----L----IWSNRYWFILSIFLCVGIAF-FYLQS-
I9RPU6          -IN---------------ITDILH----L----IWVNWYWFVLSVLVCGGIAF-FYLKS-
I8YFS5          -IS---------------IVDIFH----L----VIANWYWFVLSILICAGIAF-FYLKS-
A0A7J4XCM0      -IS---------------IVDIFH----L----VIANWYWFVLSILICAGIAF-FYLKS-
I8Y597          -IS---------------IVDIFH----L----VIANWYWFVLSILICAGIAF-FYLKS-
A0A1Q6GBF5      -IN---------------ITDIFR----F----VLANWYWFVLSVLVCTGIAY-FYVKS-
I8YFZ3          -IN---------------ITDIFH----L----ILVNWYWFVLSVLVCGGVAF-FYLKS-
A0A7J4XFW0      -IN---------------ISDIFH----L----VLANWYWFVLSVLVCGGVAF-FYLKS-
A0A1Q6GDH2      -IN---------------ITDILH----L----IWVNWYWFVLSVLVCGGIAF-FYLKS-
U6RSB0          -IN---------------ITDILH----L----IWVNWYWFVLSVLVCGGIAF-FYLKS-
I9GXM2          -IN---------------ISDIFY----L----VLANWYWFILSVLVCGGVAF-FYLKS-
I9SIK1          -IN---------------ISDIFH----L----ILANWYWFVLSVLVCGGVAF-FYLKS-
A0A7J4XIJ5      -IN---------------ISDIFH----L----ILANWYWFVLSVLVCGGVAC-FYLKS-
I9TP59          -IN---------------ISDIFH----L----VLANWYWFVLSVLVCGGVAF-FYLKS-
R5S343          -LT---------------LRDMIG----I----VWMHKWWFTASLVVCIILAS-GYLMW-
A0A1M6K7I9      -IN---------------IADLLL----I----LRNNWKWFAASIFVCMALAF-VYLKS-
A0A5M6A8C8      -IN---------------IVDLLL----I----LRNNWKWFAASIFVCMALAF-VYLKS-
A0A7J4XCJ1      -IN---------------LIDIFR----L----IFVNWYWFVLSVLICIGFAF-FYLKS-
A0A7J4XNQ7      -IS---------------IVDIFH----L----VLANWHWFTLSILVCVGIAF-FYLKS-
A0A3R5ZMK1      -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGAAF-LYLKW-
A0A7K1HMX0      -LN---------------LEDILQ----V----VLANWHWFVLSVVVCAGAAF-LYLKW-
A0A1Y3ZIA4      -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGAAF-LYLKW-
K5Y1A4          -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGAAF-LYLKW-
A0A7K1HDC0      -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGTAF-LYLKW-
A0A3R6K8X4      -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGTAF-LYLKW-
A0A6N8D6C8      -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGTTF-LYLKW-
A0A3R6BKI7      -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGAAF-LYLKW-
A0A412M2W1      -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGAAF-LYLKW-
K5ZX55          -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGAAF-LYLKW-
A0A415BDM7      -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGTAF-LYLKW-
A0A1Q6I3T6      -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGTAF-LYLKW-
A0A414XX40      -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGTAF-LYLKW-
A7AEU7          -LN---------------LGDILQ----T----VLANWYWFVLSVVVCAGTAF-LYLKW-
A0A5F0U645      -LN---------------LIDMYR----V----VRANWYWFLLSVAVCCAVAV-LYLGW-
K5ZBN2          -LN---------------LIDMYR----V----VRANWYWFLLSVAVCCAVAA-LYLGW-
A0A0J6CKW3      -LN---------------LIDMYR----V----VRANWYWFLLSVAVCCAVAV-LYLGW-
A0A0F5IQM7      -LN---------------LIDMYR----V----VRANWYWFLLSVAVCCAVAV-LYLGW-
A0A496CDT3      -LN---------------LIDIYR----V----VRANWYWFLLSVAVCCAVAV-LYLGW-
A0A6G1ZKM3      -LN---------------LIDMYR----V----VRANWYWFLLSVAVCCAVAV-LYLGW-
S0GLB0          -LN---------------LIDMYR----V----VRANWYWFLLSVAVCCAVAV-LYLGW-
A0A3R6NLC1      -LN---------------LIDIYR----V----VRANWYWYLLSVVVCCAIAV-LYLGW-
A0A416WYC9      -LN---------------LIDIYR----V----VRANWYWYLLSVVVCCAIAV-LYLGW-
A0A7W7AX81      -LN---------------LIDIYR----V----VRANWYWYLLSVVVCCAIAV-LYLGW-
A0A0F5IT40      -LN---------------LSDLFH----I----VLANWYWFVLSVLVCAGVAV-LYLKW-
A0A496CX20      -LN---------------LSDLFH----I----VLANWYWFVLSVLVCAGVAV-LYLKW-
A0A5F0UBI0      -LN---------------LSDLFH----I----VLANWYWFVLSVLVCAGVAV-LYLKW-
A0A6G1ZHG0      -LN---------------LSDLFH----I----VLANWYWFVLSVLVCAGVAV-LYLKW-
S0GSI7          -LN---------------LSDLFH----I----VLANWYWFVLSVLVCAGVAV-LYLKW-
K5YB65          -LN---------------LSDLFH----I----VLANWYWFVLSVLVCAGVAV-LYLKW-
A0A0F5IWP9      -LN---------------LKDLFH----I----VLANWYWFLLSVLICCGAAF-LYLKW-
A0A0F5IZT8      -LN---------------LKDLFH----I----VLANWYWFLLSVLICCGAAF-LYLKW-
A0A417LKQ2      -LN---------------LRDLFN----I----VRANWYWFLLSVLLCSGAAF-LYLKW-
A0A416TME1      -LN---------------LNDLFH----I----VLANWYWFLLSTLFCCGVAF-LYLKW-
A0A7W7F3X3      -LN---------------LNDLFH----I----VLANWYWFLLSTLFCCGVAF-LYLKW-
A0A416XPE8      -LN---------------LNDLFH----I----VLANWYWFLLSTLFCCGVAF-LYLKW-
A0A3B0C2S4      -TE---------------ESVNLWEVAQK----YLRYWPWFVLGILICLGGAY-AYMRY-
A0A5M8NYX7      -GS---------------LADIFF----H----YLNYWKWFVASLFVCLLISF-IYLRY-
A0A1M6GR99      -LN---------------IQDIFK----L----FFKNIWIVISCIIVALGIAY-FYNWY-
A0A7C5M4P4      -LD---------------FTKLLI----V----LRKSIPWLLLLLLGCLTAGY-LVYRY-
A0A1W2GF52      -FE---------------K--FRQ----V----FASGWPWVLGILITTMSLSF-LYMRY-
A0A2G5L7B8      -FD---------------K--LNQ----V----FIKNLPWIILILILFNAGTF-LYLRY-
A0A2D8JJW3      -FS---------------IYDFLY----F----LKRNYIYILIITLFCFLVGC-FLTLR-
A0A6B5PK86      -YD---------------SLLFRT----V----LRRFWWLVPIFMAFFFFVAI-IYLRY-
A0A2G2F510      -YD---------------PLILRT----I----LKRYWWWPLTFILLFSALAF-TYLRY-
A0A316JZ08      -YD---------------PLILRT----I----VRRYWLWVLGFVGIFVVLAY-FYLRY-
A0A2W1NDY9      -ID---------------IDILKT----V----FKKNWIWLLLCVIIGVSIAF-VYLRY-
A0A5C8AQR5      -YN---------------PHILSS----V----LRRNWYWPLAFIFLFFCFAF-LYLRY-
A0A1G0CI31      -YN---------------PLIAAT----I----VKRYWWWTLLFVTCFTAIAF-VYLRY-
A0A556N0M0      -YN---------------PIIVNV----V----LRRYWWWVLLLILFFLGVAF-FYLRY-
F2IKD6          -YN---------------PIIAQV----I----LRRYWWWVLLLIIFFMSVAF-FYLRY-
A0A1I7BM74      -FD---------------LDIIRN----V----LKKNFLFALLIIAFFGALSF-LYLRY-
A0A2G2FJ17      -FD---------------TDILRI----V----IRKNWIWLMLIATILLSSAF-LYLRY-
A0A1H4ADG3      -FD---------------FTKIFH----R----IRANWYYCVICAIVMVGLAG-IYLYV-
A0A5B8VUR8      -FD---------------FTKVIQ----R----IRANWLYAVLSAILMVVLAV-IYLYV-
A0A1V5IPN7      -IK---------------ISDYLR----I----LLQYRYLIILIFVVVLAGTI-IYTLR-
A0A7G7G5F9      -VN---------------LKNVIS----K----YLKYWPLFAASIVLCLCLAY-AYLLY-
A0A2N3U785      -FD---------------LRGVLT----K----YLRYWYLFAATLLLSLAGAY-TYLRY-
A0A0D3L8Q3      -IN---------------FKEIIL----K----YLRYWYLFLLGTIICFGLAY-LYLRY-
A0A519U664      -KD---------------FKRIIS----Q----YSRYWYLFVLGASIGLGIAY-LYLRFY
A0A519MA34      -KD---------------FRRMIH----Q----YTRYWYLFVLGAALGLGAAY-FYLRYY
A0A519UCX0      -RD---------------FKRVLQ----Q----YSRFWYLFVLGAILGSGAAY-LYLRFY
A0A5B6TJH8      -ND---------------IRNTFI----Q----YSRYWYLFLLGALLSVGAAF-MYLRYH
A0A7Y0AA98      -VD---------------IKRILL----R----YIRYWYLFLLGATISLTVAY-LYLKYY
A0A0E3ZG78      -KD---------------IRRILL----N----YLRYWYLFLIGAALGLCGAF-LYLRYY
A0A1I6BRK6      -GD---------------LKNIVL----Q----YTRYWYLFLLGAVLSISVAF-FYLRYY
A0A243WAB1      -KD---------------IKRMVG----Q----YIRYWYLFLLGGMIGLGITY-FYLRYY
A0A6G8C8X6      -KD---------------IRGLIQ----Q----YVRYWPLLLLGTTLGLATAF-LYLRYY
A0A4R5DL69      ------------------LTQTIR----R----LISLWPWLILSQIFSLLASF-IYLRY-
A0A1M4YED3      -NI---------------LSILQF----R----FAPYWPLFIILAIISGVASY-LYLKY-
A0A7T9DAA2      -ID---------------LKAIFG----K----LLKVWWLFVITVGLAVAAAY-AKYKT-
A0A7Y5V8S3      -ID---------------LRAIFR----K----LVAKWWLFLITLGIAGAGAV-AYLKT-
A0A126PFG0      -LN---------------LRAVLA----R----YRYHWSLFVAGVALALLGAY-LYTQL-
A0A7V5VRT5      -WD---------------FRRILI----V----LTRRWWIPVSMILLSFLAVR-LYLRY-
A0A3M1N7Z3      -WD---------------LRRVLI----V----LSREWWWPTLSVLFAAFTAW-AYLRY-
A0A7V1R2A1      -WD---------------VRRVLI----V----LSREWWWPTLSVLFAAFTAW-AYLRY-
A6EBM4          -VD---------------LLKITM----V----LFSRWYIIASTTLICLIAAY-AYLWY-
A0A7X8C760      -FD---------------FQKWLH----L----FIKNWYLFLIFIPAFLIGGY-LKNRS-
A0A501VZX6      -NI---------------FSSLLY----K----YLPYWPLFALLLLISCLGTW-GYLRYF
A0A399SH26      -NL---------------LTVLLR----K----FLPYWPVFIGLAILSMALAW-VYLRY-
A0A501W1A9      -NL---------------FGAIVF----R----FLPFWPLFVVLIGVCLAGAW-AYLHYV
A0A0E3ZGV6      -NL---------------VASLVY----K----FLPFWPLFVVLFILSVAGAW-AYLKFY
A0A1I2N4S1      -NL---------------AVALLY----K----FLPFWPLFLVLLLLGMAGAW-AYIKYY
A0A2T5YE44      -NL---------------AVALLY----K----FLPFWPLFLVLLVLGMAGAW-AYIKYY
A0A4Q8RX32      -DD---------------FNVIFR----K----LAKYWKVFPISILFFVSLGV-IYNKL-
A0A1M6TTV4      -LD---------------FDKIKQ----V----FVKNVIWMLLILLLINASTV-LYVRY-
K0X1U5          -ID---------------IVALWR----A----ACRKWYLFAGSVVVCVALVV-CYLKI-
R5EXK3          -ID---------------IVALWR----A----ACRKWYLFVGSIVVCVALVV-CYLKI-
A0A401UAP7      -ID---------------FSKLKS----I----LLKNTVWILLLFILCNLSAY-LYIRY-
A0A523GAC0      -ID---------------IEKLHT----V----LGKSWLWIMLIVLSTNLTAY-LVIRW-
L8JW09          -ID---------------LDKALT----V----LRKSIPWILLIFIVTNLSAY-LYIRW-
A0A364XUP5      -ID---------------INKLRV----T----IWDNILWILLIFVVTNTAAY-LVIRY-
A0A1M5RLA9      -LD---------------LNKLKT----T----LKRNWLWLIILFLVINSVAY-LKVRY-
A0A385SFR9      -LD---------------LNKLKI----I----FKRNWLWLVVLFLVINSIAY-LKVRY-
A0A5M4A9J4      -ID---------------FKKYFF----L----FLSNWYWFVLAVFFTIGAAW-VYHRF-
A0A5M4B1C7      -ID---------------FRKYFS----I----YRSYWYVFALTAGIALITAW-FYHKL-
A0A0D3LFR6      -ID---------------FDKLFS----V----LKKSLPIIVVIFLVCNMGAY-LYIRY-
M7N6D4          -ID---------------FDKLYN----V----MKKSLPIIIVIFLVCNLSAY-LYLRY-
A0A5C7MX19      --------------------------------------LWIIVLTIITIIISL-VYLRY-
A0A1M5BA90      -NA---------------VEAFMY----R----YLPYWPLFALLLILAGTAAY-MYLHYI
A0A512B879      -GV---------------VERFIY----S----YLPYWPLFALLLVVFLVAGS-FYL-YL
A0A559PPI3      -NL---------------FSSMMD----L----FFPFWPLLAVILVVVLFLAW-GYKNYA
A0A1T5CS78      -NL---------------FRYIIK----T----FFPFWPLFLVLVVVCVLGAW-GYLKYV
A0A0Q9Z8F1      -NL---------------FRYIIK----T----FFPFWPLFLVLVVVCILAAW-GYLKYA
A0A2N0U0M7      -NL---------------FRYIIK----T----FFPFWPLFLVLIVVCILAAW-GYLKYA
A0A1Q3ZMZ7      --------------------------------------------------MGY-IYLRY-
A0A7Y3KMD1      -FD---------------LGLFSL----I----ARRNLKWVGLIFIVGAILAF-VYLRY-
A0A3C1ITV0      -FQ---------------LSDMIS----W----TLCHKKFFAISIVICVALGL-IYAQR-
R7HN19          -FQ---------------LSDMIS----W----TLCHKKFFAISIVICVALGL-IYAQR-
A0A2W2AFF7      -LN---------------VHKLIG----I----VMSHWVWFAVSLFLTLILSF-VLLRY-
A0A845PZ37      -IN---------------VLDLLK----Y----LLHHWKWFAFSILVFGTFAY-YQYSK-
A0A077ENE7      -IN---------------LLDILK----Y----LLHHWKWFVLSILIFGGYYY-YQYSK-
A0A854FRG7      -IN---------------VLDLLK----Y----LLHHWKWFALSILIFGGYFY-YQYSK-
T0NN57          -IN---------------VLDLLK----Y----LLHHWKWFALSILIFGGYFY-YQYSK-
R7PCR1          -IN---------------FQQIIGICIVI----LQKHWMWFLTSVVLFVVLAF-VYSRT-
A0A2N5YXE2      -FD---------------PRTFFT----I----FKKNFWLILIIFVVSLAAGY-AYFRY-
A0A2U1FKU2      -FS---------------VEEFLF----S----LLSSWKWIVGSVVACALIAY-IYVQN-
A0A0A2F954      -FS---------------LEEFFL----G----LLTSWKWIVASVLACLLIAY-IYIQR-
A0A0A2FW91      -FS---------------LEEFFL----G----LLTSWKWIVASVLACLLIAY-IYIQR-
A0A2D2N2N1      -FS---------------LEEFFL----S----LLTSWKWIVASVLACLLIAY-IYIQR-
Q7MWZ2          -FS---------------LEEFFL----S----LLTSWKWIVASVLACLLIAY-IYIQR-
A0A212FSE5      -FS---------------LEEFFL----S----LLTSWKWIVASVLACLLIAY-IYIQR-
T2NDT6          -FS---------------LEEFFL----S----LLTSWKWIVASVLACLLIAY-IYIQR-
A0A1R4AFZ0      -FS---------------LEEFFL----S----LLTSWKWIVASVLACLLIAY-IYIQR-
A0A1R4DVZ7      -FS---------------LEEFFL----S----LLTSWKWIVASVLACLLIAY-IYIQR-
A0A1V9FHD0      -MN---------------IISLAL---NW----YLPYWPLFLILIVLGSAGAL-VYLNFF
A0A4V4H170      -MN---------------IVSVAI---NW----YLPYWPLFLILIVLGLAGAW-AYLKYF
A0A1V9F098      -MN---------------IISVVT---NW----YLPYWPMFLVLLILGLAGAW-AYLKFY
A0A4R2VU64      -MN---------------IISVVT---NW----YLPYWPMFLILLVLGLAIAW-AYLRYF
A0A0K8QSK7      -SM---------------IKPFLL----K----LLGKWYWFVLSVVLFLAAAW-LLTRY-
A0A7C0WKI7      -LE---------------EKPVRLTDYLR----VLYGGKWIIIFSFIIVVAAT-AYFTFT
A0A1T5K9D4      -IN---------------LVDIFF----Y----LLNHWYWFVLCIGLAVAFTS-YRYAK-
A0A5M4B212      -RN---------------YRKYLF----L----LLSHWYWFAIAIVLTSIGTW-LYYRY-
A0A3D1KEX9      -MD---------------IFSILRICVAV----FLRNWKWFLLSVVACLLFAL-LFVKK-
A0A358Y7S2      -FN---------------PLILEE----I----LKRHWRAPIFYSTIFLIFAY-LYIRY-
A0A2J6HHN3      -FD---------------FKLFLY----I----AKRNLKRIILFFIVLFLFLF-LYLRY-
A0A1Y3WMT8      -VD---------------VLALWR----A----ARKRWYLFAGSVFICVVLVA-CYLKI-
A0A1Y4GQU1      -VD---------------VVALWR----A----ICRKWYLFVGSVVVCVALVA-CYLKI-
A0A6A0R272      -LE---------------LANFIN----Q----VKLKLPWLLLFLFIGLSSGY-LVSKY-
A0A1V5W8T5      -FD---------------VSKLIH----I----LRQNFIFYIIFGLIAGISAF-TYLRY-
A0A2T8HKA9      -IN---------------VLDLLK----Y----LFVHWKWFLLSVLFFGGYYY-YQYSK-
A0A1X7J248      -VD---------------FFKLKT----I----LKKNLPWAILLIIIAVFVAF-LYVRY-
E4TQD2          -VD---------------FYKLKT----I----LKKNLPWAILLIAIAVFVAF-IYVRY-
A0A2I0QZ80      -FD---------------TNILKI----V----IKRNWYWCVLIFSLFIVLGF-LYLRY-
A0A3E1F1A3      -LD---------------FKVLKI----V----IKRNWYWCVLISLILGILAF-SYVRY-
A0A2U2XBJ3      -FD---------------LKVLKI----V----IKRNWYWCALISILLVVSAF-IYVRY-
A0A4Q4KU94      -FD---------------LKVLKI----V----IKRNWYWCAIISILFFVFAF-IYVRY-
A0A3B8INU3      -ID---------------TEKIAS----V----LRRSIVWVVLIIVGAVASAY-LVVRY-
A0A7V6V2N8      -FN---------------PYIFKI----V----FKKNLWLLLLYLFVTLFIVF-ASIRY-
A0A414ZBF2      -TV---------------MADMIG----V----LAHHRKWFILSVAVCLLVGF-IYVRS-
A0A7X9D3Q8      -SS---------------LAKLFS----T----VLFHRKWFILSVLICGLIGF-LYVRS-
A0A1Q3Q573      -FN---------------LGLLIY----I----LNKSILWIILIVAITVFASF-IYLRY-
A0A662BAY3      -YE---------------IKKILK----R----LLSYWYWFLICIILAVSIAY-VYNRY-
A0A4U3L369      -FD---------------IKKVIG----N----IIANWYYFVLGLVLMLVLAF-LYVRY-
A0A4S8HY23      -MN---------------FVSVAI---NW----YLPYWPLFLMLIVFALAGAW-AYLTYY
A0A1V9F383      -KN---------------IGSLIV---NW----YLPYWPLFLILIIVGVGSAW-AYLHFI
G8TRZ6          -KN---------------IGSLII---NW----YLPYWPLFLILTVVGLAAAW-AYINFV
A0A357YNR3      -VD---------------VLSILM----K----YLIHWKWFLVSIFICIFLAV-VYVYF-
A0A7X6YKE8      -VD---------------VLSILM----K----YLIHWKWFLVSIFICIFLAV-VYVYF-
A0A5E8AX52      -LD---------------VEKLLQ----V----VRSSILYVVAIFAVAGTASY-AFLRY-
A0A1V6CN82      -FN---------------YKRLVS----E----LISHWYLFVLFMGIGLAGAW-LYNRY-
A0A1M4XZ45      -ID---------------LKKIIF----K----LLHNWYWFVLSIIVALSLAF-LYNRY-
A0A399D319      -ID---------------LKKIIF----R----FLRNWYWFAFVVAITLGMAF-LYNRY-
A0A7Y1YS85      -FD---------------LREWLR----R----LTQYWWVFILGLMICVPTGY-LYLRY-
F4KK08          -FS---------------LRDILM----I----LKANWLFILLSFLVCLALGF-LYIKS-
A0A7V5VE02      -VT---------------LTELMR----I----MYRGRWVIISCFLAVMALTT-WYTFT-
A0A496LCF9      -FN---------------ILEWIM----R----FIKYWYLFVISVLIFMAVAY-YQNRS-
A0A5P2G2A9      -ID---------------FEKILA----D----IIDHWKWFVIGVVLMIILGL-LYIQH-
A0A3C0ZQC7      -PT---------------FQDYVQ----I----VLRGKWMILASFLLVLAGTA-VFTFT-
A0A3N2N6F7      -IN---------------ISDFLS----L----CVRCWKWFAFSVAACLIIGA-LYVLT-
A0A419VXB7      -QN---------------IKDFLF----K----LLYHWKWFVLTVVVGVGIAF-VFNRY-
A0A1Q6E6I7      -IT---------------LRDIFD----F----IVFNWYWFALSAIAFAGIGI-VYALS-
A0A3B9CNN6      -IT---------------LRDIFD----F----IVFNWYWFALSAIAFAGIGI-VYALS-
R5X290          -IT---------------LRDIFD----F----IVFNWYWFALSAIAFAGIGI-VYALS-
C3J7R8          -IT---------------LSDIGL----I----LRSNWYWFAITLCVAIGGAS-AYLLH-
A0A1G8BVM8      -TA---------------IADLLG----I----LWRNRFWFALSIIIAVSIAV-FYVRS-
A0A1I1FXP9      -IN---------------SDKLLS----I----LNKSLWWIIMFVVVATLGAY-TYVRY-
A0A4P7VVU7      -FN---------------LHDFFI----L----CLNKWKWFVISIIIFLGLGV-LYIMS-
A0A2V1ILM4      -FN---------------LHDFFI----L----CLNKWKWFVISIIIFLGLGV-LYIMS-
A0A3N2L0E8      -FN---------------LHDFFI----L----CLNKWKWFVISIIIFLGLGV-LYIMS-
A0A3N2LFC5      -FN---------------LHDFFI----L----CLNKWKWFVISIIIFLGLGV-LYIMS-
A0A7K3KWJ8      -FN---------------LHDFFI----L----CLNKWKWFVISIIIFLGLGV-LYIMS-
A0A3N4H5N3      -ID---------------LSVVFK----S----LVKHWYLFIICVIIFLGLAF-LYLRI-
A0A2P8EAX2      -ID---------------LFKSVR----L----LLPYWPYIIASILLFVGLSF-LYLKS-
A0A4V2F6N9      -ID---------------LMRSVK----V----VLPFWPYILASILLFVGLSF-LYLKS-
A0A838T9G8      -FN---------------PALLFI----M----IRKSFWWCLLILLLTTFAAF-IYLRY-
A0A3B9FXJ0      -VD---------------LQLLLL----F----TWKNRYIILLIMMLSLLAGY-MVNKY-
A0A848SUJ0      -FN---------------PGLFVH----I----IQKSLKWVLFFLILSTTLSY-IYLRY-
A0A847ALW2      -ID---------------LKKIIF----R----FIHNWYWFLISIVVFIGIAF-MYNMY-
B2RKZ8          -FS---------------IEEYLL----G----LLSSWKWIVGSIIVCLLVAY-IYTQR-
A0A0K2J6Z0      -FS---------------IEEYLL----G----LLSSWKWIVGSIIVCLLVAY-IYTQR-
A0A212GC82      -FS---------------IEEYLL----G----LLSSWKWIVGSIIVCLLVAY-IYTQR-
A0A0E2M2Y7      -FS---------------IEEYLL----G----LLSSWKWIVGSIIVCLLVAY-IYTQR-
A0A829KSZ7      -FS---------------IEEYLL----G----LLSSWKWIVGSIIVCLLVAY-IYTQR-
R5GSU5          -ID---------------WLSIVRACTGT----LRRQWRWFVFSIIVCGCLAF-LYERK-
A0A7X8I6A2      -FD---------------PIVFFK----I----VKKTILPSIAILLIALGIGF-IYLRY-
A0A0A2G557      -IS---------------LSDIFY----L----LRQNWYYFIACLLIALICGY-VYIKS-
A0A1T4PT95      -IS---------------LSDIFY----L----LQQNWYYFIFWLIIALAGGY-IYIKS-
A0A6I6JYY3      -ID---------------LKKLVF----K----LLSNWYWFILCIVVAVGAAF-LYNRY-
A0A651GU15      -FE---------------LGLFLY----I----ARKSLKWIALLAVFTFTFAY-LYLRY-
A1ZKR2          -LD---------------LEKVWE----I----FRKSIIWMLLLPLFTISIGH-LWLRY-
A0A1Q3GX01      -ID---------------LEKIWE----I----LKKSILWMLLLPLLTLSVAH-IWLRY-
A0A349DQI4      -ID---------------LEKIWE----I----LKKSILWMLILPLLTLSVAH-IWLRY-
A0A4P5TMD1      -FN---------------PGLLMI----I----TRKSLIWCILIVLLTVSTSI-LYLRY-
A0A3Q9FR88      -ID---------------FDKLEF----V----IKKKFIWVILILMMAGICAF-LYIRW-
A0A553GEX3      -ID---------------FDKLEF----V----IKKKFIWVILILMMAGMCAF-LYIRW-
A0A150ADJ9      -ID---------------FDKLEY----V----VKKNIVWVLLLISLTTICAY-LYIRW-
A0A7X9P1P7      -ID---------------LDKLEY----V----IKKNIIWALLLISLTTVCAF-LYIRW-
A0A7X8SM94      -LD---------------LDKLEF----V----VKKNLIYIALILILSGIGAF-LYIRW-
A0A1S1Z228      -ID---------------FDKLEY----V----VKKNIIWVILLLMLSGIAAY-LYIRW-
A0A1B1FWQ4      -ID---------------FDKLEF----V----VKKNIIWVILLLILSGVAAY-LYIRW-
A0A7X9Y5D2      -ID---------------FDKLEF----V----VKKNIIWVILLLILSGVASY-LYIRW-
A0A7X8ISG0      -IN---------------FKIIFI----V----LKRYWYVLPALLLIALTISF-LYLRF-
A0A2N3IIZ0      -ID---------------FAKILY----I----LRKNWYWLIVFPLLSVSLAY-LYLRY-
A0A7X8Q7Q7      -FD---------------FKLFLN----I----VKKNIKYILIFFVLVFISTF-IYLRY-
A0A2N2WFW8      -FD---------------FKLFLF----I----ARRNLKFILVFFALLFALIF-MYLRY-
A0A1F3IU95      -FD---------------FKLFLN----I----TRKSLIYIIVFSALLFTAVY-VYLRY-
A0A3D0VUF6      -FD---------------FKLFLN----I----TRKSLIYIIVFSALLFTAVY-VYLRY-
A0A7K3WUF2      -FE---------------LGLFLH----I----LRKNFYLVAIIICVALVGSY-IYLRY-
A0A497D5Z2      -MD---------------VRRLVI----S----VLRNWYWFILAVVVALAIAF-LYNRY-
A0A662B170      -MD---------------VRRLAI----S----VLRNWYWFILAVVVALAIAF-VYNRY-
A0A7X7FWB7      -IN---------------FKIIFI----V----LKRYWYVLPTLILAALITAF-LYLRF-
A0A7X8DM61      -LN---------------FKIVFI----I----LKRFWYVLPTLLLIAIISSF-LYLRF-
A0A3M1CDV2      -LD---------------IGLLID----I----TLKSKWWYVLFFSIAGISVF-LYLRY-
A0A1F3SJM1      -YD---------------PLILRT----I----LRRYWWWPLTFVFIFGLLAF-SYLRY-
A0A2G2EB96      -YD---------------PLILRT----V----LKRYWWWAALLVMAFASFAY-IYLRY-
A0A2G6PRA9      -YD---------------PLILRT----V----LRRYWWWAALLVLTFAACAW-VYLRY-
A0A7Y7A9N2      -YD---------------PLILRT----V----LRRYWWWAALLVLTFAACAW-VYLRY-
A0A6C1QGZ7      -ID---------------IKLFLY----I----AKKNILFPIIFILIAVAGAW-IYLRY-
A0A7W1EH85      -FD---------------IGIIAY----L----FNKSRYLILAFFVLSFIGAF-LYLRY-
A0A2E3XZI5      -FE---------------LGLFLY----L----INKIKWVLITILIIFLLGSR-IYLRY-
A0A6I7QXV0      -FN---------------LSLLVS----I----IRKTFGWFLLILFITVLSVW-LFLRY-
A0A7Y3V126      -LD---------------FQRLLL----V----ADKSIGWVLLFLFVSVISGL-IYLRY-
A0A7Y5C3U1      -LD---------------FQRLLL----V----ADKSKGWVLLFLFVSVISGL-IYLRY-
A0A2M7NLQ9      -FD---------------VSKLIR----V----VKKKLIYVIFLLIICVVASW-IVLRY-
I4AFR0          -FD---------------VSKLIR----V----VKKNIIYVILLLIICVAASW-VVLRY-
A0A2N2Y3E5      -FD---------------IPLFLL----V----FRKSLLYFTIIAVLCGAGAY-AYLRY-
A0A2D9D7T6      -YN---------------PLILGE----I----LRKHWFAPILFIVFFSTVAF-FYLRY-
A0A1F3PPL5      -FD---------------VRIFTY----I----IKKSMFLVAIIMGISIVGAF-LYLRY-
A0A357QK06      -FD---------------VRIFTY----I----IKKSMFLVAIIMGISIVGAF-LYLRY-
A0A7X9JJJ8      -ID---------------PFILWY----I----FKKSIIFSAVIFILAIGAAL-VYLRY-
A0A522EYA6      -FE---------------IGLFIF----L----IKKSFLWIILFFSVSFAAAF-IFLRY-
A0A662AEA4      -FD---------------LQIFLL----I----LKKNVWLTFLFIILSLFGTF-IFLRY-
A0A0S2HYK8      -FD---------------IITFKR----I----LYRSVWIGLFIILLALGAGF-LKIRY-
A0A2N5ZWN6      -FD---------------ITTFKR----I----FIRSFWMGIIIMMLVIGGAF-LKIRY-
A0A2E0FJ09      -FE---------------IGLFLY----L----TRQIWVWMLLIVIVCFGLGF-LYIRY-
A0A1F3FZ62      -FD---------------LGLLFK----I----IQKTILPIFILFIISSTIAF-LYLRY-
A0A1F3K211      -FD---------------LGLLFK----I----IQKTILPIFILFIISSTIAF-LYLRY-
A0A7Y1UDU0      -FD---------------FKLFVT----I----TKKTLPWLLLFIFLGIASAY-VYLKY-
A0A1V6I2U9      -FD---------------ARTFLI----I----FKKNVWVVILLILISLGAGF-AYHRY-
A0A2H0B957      -FD---------------FNISLQ----V----FKKSIILSVLVFILAAVGAF-VYLRY-
A0A1F3CFW6      -FD---------------VNIFLQ----V----FKRSIILSIIIFFAAIVGVY-VYLRY-
A0A2M7E2T8      -FD---------------VNIFLQ----V----FKRSIILSIIIFFAAIVGVY-VYLRY-
A0A2M7NC69      -FD---------------VNIFLQ----V----FKRSIILSIIIFFAAIVGVY-VYLRY-
A0A1F3KLL5      -FD---------------LPIFLM----I----IRKSIWWIVIIFILALFSAF-AFLRY-
A0A359D1M1      -FD---------------LPIFLM----I----IRKSIWWIVIIFILALFSAF-AFLRY-
A0A0F2NS19      -LD---------------IILLLK----V----FKKTFIYFVGIIAICVTLSL-IYLRY-
A0A2A5H8X6      -LD---------------IILLLK----V----FKKTFIYFVGIIAICVTLSL-IYLRY-
A0A2H0GAU8      -LD---------------IILLLK----I----FKRNLFLFIAIITICVVVSF-VYLRY-
A0A2M8FTK1      -LD---------------IILLLK----I----FKRNLFLFIAIITICVVVSF-VYLRY-
A0A2A5B3B0      -SD---------------PILFFH----L----LKQNLLSFAIIIAVCLMGAF-IYLRY-
A0A5C6RXM7      -SD---------------PILLLH----L----LRSHLKWFFVIILFCLLSSY-LYLRY-
A0A7W1FWM4      -FE---------------LGLFIY----I----AQKSILWVLLFFALAFSAAY-IYLRY-
A0A7T9QP55      -FD---------------LGLFIY----I----VRRSLIWIGMCLLLAFSAAY-LYLRY-
A0A7V9MK11      -FE---------------FGLFLI----I----IRKNLIWLATFIFLAALCAF-IYLRY-
A0A1F3C1M2      -FD---------------IGLFVY----I----VKKSLILIGLLIGIAAVSVF-AYLRY-
A0A1F3DS87      -FD---------------FALFIY----I----IKKSAILIGLLIGIAIFSVF-AYLRY-
A0A7Y5QSG1      -FD---------------LGLFLY----I----IRRSTVWIMLCILLSGAAAY-LYLRY-
A0A7Y2EX06      -FE---------------FGLFFY----I----FRRTIPIILLIITLSGLAAY-FYLKY-
A0A7Y7NV14      -LD---------------FKLFFF----I----AKKNIFIAFFIISIAIITAF-IYLRY-
A0A6A0R6K9      -FD---------------IGLFIY----I----TKKNSLWILLTIILMVLAAF-LYLRY-
A0A2E7CT70      -FE---------------IGLFLY----L----LKKSRFTIILILLSAFSLGF-LYLRY-
A0A2D5V560      -FE---------------LGLFLY----L----LNKIKWYAITLIILCITSAF-IYIRY-
A0A2D7K5A8      -FE---------------LGLFLY----L----LNKIKWYSIIIIIISISLAF-LYLRY-
A0A2E1XQ82      -FE---------------LGLFLY----L----LNKIKWYAIIILIISISLAF-LYLRY-
A0A1F3K695      -FD---------------LGLFLF----V----FRKSILLIGIFLFLIVAVMY-AYLRY-
A0A353KZR1      -FD---------------LGLFLF----V----FRKSILLIGIFLFLIVAVMY-AYLRY-
A0A2N2WYB5      -FD---------------FAIFMQ----I----LKKSLWVSIVLILLSFFAAF-LYLRY-
A0A1F3K4G0      -FD---------------LAIFLQ----I----VRKNYWAPILFVAVSFVASF-LYLRY-
A0A356H8Y3      -FD---------------LAIFLQ----I----VRKNYWAPILFVAVSFVASF-LYLRY-
A0A351HSA6      -FD---------------LAIFLQ----I----VRKNYWAPILFVAVSFVASF-LYLRY-
A0A2A4PYG9      -FD---------------LGVFIG----I----LKKQFKWIVLFFLLAGIGAF-LYLRY-
A0A350JJ90      -FD---------------LGLLLM----I----TSKSLIWIVSIILLLGGLAF-TYVYY-
A0A2A4YXP3      -SD---------------PILFFH----L----LKRNLLLFAVIIICCLLVSL-VYLRY-
A0A1F3R158      -LD---------------IILLLQ----I----FKKNLLLFIAIIITTSIVAF-IYLRY-
A0A2M8ADX2      -LD---------------IILLLQ----I----FKRNLFLFAAIILACAVISF-IYLRY-
A0A1J5B2H0      -ID---------------PKLFLF----L----VKRNLLLFAILFIMAIAGSY-IYLRY-
A0A1V5N756      -FD---------------LKLLLS----I----VKKNIPYVLIIFAFFFTLAF-LYLRY-
A0A4P5U6G4      -FN---------------PGLLFI----I----IKKSFIWCVLIVLITMSSSL-LYLRY-
A0A2E2TFD1      -FE---------------IGLFIH----L----IQKSFIWILLFVSLAFGGAY-LYLRY-
A0A2E4ELE6      -FE---------------IGLFVH----L----AQKSLLFVLAFFVIAFISSS-LYLRY-
A0A2A3UE91      -FD---------------IGVIAF----L----FMKSRIYIVLFFVISFSLAF-LYLRY-
A0A7V9SRJ9      -FD---------------IGVIAF----L----FNKSKFFIALFFIISFLSAF-LYLRY-
A0A2E6SYP1      -FD---------------LGLALL----I----IRRNLFLTILLILMGAGFAF-FVNRY-
A0A2E5RLE8      -FD---------------LGLAIL----I----IRKNLISILFSISIGFCVAF-FINRY-
A0A2E7TQF6      -FD---------------LGLAIL----I----IRKNLISILFSISIGFCVAF-FINRY-
A0A2E6GVY9      -FD---------------LSLAIL----I----IRKNLLFIVLSIFLGFCIAF-FINRY-
A0A2A5FYT6      -FD---------------FGLLLY----I----TQRNIFWIIAILIVAGTAAY-FYIRY-
A0A6N9NIX1      -FD---------------LGLLLF----I----LRKNLVWIAVILLISFIAIF-LTLRY-
A0A1F3Q014      -FE---------------LGLFIF----I----ARKSFFWIILFFILAFLGAS-AYLRY-
A0A2D5KD44      -FD---------------LGLFLY----I----IKKNLLWVMLTIGMSILGSF-LYIRY-
A0A7Y2F301      -FE---------------FGLFLH----I----FRVSLPIVISLFIIFGVGAW-LYLRY-
A0A0E3V905      -NI---------------RALLS-----K----YSKLWPWFILSTVLMLAIGH-IYISN-
A0A553ETH6      -QA-------------------------V----LKKNWIWIVIIFVISITSAY-LVIRW-
A0A2D4ZVH1      -DL---------------IKVFN-----I----LLLHKWALIGITVLFTVVAI-IFAQL-
A0A6P1P355      -SL---------------FDSLAH----K----YVPYWPLFLLLFIFAMAGAW-AYLQYL
A0A3D0MYJ7      -ND---------------IRFYFF----S----ILKYKYIILITTIVGFLVAF-FFARS-
A0A4Q5WS95      -PF---------------VEAFVY----R----YLPYWPLFAILAIFFTALSV-GYLRY-
A0A7V9RTA1      -TF---------------FEDFSY----K----YLPFWPLFIFFLIVLLVGAW-VYLRY-
A0A5C8KAD6      --M---------------FLDLVY----K----FTPYWPLFLTLLVISCMAGW-AYLNYY
A0A5N1J695      -SM---------------FSSLMF----R----FLPYWPLFAGLLVVSLFGAW-GYLRYL
L8JI02          -NI---------------KGIVL-----Y----LLSKWHYFVFAAIFLLPGAY-LYTKY-
A0A1Q3PII2      -TA---------------NPLWK-----T----VRYHWYWFAISPLLSLLLAW-AFLRY-
A0A351BXT2      -NF---------------KIYLN-----I----LRMNLIPMTIITLLCILLTI-VYVMY-
A0A2K8Z965      -NL---------------RNLIS-----R----YIKRWPWFVVSIGLMLAGAY-IYLLD-
A0A418M8U8      -RV---------------SDLLP-----K----FTRNWPWILFSVCVFLVAAY-TYLAY-
I2GTA4          -RV---------------SDLLP-----K----FTRNWPWILFSVCVFLVAAY-TYLAY-
A0A2K8ZAJ2      -YN---------------LGTLLI----R----YVRNWPWFMLSILLAQAAAY-IYLLY-
A0A368JPA3      -DG---------------QGTLK-----D----YLKHWKWFLISLITLIVAGF-VYIWF-
A0A5N1JI29      -DA---------------KGTLK-----D----YLKHWKWFLISLIALIVAGF-VYIWF-
A0A7K0EGC9      -DV---------------RGTLK-----D----YLKHWKWFLTSLITMIVAGF-VYIWF-
A0A3P1BT12      -DV---------------PGTLK-----D----YLKHWKWFLISLITMIVAGF-VYIWF-
A0A3P1CI15      -DG---------------KGTLK-----D----YLKHWKWILISLIAMLVAGF-VYIWF-
A0A4R8CUK1      ------------------RGAWQ-----D----YLKQWEWFLLSLITMLVAGF-VYIGF-
A0A7Y6XX71      -DL---------------SQYLW-----V----IKRYKWQILGLAVISTLLVA-LIVLS-
A0A2H3NSN0      -DL---------------NTIWH-----T----IKRGKWIILGTCLAMIAAFA-GYTFM-
A0A800J4N3      -GYYGPSRRPPSDFANQLRDWID-----V----VVRGRWWILAAVVAVGIPVT-LYALL-
A0A2P6C324      -DL---------------GALWE-----A----VKRSKWVILGTCVFVTALTA-AVTMM-
A0A7V2F6E1      -NF---------------AEIWH-----T----IRRGKWLILLTTLIVAGVVT-IYTYS-
A0A1M6XHU0      -NF---------------AEIWH-----T----IRRGKWIILLTTLVVAGVIG-AYTYT-
G2SF81          -NF---------------AEIWH-----T----IRRGKWIILLTTLVVAGIIG-AYTYT-
A0A5S9EYW1      -NF---------------AEIWH-----T----IRRGKWIILLTTLVVAGAIG-AYTYT-
D0MHQ9          -NF---------------AEIWH-----T----IRRGKWIILLTMLVVAGAIG-AYTYT-
A0A662AH13      -SL---------------KDYIN-----L----IKLNLIPILLITITGLIVSI-IFALM-
A0A5C7QA01      -DL---------------KELFF-----S----LIAQWKLIALCVFLSLVCAL-LYLRV-
A0A3D3LS70      -NL---------------HLFLN-----L----VKSNWILILIVFIISAVFTG-LYVFR-
A0A1G1TM36      -----------------------------------------MVGVALALLAAY-AYNQL-
A0A1G7ZF38      -TK---------------NPFWK-----A----VRYRWYWFLISPLLSVLLGF-TFLRY-
C6VS52          -AN---------------HPLWK-----A----IQFRWYWLVVSPIVSLLLGT-AFLRY-
                                                                            

A0A7V5RJC2      EKPVYETTAVIQFQTY-SGG---------------------------------------I
A0A7C1LGX3      TAKIYESVAKIKIVDN-STD--------------------IGLQSNAMSLFTN------G
A0A1T5MMH4      TQDRYESFSEIKLDVK-DEA--------------------------SELGISILAGKDQQ
A0A2W4R1L8      SPDLYESHSEIKLDIR-NEA--------------------------TELGINRLV--EDQ
A0A7L9BFB6      TKDLYESVSEIKLDVK-QDA--------------------------TELGIREII-PERQ
A0A5C8A5B4      TPKKFDVGAVMLLGNKKRTG-------------------------FSENSEFIKGTSYLS
A0A2E5CV79      IHPVYRSTSSIIIKEKPGTS--------------------------------MIMQYGSR
A0A2A4G4B1      VNPKFRVETSVLLKSV-TNS------------------------IPDELSVFDDLGMVSG
A0A0P7X1V8      QIPIFESNGSLQITEA-GNR--------------------YSMAGSDLSNLMVSNFGI-G
A0A4Y9ITE2      KSPVYEVQANVLITDNDTKS--------------------DFLRSFSMADMF-------G
A0A3N2M1H3      QQPEYQRTEEVLIKDQ-EGG--------------------SGV--PDMAGVFSSF-GLVS
A0A4S2G8T2      QQPEYQRTEEVLIKDQ-EGG--------------------SGV--PDMAGVFSSF-GLVS
A0A212K7W5      TSPVYTRMAAVLIKDN-SAK--------------------GGML-SDNINTFSDM-GLFK
F5IU11          TPPVYTRMAAVLIKDN-SAK--------------------GGML-SDNINTFSDM-GLFK
A0A7C1QWC7      APTIYQVNSTIGPVEE-SRS--------------------SFLE---SAERFSGL-AELD
A0A7Z8P8P1      LVPVYQRQAVMLVKTG-GKT--------------------ANSDISAMLELQGGV-----
K0XJ09          QTPLYKRSAVMLVKSE-NKS--------------------GN-DMSAVLELNGGI-----
R5EUZ0          QTPLYKRSAVMLVKSE-NKS--------------------GN-DMSAVLELNGGI-----
W0EQS0          QTPLYKRTAVMLVKSE-NKS--------------------SN-DMSAILEMNGGV-----
A0A1Y3WE15      QTPLYKRSAVMLVKAE-NKS--------------------NN-DMSAIMELNGGI-----
A0A1Y4GUK3      QTPLYKRSAVMLVKAE-NKS--------------------NN-DMSALLELNGGI-----
A0A352Z1R7      MKPIYEASSTLHIKKE-RGQ--------------------GVLV---------DM--TFD
A0A7X7BZF5      SEPQYTRTATIHIKDD-SKG--------------------GSID-NSL-DAFTDL-GLTQ
A0A0A2F501      TPPVYKRTATLLIKDD-SKG--------------------KGLS-LNDQFSFGDM-GLLQ
R5B7P0          STPTYNTSADIQIKSN-TKG--------------------ASMP-GDI-GEFGNM-GLFA
R5B0L5          TPSMYTRSASIVIKSS-SQG--------------------ASIS-----DTFAEM-GLVQ
A0A6I1TEC0      TPNVYQRTASLLIKDE-SKG--------------------SSIN-NDVESMFSDM-GLGG
A0A3R5XWG1      TPNVYQRTASLLIKDE-SKG--------------------SSIN-NDVESMFSDM-GLGG
A0A5P0Y910      TPNVYQRTASLLIKDE-SKG--------------------SSIN-NDVESMFSDM-GLGG
A0A414YFM3      TPNVYQRTASLLIKDE-SKG--------------------SSIN-NDVESMFSDM-GLGG
A0A6A7UIA7      TPNVYQRTASLLIKDE-SKG--------------------SSIN-NDVESMFSDM-GLGG
A0A6A7VPS3      TPNVYQRTASLLIKDE-SKG--------------------SSIN-NDVESMFSDM-GLGG
A0A374THP7      TPNVYQRTASLMIKDD-SKS--------------------QGIS-SDVSSMFADM-GLGN
A0A6G1VND1      TPNVYQRTASLMIKDD-SKS--------------------QGIS-SDVSSMFADM-GLGN
A0A0A2EVS5      TPVEYKRSASILIKES-DKP--------------------GASL-AQDIGGFADM-GLFS
A0A1T4NAJ7      TPVEYKRSASILIKES-DKP--------------------GASL-AQDIGGFADM-GLFS
A0A255T941      TPNIYTRTASILIKED-AKG--------------------KSSN-LI--SDFADMGGLFK
A0A4P7VSV0      TPKVYTTTASIMIKDE-AAG--------------------KSAG-A---EDFGDF-GLFQ
A0A7J0AX49      TPKVYTTTASIMIKDE-AAG--------------------KSAG-A---EDFGDF-GLFQ
A0A3N2KCL3      TPKVYTTTASIMIKDE-AAG--------------------KSAG-A---EDFGDF-GLFQ
A0A2V1IJY1      TPKVYTTTASIMIKDE-AAG--------------------KSAG-A---EDFGDF-GLFQ
A0A4P7VXK7      TPKVYTTTASIMIKDE-AAG--------------------KSAG-A---EDFGDF-GLFQ
A0A1Y4CHN5      TPPEYTRSASMLIKEE-GKG--------------------QSIS-SDVSSAFASM-GLVQ
A0A7Y5JED7      TPNVYTRSASILVKDD-SKG--------------------GSAS-SALSNDFADL-GMFK
A0A1M6I2S6      TPNIYTRTAAILVKDD-TKS--------------------GSST-TM--SEFSDL-GIFK
A0A1Y3V692      TPNIYTRTAAILVKDD-TKS--------------------GSST-TM--SEFSDL-GIFK
F3PXM2          TPAIYTRHAAILVKDD-SKG--------------------GATS-GSM-GEFADF-GLFK
A0A174JCE8      TPNIYTRTAVILIKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A3E4JMC4      TPNIYTRTAVILIKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A412SND6      TPNIYTRTAVILIKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A414IEQ9      TPNIYTRTAVILIKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A7K0HNT3      TPNIYTRTAVILIKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A0M1W8D8      TPNIYTRTAVILIKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A3R6GKX5      TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A7V4S1          TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
B0NU19          TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
D4V601          TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A0A4Q0U3M9      TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A0A7J5G2G2      TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A0A7J5HH13      TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A0A397WLT5      TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A0A6N8DDD8      TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A0A6A2J529      TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A0A7S9QIA5      TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A0A015XH67      TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A0A078RZN2      TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A6L0K5          TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A7ACT5          TPNVYTRTAAILIKDD-SKN--------------------NSPA-SAM-NEFADM-GIFK
A6KY94          TPNVYTRTAAILVKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A173UQR8      TPNVYTRTAAILVKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A3R6HK75      TPNVYTRTAAILVKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A412B7D1      TPNVYTRTAAILVKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A412VNY9      TPNVYTRTAAILVKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A414LTU9      TPNVYTRTAAILVKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A8B2YHC3      TPNVYTRTAAILVKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
I9Q4U4          TPNVYTRTAAILVKDD-SKN--------------------NSSA-SAM-NEFADM-GIFK
A0A373ISF0      TPSIYTRSAAILVKDD-SNS--------------------GSSG-GAM-SEFSDM-GIFR
U6RF62          TPSIYTRSAAILVKDD-SKS--------------------GSSG-GAM-SEFSDM-GIFR
A0A662ZZD5      TPNIYTRTAAILVKDD-SKG--------------------GTST-NVV-SEFSDL-GIFK
A0A415NEB6      TPNIYTRTAAILVKDD-SKG--------------------GTST-NAV-SEFSDL-GIFK
A7AJ60          TPNIYTRTAAILVKDD-SKG--------------------GTST-NVV-SEFSDL-GIFK
A0A6A2JF01      TPNIYTRTAAILVKDD-SKG--------------------GTST-NVV-SEFSDL-GIFK
A0A7J5MKN5      TPNIYTRTAAILVKDD-SKG--------------------GTST-NAV-SEFSDL-GIFK
A0A015UXN7      TPNIYTRTAAILVKDD-SKG--------------------GTST-NVV-SEFSDL-GIFK
A0A642KJV3      TPNIYTRTAAILVKDD-SKG--------------------GTST-NVV-SEFSDL-GIFK
A0A6I2NTL0      TPNIYTRTAAILVKDD-SKG--------------------GTST-NVV-SEFSDL-GIFK
A0A6I2Q447      TPNIYTRTAAILVKDD-SKG--------------------GTST-NVV-SEFSDL-GIFK
A0A016E4F9      TPNIYTRTAAILVKDD-SKS--------------------GSST-NAM-SEFSDL-GIFK
A0A6N3HG44      TPNIYTRTAAILVKDD-SKS--------------------GSST-NAM-SEFSDL-GIFK
A0A7K0HSP7      TPNIYTRTAAILVKDD-SKS--------------------GSST-NAM-SEFSDL-GIFK
A0A7K1HEJ5      TPNIYTRTAAILVKDD-SKS--------------------GSST-NAM-SEFSDL-GIFK
A0A6H9P0U9      TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-NDFSDL-GIFK
A0A108TH71      TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-NDFSDL-GIFK
I8VXH0          TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-NDFSDL-GIFK
A0A412S0N6      TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-NDFSDL-GIFK
A0A412IIJ0      TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-NDFSDL-GIFK
A0A0P0FM97      TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-NDFSDL-GIFK
R6KTP3          TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-NDFSDL-GIFK
A0A139LU87      TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-NDFSDL-GIFK
A0A1C6B3Y5      TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-NDFSDL-GIFK
A0A6L3KCD1      TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-NDFSDL-GIFK
E2NMQ4          TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-NDFSDL-GIFK
A0A412YDB9      TPPIYTRTAAILVKDN-SKS--------------------SSST-SSM-SDFSDL-GIFK
R7DY01          TPPIYTRTAAILVKDN-SKS--------------------SSST-SSM-SDFSDL-GIFK
A0A414LGK8      TPPIYTRTAAILVKDN-SKS--------------------NSST-SSM-SDFSDL-GIFK
A0A415IPQ4      TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-SDFSDL-GIFK
A0A3E5BRW7      TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-SDFSDL-GIFK
K9DXS6          TPPIYTRTAAILVKDN-SKS--------------------SSST-SAM-SDFSDL-GIFK
A0A1M6KFV3      TPPIYTRTAAILVKDN-SKS--------------------NSST-NAM-SDFSDL-GIFK
A0A1Q6G7L3      TPPIYTRTAAILVKDN-SKS--------------------NSST-NAM-SDFSDL-GIFK
A0A413H235      TPPIYTRTAAILVKDN-SKS--------------------NSST-NAM-SDFSDL-GIFK
A0A358R8U0      TPSVYTRSATLLIKEN-TKG--------------------QSLA-SDV-ESFGDL-GLFQ
R6WSB6          TPSVYTRSATLLIKEN-TKG--------------------QSLA-SDV-ESFGDL-GLFQ
A0A401LPX7      TPSVYVRTASILIKDD-SKG--------------------KSSS-ADM-ESFSDL-GLFT
A0A6G0GNY9      TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
A0A6I1BFM0      TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
A0A3A5Z900      TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
A0A7K0GW19      TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
A0A285TGL6      TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
A0A3A5RFX4      TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
A0A1Q6IUW9      TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
A0A413XDP6      TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
A0A6N8CVT6      TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
K6AP24          TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
A0A6I2NHV3      TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
A0A662ZYI7      TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
A0A078RYI7      TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
C7XEQ8          TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
D7INX6          TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
K5ZG55          TPSVYVRTASILIKDD-SKG--------------------KSSS-TDM-ESFSDL-GLFT
A0A7Y5MWI8      TPPVYTRSASLLIKED-SKG--------------------NSLG-DAA-GLMGDF-DLFQ
A0A1M5B2J8      TPPVYTRSASILIKDD-SKG--------------------KSAS-TDM-ESFADF-GIFT
A0A255RCT5      TPPVYTRSASILIKDD-SKG--------------------KSAS-TDM-ESFVDF-GIFT
A0A1Y4GLF5      TPSVYTRTASVLIKED-SKG--------------------NSIS-SGM-ETFSEF-GLFQ
A0A1H3XSC0      TPPVYTQTASVLIKDD-SKG--------------------KSVS-SDL-ESFSEF-GLFQ
A6LE40          TPAVYTRTASVLIKED-SKG--------------------KSVS-SDL-ESFSEF-GLFQ
A0A4Y1VPX5      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDL-ESFSEF-GLFQ
A0A6N2XMM4      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDL-ESFSEF-GLFQ
A0A7U8L0B4      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDL-ESFSEF-GLFQ
B3JI46          TPAVYTRTASVLIKED-SKG--------------------KSVS-SDL-ESFSEF-GLFQ
A0A3N2N9B8      TPTVYTRAAQIMIKDT-SKG--------------------KS---AGMEE-FSDF-GLIS
A0A3N2NMI0      TPDVYTRATEIMIKEP-SKG--------------------KS---AGMEE-FADL-GLIS
A0A359I8H7      QQPVYSRSMELLIKDQ-DGG--------------------GGVA--DISNAFSSL-GLVS
A0A3N2KA63      QQPVYSRSMELLIKDQ-DGG--------------------GGVA--DISNAFSSL-GLVS
A0A4Q0IMT7      QQPVYSRSMELLIKDQ-DGG--------------------GGVA--DISNAFSSL-GLVS
A0A7J0B660      QQPVYSRSMELLIKDQ-DGG--------------------GGVA--DISNAFSSL-GLVS
A0A3B9FAU3      TPNTYQRTALVVIKED-SPQ--------------------RG---KDLNAMFANL-GQNP
A0A3C1E5L7      TPNTYQRTALVVIKED-SPQ--------------------RG---KDLNAMFANL-GQNP
A0A4Q0UAV1      TRPTYVRTITVMFKTE-ESG--------------------NGTL--AMPD-LSAL-GISN
A0A354SN68      KSPVYMRRASVLMKED-NRR--------------------SASI-GNTSGIFNNL-GIGK
A0A6L5XFL0      SQPVYTRQASILIKDE-DNN--------------------SSIS-SQFGQ-FSSM-GIGK
A0A3N2N595      TPKIYTTSASILIKDN-AKS--------------------NTPSMSVGGDEFANM-GLFQ
A0A7J0ACS3      TPNVYSRSAEILIKDD-AKG--------------------N----SAGAEEFANL-GLFQ
A0A0A2DUD9      TPPVYKRTASVMIKAD-DKG--------------------KSLS-NDMSSAFSEL-GLFQ
A0A3P1ZBJ5      TTPVYNRYTTIMIKEN-TKG--------------------GGRS---VEQQLSQL-GLFE
R5FHS9          TPPVYTRTESVVISNS-DDS--------------------RSVSIDDIFSSASSG-GIST
A0A413TW79      TPGVYQRTASILIKED-GKS--------------------QSIN-SDVASMFSDM-GLSG
A0A7K0AAG2      TPSVYQRTASILIKED-GKS--------------------QSIN-SDVASMFSDM-GLSG
A0A7K0ASF1      TPCVYQRTASILIKED-GKS--------------------QSIN-SDVASMFSDM-GLSG
A0A3E5E9M7      TPSVYQRTASILIKED-GKS--------------------QSIN-SDVTSMFSDM-GLSG
A0A3E4SK73      TPSVYQRTAFILIKED-GKS--------------------QSIN-SDVASMFSDM-GLSG
A0A415GGC6      TPSVYQRTASILIKED-GKS--------------------QSIN-SDVASMFSDM-GLSG
A0A413DBH9      TPSVYQRTASILIKED-GKS--------------------QSIN-SDVTSMFSDM-GLSG
A0A495WI87      TPPVYTRSASILIKED-SKG--------------------KSLS-ADAGS-FADL-GLIQ
A0A354M4S6      TPPVYTRSASILIKED-SKG--------------------KSLS-ADAGS-FADL-GLIQ
R7DH52          TPPVYTRSASILIKED-SKG--------------------KSLS-ADAGS-FADL-GLIQ
A0A7J5IAE7      TPQVYTRTASVLIKED-AKG--------------------KSVS-SDMDA-FSDL-GLFQ
A0A016CWA4      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A4P8LP09      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A0M1W0V2      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A139KA16      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A174VQ92      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A1Q6HCG0      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A1Y4JYM9      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A3A5QW67      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A3A5RQE6      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A3A6BP07      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A3E5E153      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A3Q9IP20      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A412WV15      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A413ICP6      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A414KYB9      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A5B3FWR2      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A7J5QHB9      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
E5WX00          TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
K0X3P3          TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A1C6H117      TPAVYTRTASVLIKED-SKG--------------------KSVS-PDLES-FSEF-GLFQ
A0A6I1AQV4      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A5C6L2P1      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A3E4WKT5      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A3A5YY33      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A1E9CFZ7      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A373FYU5      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A3A5XBP2      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A3A6MEG9      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A3E4JP35      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A3E4KP40      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A3E4NX82      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A3E4XFU8      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A412RG70      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A412TD37      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A413GAA4      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A414M7I4      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A496BTA0      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A496D2V6      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A5C6KCA6      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A5M5AHM5      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A6I0Y5K7      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A6I1BFB8      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A6I2P5W5      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A6N8DC51      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A7J5HGP0      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A7J5HVL8      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A7J5JHD3      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A8B3EKM1      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
E5UZA2          TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A069SMG6      PPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
C3RFN5          TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A3A5Z014      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A7J5GD93      TPAVYTRTASVLVKED-SKG--------------------KSFS-SDLES-FSEF-GLFQ
A0A7K0HGR5      TPAVYTRTASVLVKED-SKG--------------------KSFS-SDLES-FSEF-GLFQ
A0A078S3Q8      TPAVYTRTASVLVKED-SKG--------------------KSFS-SDLES-FSEF-GLFQ
A0A069SJV7      TPAVYTRTASVLVKED-SKG--------------------KSFS-SDLES-FSEF-GLFQ
A0A3E5DXI5      TPAVYTRTASVLVKED-SKG--------------------KSFS-SDLES-FSEF-GLFQ
A0A3E5EM98      TPAVYTRTASVLVKED-SKG--------------------KSFS-SDLES-FSEF-GLFQ
A0A6N2YYD4      TPAVYTRTASVLVKED-SKG--------------------KSFS-SDLES-FSEF-GLFQ
I9T3G6          TPAVYTRTASVLVKED-SKG--------------------KSFS-SDLES-FSEF-GLFQ
A0A3E4SYU0      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A6LGY1          TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
K5ZSH4          TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A6A2RTB3      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A7J5PEN4      TPAVYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A1M4YZ07      TPAVYTRTASVLVKED-SKG--------------------KSVS-SDLKS-FSEF-GLFQ
A0A7J5I238      TPTIYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A0P0FQW1      TPTIYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A7K0I229      TPTIYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A5M5C0W6      TPTIYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A642NJ89      TPTIYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A6L3JTQ2      TPTIYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A7J5FQU6      TPTIYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A7J4YLH7      TPTIYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A6N3AEV2      TPTIYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A6G0G4T5      TPTIYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A6L3KG29      TPTIYTRTASVLIKED-SKG--------------------KSVS-SDLES-FSEF-GLFQ
A0A1Y4PQK7      TPPVYTRTAELLVKRE-YRG--------------------RSIA-SDIEG-FDNF-GLFR
A0A1Y4IH41      TPPVYTRTAELLVKRE-YRG--------------------RSIS-SDIEG-FDNF-GLFR
A0A3A6AAP4      TPPVYTRTAELLVKRE-YRG--------------------RSIS-SDIEG-FDNF-GLFR
A0A6I0ZRD2      TPPVYTRTAELLVKRE-YRG--------------------RSIS-SDIEG-FDNF-GLFR
A0A1Y4DYA7      TPPIYTRSASLLIKED-NKS--------------------NSPS-GN-AGVLYDL-DLFQ
A0A1Y3X4I9      TPPVYTRSASLLIKED-SKG--------------------NSLS-NS-AGVLGDL-DLFQ
A0A1Y4FNK8      TPPVYTRSASLLIKED-SKG--------------------NSMS-DA-AGVLGDM-NLFQ
A0A355FD59      TPAVYTRSASLLIKED-SKG--------------------KSMA-GDVSSLFSDL-GLSQ
A0A359CEZ9      TPAVYTRSASLLIKED-SKG--------------------KSMA-GDVSSLFSDL-GLSQ
A0A353Q7B4      TPAVYTRSASLLIKED-SKG--------------------KSMA-GDVSSLFSDL-GLSQ
F8X3A5          TPPIYIRSASILIKED-SKS--------------------QSIS-SDVASMFADF-GLSQ
A0A1M3KVR9      TPPIYIRSASILIKED-SKS--------------------QSIS-SDVASMFADF-GLSQ
A0A4Y9IJS3      TPPIYIRSASILIKED-SKS--------------------QSIS-SDVASMFADF-GLSQ
A0A416GA42      TAPMYQRMATVLIKDK-ESG---T---------RTPSEAE------IFKEVG-----FMN
A0A1T3IYP5      TPFIYNQSEVVMIKTPSNTP---T---------TARITRS-----------------SVA
A0A7Z6RZU4      SPEVGEQKAIVLIKDK-EKT---D---------AAFLEKQ-----------------LFQ
A0A4D7K1D4      IPPLFESSSELKLDVK-DET---S---------VLTFGVD----------------PQKN
A0A846MP44      TKPTYQAEATLKLIPK-IEA---Q---------FSPLGN------------VM----RQE
A0A1G9E2A9      IKPVYESASLLKLEVK-RNA---N---------VL------------FGRNSD----LGS
A0A098LL25      TKPVYESSSILKLDLK-SEA---G---------VLGLNK--------FNDENM----PGN
A0A6J4H627      TSPVYESSSSIKLEIK-QKA---N---------LLGISD-------------------ND
A0A6C0GJI1      TKPLYESSSSIKLEVK-REA---S---------VLGLNG-----------VNA----VED
A0A839GQ17      TKNIYESSSVLKLEEQ-SEA---T---------VLGLGA------------TS----ADA
A0A127B287      TKKVYESSSVIKLEEQ-TEA---K---------VLELPG------------AG----MES
A0A6P1P2P6      TKKVYESSSVIKLEEQ-TEA---K---------VLELPG------------AG----MES
A0A2T2YJE8      TKPLFKSSSTLKIDEQ-SEA---G---------RLGLGG-----------TIE----NQQ
A0A7L7LEW0      TKPLFKSSSTLKIDEQ-SEA---G---------RLGLGG-----------TIE----NQQ
A0A3M9N829      TKKVYESSSTIKLDEQ-SEA---G---------VLGLES----------NGLP----IEA
A0A0P0CSF9      TKKVYESSSTIKLDEQ-SQA---G---------VLGLQN----------SGLK----VES
A0A5M8QQB8      TKKVYESSSTLKLDEQ-SEA---G---------VLGLEN----------NGLK----VES
A0A3M9MNC3      TKKVYESSSTIKLDEQ-SEA---G---------VLGLEN----------NGLK----VES
A0A5B6TAX2      TKKVYESSSTIKLDEQ-SEA---G---------VLGLEN----------NGLT----VES
A0A7L5A132      TPPIYQSSSTLKIDQK-SQS---G---------VLGLESA--------GKAVD----ARQ
A0A512AYT3      TKPVYKSSSIIKIDEQ-SQA---G---------ALGLGGP-------MGDAAS----SQQ
A0A5M6CYN7      TKPIYKSSSIIKIDEQ-SQA---G---------ALGLGGP-------LSD--------QQ
A0A369QP10      TKPLYKSSSTLKIDEQ-SEA---G---------RLGLDG-----------TIE----NQQ
A0A7G7G7M4      TKPLYKSSSTLKIDEE-SEA---G---------RLGLDG-----------TIE----NQQ
A0A126PDF2      TKPVYKSTSLLKIDQR-SEA---G---------VVGLGG--------QLAAAD----PR-
A0A2Z3GKA1      TKPVYKSTSLLKIDQR-SEA---G---------VVGLGG--------QLAAAD----PR-
A0A502GZP7      TKPVYKSTSLLKIDQR-SEA---G---------VVGLGG--------QIAAAG----PSV
A0A0M3RW20      TKPVYKSSSILKIDEK-QEA---G---------TLGLGGG-------LAGP-E----GPL
A0A495VFX4      TRPLYKSSSILKIDEK-QEA---G---------TLGLTGK-------LAVA-E----GPL
A0A246FQC0      TPPLYKSTSALKIDEK-SEA---G---------VLGLGA--------LGGAID----QKK
A0A372E5P8      TPPLYKSSSTLKIDEK-TEA---G---------VLGLGG--------LGGAVE----QKQ
A0A7Y7PLY0      TPPLYKSSSTLKIDEK-TEA---G---------VLGLGG--------LGGAVE----QKQ
A0A1H3EMW1      TPPLYKSTSTLKIDEK-TEA---G---------VLGLGG--------LGAAVE----QKQ
A0A1H9ZSN3      TPPLYKSTSTLKIDEK-TEA---G---------VLGLGS--------LGGAVE----QKQ
A0A7W9SXN1      TPPLYKSTSSIKIDEK-TEA---G---------VLGLEG--------IGGAVE----KQQ
A0A418R9X5      TPPVYRASSTLKIDEK-SEA---G---------VL-LGG--------IGQAAE----QKQ
A0A428JSJ3      TPPLYKASSTLKIDEK-SEA---G---------LL-LGD--------VGQAAE----QKQ
A0A428KI59      TPPLYKASSTLKIDEK-SEA---G---------VL-LGD--------IGQAAE----QKQ
W8F1I6          TPPLYKAASTLKIDEK-SEA---G---------VL-LGD--------IGQAAE----QKQ
A0A1S9B3W0      TKPIYQSSSTIKIDEK-TEA---G---------QLGLLPP---------GAAD----PRQ
A0A1W1VRL3      TKPVYQSSSVLKIDEK-TEA---G---------LLGLGA---------GGSVE----KRR
A0A7G6YQJ9      TPSIYRSSSVLKIDEK-TEA---G---------VLGLGG--------VGEGME----KKQ
A0A1M6R305      TKPVYKSSSLLKIDEK-TEA---G---------ALGLGGA-------LGEGVA----GRQ
A0A7G7W8X3      TKPIYKSSSLLKIDEK-TEA---G---------ALGLGGA-------LGETAG----GRQ
A0A4Z0PHK3      TKPVYKSSSLLKIDEK-TEA---G---------ALGLDGP-------LGQAV-----GAS
A0A2M9B9H9      TKPVYKSSSLLKIDEK-TEA---G---------ILGLDGP-------VGQAV-----GSS
A0A4Z0QCY9      TKPVYKSSSLLKIDEK-TEA---G---------VLGLDGA-------LGQAV-----GAS
A0A7Y0AH93      TKPVYKASSVLKIDEQ-KSA---S---------VLGLGG--------APGSNG----QDG
A0A519SBU8      TKPVYKSASLLKLDEH-SEA---A---------KVGLGG--------LADADA----RNG
A0A4Q3JNZ3      TKPVYKAASLLKLDEH-SEA---D---------KFGIGG--------IKG--E----P-G
A0A519Q9V3      TKPIYKAASILKLDER-SEA---A---------NLGLGA--------AKGGDS----P-S
A0A5N1J2M4      TPKLYDSTSLIKIDEK-KEA---G---------LLGLK---------LGESDK----QRV
A0A519S476      TKPVYQSASLLKLDEK-SEA---A---------NLGL-A--------SVKALD----NTQ
A0A4Q3JRW8      TKPIYKAASVIKLDER-SEA---A---------NLGFGA--------AVKGEE----GAN
A0A519M923      TKPVYRAASLLKLDER-SEA---A---------NLGLGG--------AAKGAD----DGR
A0A4Z0ENW1      TKPIYEATSILKIDDR-SDA---S---------ALGLG---------MAMGGG----DNN
A0A519UDB4      TKPIYRASSILKIDER-SNA---N---------DLGLG---------ELTGRG----NDN
A0A3S0QKV1      TKPVYQSSSTIKIDEK-RQD---A---------ELNLPGL---------VANP-----QQ
A0A328BL48      TKPLYRSSSTIKIDEK-QQA---G---------DLGLLAA---------GAQA----GQQ
A0A5R8WLY4      TKPLYRSSSTIKIDEK-QQA---G---------DLGLLSA---------GAQP----GQQ
A0A1I5WSL8      TKPVYKSQSLLKIDER-NEG---S---------ALGLAGQ-------MAPAAA----DKG
A0A0U3JVM7      TKPVYKSASLLKIDER-NEG---S---------ALGLAGQ------AAAPAVM----DKG
A0A1G1SSV2      TKPVYKSASLLKIDER-NEG---S---------ALGLGGQ-------GAPAVV----PNG
A0A1G1SXV7      TKPVYKSASLLKIDER-NEG---S---------ALGLGGQ-------GASAAL----PNG
A0A6G8CBJ6      TKPVYQSSSVIKIDER-TEA---G---------LLGMGP--------VGGAVE----KRQ
A0A0W8EDI5      TQPVYQSASTLKIDQK-TQS---A---------VLGLGG--------VGGSAE----AQQ
A0A3B7RBP8      TQPIYQSSSTLKIDQK-TQT---A---------VLGLGA--------VGGAAE----AQQ
A0A3R9P8H7      TPPLYQSSSTLKIDEK-TEA---G---------VLGLGG--------LGGAVE----QKQ
A0A238WIA7      TRPVYQSSSVLKIDEK-TEA---G---------VLGLEG--------LGKMVE----QKQ
A0A212UCJ7      TSPVYQSSSTLKIDEK-TEA---G---------VLGLEG--------LGKMVE----QKQ
A0A4Z0MQE1      TSPVYQSTSLLKIDEK-TEA---G---------VLGLEG--------LGK--------AP
A0A4Z0PCF4      TSPVYQSSSVLKIDEK-TEA---G---------VLGLEG--------LGKMVE----QKQ
A0A6M6BED0      TSPVYQSSSTLKIDEK-TEA---G---------VLGLEG--------LGKMVE----QKQ
A0A5D6VDG1      TKPLYKSSSTLKIDEK-EDA---G---------ALGLG---------LGAGAE----ARQ
A0A243WHR7      TKPVYQSLSILKIDEK-TEA---G---------ALGLGGA-------LTGDI------RQ
A0A5B8A0P6      TKPVYKSSSLLKIDER-TEA---G---------ALGL-GA-------LGQG-D----GRQ
A0A076HRT9      TKPVYKSSSLLKIDEK-TEA---G---------TLGLGGA-------M-KEAE----GRQ
A0A4Z0PVM7      TKPVFKSSSLLKIDEK-TEA---G---------ALGLDGP-------LAQAVG----S-S
A0A1M6DHW8      TKPIYKSTSLLKIDEK-TEA---G---------ALGLSGT-------MGKGIE----ERQ
A0A4Q5LC61      TKPVYKSTSLLKIDEK-TEA---G---------ALGLAGP-------LGKGIE----EQQ
A0A060RD97      SPLVFKRQASIMLKDK-SGS---G---------Q--GEAA------IFADLGL----LSS
A0A350IHV0      TAPKYTRTAKVIVDDS-NEN---S---------A-MKELA------SFTNAMS---LRRN
A0A2A8CVM9      VDPVYEAKSIVKIDLG-AQS---G---------P------------------GGM-GAFG
R5RVP0          TASSYTRTAKVMIDDT-NEN---S---------A-LRDLASFTGGVRYRSMNG-------
A0A2L2WX98      QPRIYQRQAVILLEDTDGRS---A---------MGRKASS---SMNTLLELNG-----IS
A0A2E3R1D0      SPSKYRSYAILLVDKT-DTD---L---------ADVLPEA-------MP-----S-GFWR
A0A800J826      QPNVYTATATILVEDN-NDA---Q---------AVLPGTS-------SS-----N-PLIE
A0A2T2USC0      QTPIYESSNLVLVEKQ-QRQ---V---------SSILGEQ-------GSSF---S-PF-G
A0A2T2V0F3      QTPIYETSSLVLVEKQ-GEG---V---------SSILSES-------G-SM---N-PF-G
A0A2T2S682      RTPQYKTSTLLLVDLG-QSR-------------SAVPSLT-------GGRSSGAS-ALGG
A0A840DJZ8      QVPVYRTSSLVLVEKG-QQA-------------STESAIG-------SQAQAQGS-GLLP
D5H561          QVPVYRTSSLVLVEKG-QQS-------------GTESAIG-------AQAQAQGS-GLLP
A0A2H3NWA9      LPNQYQTSSLLLIKPD-SPS-------------TLVS--T-------RGRM---V-PGLA
A0A2A8CVB6      IPTTYRTSSLLLVDKQ-SQS---G---------GVVAQLS-------SRGL---S-PYSA
A0A2P6C1S6      IPTTYRTSSLLLVDRN-QQS-------------SVLSGLG-------RGRT---S-PFLQ
A0A2T2UTM4      IPATYRTSSLLLVDRE-GQT-------------SVLSGLG-------RGRR---S-PFGQ
R6A0L2          QPRVYQRQAVMLIEDSNGSS---T---------GGLRRTSKNSGMNTLLELNG-----VS
R7LG80          QPSVFKQQSVILIEEADSDP---R---------SRMVK----GNMSGLLELNG-----IS
A0A7W5UEN4      QSRVYQRQAVILFEDNESGS---G---------GGMSRSARNNGLNTLMQLNG-----IS
G5GD56          QSRVYQRQAVILFEDNESGS---G---------GGMSRSARNNGLNTLMQLNG-----IS
R5KD55          TQPVYKRDASIMVLERNDKP---T---------VLNQLLN------DYVDF-G----FFA
A0A174QNT3      VSPVYQRTAVMLVKSD-NQN---S---------Q--NDLS------AMLELSG-----IP
A0A4S2FGS1      TPPLYQRTAVMLVKGD-SQN---S---------Q--NDIS------AMLDLNG-----IP
A0A7K3KG59      TPPLYQRTAVMLVKGD-SQN---S---------Q--NDIS------AMWEVSG-----GL
R9I0H0          TPPLYQRTAVMLVKGD-SQN---S---------Q--NDIS------AMWEVSG-----GL
K5BUT9          IQPVYQRQAVMLVKDK-EKS---A------------SDMS------AMLEVSG-----GI
A0A174FPA3      IQPVYQRQAVMLVKDK-EKS---A------------SDMS------AMLEVSG-----GI
R6S9Y6          IQPVYQRQAVMLVKDK-EKS---A------------SDMS------AMLEVSG-----GI
A0A7J4YSB2      IQPVYQRQAVMLVKDK-EKS---A------------SDMS------AMLEVSG-----GI
C9KX15          IQPVYQRQAVMLVKDK-EKS---A------------SDMS------AMLEVSG-----GI
A0A6H0KRK1      LVPVYQRQAVMLVKTG-GKN---A---------N--SDIS------AMLELQG-----GI
R6DAG6          LVPVYQRQAVMLVKTG-GKN---A---------N--SDIS------AMLELQG-----GI
A0A3L8AAP1      LVPVYQRQAVMLVKTG-GKT---A---------N--SDIS------AMLELQG-----GI
A0A4S2AYX2      LVPVYQRQAVMLVKTG-GKN---A---------N--SDIS------AMLELQG-----GI
A0A7J0A2L4      LVPVYQRQAVMLVKTG-GKT---A---------N--SDIS------AMLELQG-----GI
A0A7K3MN31      LVPVYQRQAVMLVKTG-GKT---A---------N--SDIS------AMLELQG-----GI
R6CQ93          SPLVFFRSVTVIIKDQ-SNK---T---------S-TAGLD------RYDNYIN-------
A0A3D1NQW3      TPKIYSRTANILVKDS-RKG---G---------D--TDLA------TLSDLAG-----LS
B0MT10          TPKIYSRTANILVKDS-RKG---G---------D--TDLA------TLSDLAG-----LS
R7JGW9          TPKIYSRTANILVKDS-RKG---G---------D--TDLA------TLSDLAG-----LS
A0A3D2BF46      APKVYNRTATILIKDG-KKG---S---------E--TDIA------AFGDLLG-----AT
A0A358R538      TPRIYSRTATILVKDS-RKG---G---------D--TDLA------AFSDLAG-----FQ
A0A1Y4AAB8      TPKVYSRKATILVKDD-RKG---A---------N--MDIS------AFSDISG-----FQ
A0A1Y3WWY9      TPKIYSRTATILVKDS-RKG---G---------A--PELS------AFSDLAS-----FQ
A0A1Y4U5L4      TPKIYSRTATILVKDS-RKG---G---------A--PELS------AFSDLAS-----FQ
A0A1Y3VCJ1      TPKIYTRSATILIKDS-RKG---G---------D--VELS------AFSDLSG-----YQ
A0A1Y3QTW7      TPKIYSRTATILVKDS-RKG---G---------D--MELG------AFSDLVG-----FQ
R6XWY7          TPKIYSRTATILVKDS-RKG---G---------D--MELG------AFSDLVG-----FQ
A0A4Y1X9Y9      TPKIYSRTATILVKDS-RKG---G---------D--MELG------VFSDLVG-----FQ
A0A4Y1WM66      TPKIYSRTATILVKDS-RKG---G---------D--MELG------AFSDLVG-----FQ
A0A6N4GYT3      TPKIYSRTATILVKDS-RKG---G---------D--MELG------AFSDLVG-----FQ
A0A174AVF1      TPKIYSRTATILVKDS-RKG---G---------D--MELG------AFSDLVG-----FQ
A0A1Q6EIY0      TPKIYSRTATILVKDS-RKG---G---------D--TDLG------AFSDLVG-----FQ
A0A5B5VN71      TPKIYSRTATILVKDS-RKG---G---------D--TDLG------AFSDLVG-----FQ
E4M8L3          TPKIYSRTATILVKDS-RKG---G---------D--TDLG------AFSDLVG-----FQ
I3YQ50          TPKIYSRTATILVKDS-RKG---G---------D--TDLG------AFSDLVG-----FQ
R5UEY8          TPKIYSRTATILVKDS-RKG---G---------D--TDLG------AFSDLVG-----FQ
A0A1H4D866      TPKIYSRTATILVKDS-RKG---G---------D--LELT------AFSDLAG-----FQ
A0A5B3G4Y7      TPKIYSRTATILVKDS-RKG---G---------D--VDLT------AFSDLAG-----FQ
A0A374A9J5      TPKIYSRTATILVKDS-RKG---G---------D--VDLT------AFSDLAG-----FQ
A0A5B3GQN5      TPKIYSRTATILVKDS-RKG---G---------D--VDLT------AFSDLAG-----FQ
A0A1Q6E9S3      TPKIYSRTATILVKDS-RKG---G---------D--VDLT------AFSDLAG-----FQ
D4IJ36          TPKIYSRTATILVKDS-RKG---G---------D--VDLT------AFSDLAG-----FQ
A0A414Q925      SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
A0A415PUS9      SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
A0A108TCU0      SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
A0A413BA42      SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
S3Y344          SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
A0A7J5LEW3      SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
A0A412TGL3      SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
A0A413VJ33      SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
A0A414L0W6      SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
A0A412DP39      SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
A0A413ZSE8      SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
B0NP84          SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
R6AK43          SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
A0A412N2D9      SPEIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
A0A1Y4JYS9      SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
R6LHA4          SPKIFLRTATVLVKDE-QKG---G---------G-VNGAA------AFQDL------FSL
A0A3E5HPT8      TPFVYSRTAIVMIKTP-------------------ANSRS------AMQLNNA----DFI
C6IJ48          TPFVYSRTAIVMIKTP-------------------ANSRS------AMQLNNA----DFI
Q8A3U2          TPFVYSRTAIVMIKTP-------------------ANSRS------AMQLNNA----DFI
A0A3R6S1H6      TAKIYTCVASVLIKND-SKG---T---------SLASEAA------AFEDL-N----VLN
A0A3R6SD81      TAKIYTCVASVLIKND-SKG---T---------SLASEAA------AFEDL-N----VLN
A0A354WXN6      APKVYTRTASVLIKDD-KKG---G---------G-FSEAN------AFGDL-G----ITM
A0A7G1HW11      LPYIYTRSASVIIKDN-KSG---G-----------FSESA------MFKDL-GSM-DMIN
R5IP14          LPYIYTRSASVIIKDN-KSG---G-----------FSESA------MFKDL-GSM-DMIN
A0A316SZX7      ATPIYTRTASVMIKDD-RRG---G---------A-ITESA------AFQEL-G----AFN
A0A1Y4AIY1      APKVYTRSASVLIKED-RRS---S---------R-SMSAY------GFSDLNN----MLG
A0A0J6CIR2      APKVYTRTASVLIKDN-SKG-------------GGLSESA------AFEEL-N----MFN
A0A3D8HG59      APKQYTRTASVLIKDD-TKG---S---------GAMSEAS------AFSDL-G----MFS
A0A3R6S408      APKQYTRTASVLIKDD-TKG---S---------GAMSEAS------AFSDL-G----MFS
F3ZRU7          TPKTYERHASVLIKDDKASG---G---------ANMQGVA------ALTDL-A----DFG
A0A1C5Q1F3      SPDIYSRSASVLIKDE-TRG---A---------QLPNAAS------AFSEM-D----LLN
R7A239          SPDIYSRSASVLIKDE-TRG---A---------QLPNAAS------AFSEM-D----LLN
A0A3R6HIK7      APRVYTRTASVLVKEE-QRK---S---------R-AATTY------GFTDL-D----MFG
K5ZVW7          APRVYTRTASVLVKEE-QRK---S---------R-AATTY------GFTDL-D----MFG
A0A1Y4D5Z0      APLVYTRSASVLIKEE-NRW---G---------R-SRSLY------GFSDL-D----MLS
A0A413VXJ7      TSKVYSRKATVLIRDD-SKG---G---------G-ISESS------AFADL-G----LFG
I9RSN9          SSKIYSRKASVLIRDD-SKG---G---------G-ISESS------AFADL-G----LFG
U6RJK5          SSKIYSRKASVLIRDD-SKG---G---------G-ISESS------AFADL-G----LFG
A0A1Q6GA32      SSKIYSRKASVLIRDD-SKG---G---------G-ISESS------AFADL-G----LFG
I9RPU6          SSKVYSRKASVLIRDD-SKG---G---------G-MSESA------AFSDL-S----LFG
I8YFS5          SSKVYSRKASVLIRDD-SKG---G---------S-ISEST------AFADI-S----FLG
A0A7J4XCM0      SSKVYSRKASVLIRDD-SKG---G---------S-ISEST------AFADI-S----FLG
I8Y597          SSKVYSRKASVLIRDD-SKG---G---------S-ISEST------AFADI-S----FLG
A0A1Q6GBF5      SSKIYSRKASVLIRDD-SKG---G---------A-VSESS------AFADL-S----LFG
I8YFZ3          SSKVYSRKASVLIRDD-SKG---G---------G-MSESA------AFSDL-S----LFG
A0A7J4XFW0      SSKVYSRMASVLIRDD-SKG---G---------A-MSESA------AFADL-S----LFG
A0A1Q6GDH2      SSKVYSRKASVLIRDD-SKG---G---------G-MSESA------AFSDL-S----LFG
U6RSB0          SSKVYSRKASVLIRDD-SKG---G---------G-MSESA------AFSDL-S----LFG
I9GXM2          SSKVYSRKASVLIRDD-SKG---G---------G-MSESA------AFSDL-S----LFG
I9SIK1          SSKIYSRKASVLIRDD-SKG---G---------G-MSESA------AFSDL-S----LLG
A0A7J4XIJ5      SSKIYSRKASVLIRDD-SKG---G---------G-MSESA------AFSDL-S----LLG
I9TP59          SSKVYSRMASVLIRDD-SKG---G---------G-MSESA------AFSDL-S----LLG
R5S343          MPNVYTRTASVLIKDS-NKG---G---------A-AGEGR------VFEEL-N----LFN
A0A1M6K7I9      TPKTYSRKATVLIRDD-KKG---G---------G-MGESA------LFADL-N----LFG
A0A5M6A8C8      TPKTYSRKATVLIRDD-KKG---G---------G-MGESA------LFADL-N----LFG
A0A7J4XCJ1      SSKVYSRKASVLIRDD-SKG---G---------N-MSESS------AFADI-S----FFG
A0A7J4XNQ7      SSKVYSRKASVLIRDD-SKG---G---------S-ISESS------AFADI-S----LFG
A0A3R5ZMK1      APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
A0A7K1HMX0      APKVYTRTASVLIKDD-AKG---G---------A-LSESA------AFEDL-G----IFG
A0A1Y3ZIA4      APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
K5Y1A4          APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
A0A7K1HDC0      APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
A0A3R6K8X4      APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
A0A6N8D6C8      APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
A0A3R6BKI7      APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
A0A412M2W1      APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
K5ZX55          APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
A0A415BDM7      APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
A0A1Q6I3T6      APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
A0A414XX40      APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
A7AEU7          APKVYTRTASVLIKDD-AKG---G---------A-MSESA------AFEDL-G----LFG
A0A5F0U645      APKIYQRTATVLIKDD-TKG---G---------GAASEAA------VFEDL-N----MFN
K5ZBN2          APKIYQRTATVLIKDD-TKG---G---------GAASEAA------VFEDL-N----MFN
A0A0J6CKW3      APKIYQRTATVLIKDD-TKG---G---------GAASEAA------VFEDL-N----MFN
A0A0F5IQM7      APKIYQRTATVLIKDD-TKG---G---------GAASEAA------VFEDL-N----MFN
A0A496CDT3      APKIYQRTATVLIKDD-TKG---G---------GAASEAA------VFEDL-N----MFN
A0A6G1ZKM3      APKIYQRTATVLIKDD-TKG---G---------GAASEAA------VFEDL-N----MFN
S0GLB0          APKIYQRTATVLIKDD-TKG---G---------GAASEAA------VFEDL-N----MFN
A0A3R6NLC1      APKIYQRTATVLIKDD-TKG---G---------GAASEAA------VFEDL-N----MFN
A0A416WYC9      APKIYQRTATVLIKDD-TKG---G---------GAASEAA------VFEDL-N----MFN
A0A7W7AX81      APKIYQRTATVLIKDD-TKG---G---------GAASEAA------VFEDL-N----MFN
A0A0F5IT40      APKVYTRTASVLIKDN-SKG---G---------G-LSESA------AFEEL-N----MFN
A0A496CX20      APKVYTRTASVLIKDN-SKG---G---------G-LSESA------AFEEL-N----MFN
A0A5F0UBI0      APKVYTRTASVLIKDN-SKG---G---------G-LSESA------AFEEL-N----MFN
A0A6G1ZHG0      APKVYTRTASVLIKDN-SKG---G---------G-LSESA------AFEEL-N----MFN
S0GSI7          APKVYTRTASVLIKDN-SKG---G---------G-LSESA------AFEEL-N----MFN
K5YB65          APKVYTRTASVLIKDN-SKG---G---------G-LSESA------AFEEL-N----MFN
A0A0F5IWP9      APKVYTRTASVLIKDN-TKG---G---------G-LSESA------AFEEL-N----MFN
A0A0F5IZT8      APKVYTRTASVLIKDN-TKG---G---------G-LSESA------AFEEL-N----MFN
A0A417LKQ2      APKVYTRTASVLIKDN-AKG---G---------G-LSESA------AFEEL-N----MFN
A0A416TME1      APKVYTRTASVLIKDN-TKG---G---------G-LSESA------AFEEL-N----MFN
A0A7W7F3X3      APKVYTRTASVLIKDN-TKG---G---------G-LSESA------AFEEL-N----MFN
A0A416XPE8      APKVYTRTASVLIKDN-TKG---G---------G-LSESA------AFEEL-N----MFN
A0A3B0C2S4      APIVYESSAKIKIIDE-AKE-------------MDITVDPMALLSG-------------N
A0A5M8NYX7      TTREYSVSSRALIKDE-QKG-----------------RTAMDMNTFSDLGFM-------P
A0A1M6GR99      SIPTFKVSATLLLKDN-SGS-------------SSSSGESRYINSELL-----------S
A0A7C5M4P4      TKPLY--ESYSEIKLD-QEN-------------QSNILNLPGTES--Q-----------N
A0A1W2GF52      TKPIY--SAESILKLD-IKN-------------DA---NLLGLQNPLE-----------Q
A0A2G5L7B8      TKPIY--SSESILKLD-IKS-------------DA---GILGIQNPME-----------Q
A0A2D8JJW3      IKPIY--SSYAEIEIV-KDD-------------NSGIAKMPGFEA-FS-----------D
A0A6B5PK86      TKPVY--ESQLILQIE-NED-------------NA--KNVIDVEN-IN-----------S
A0A2G2F510      TKPVY--ESAMILQLS-EKD-------------TA--KEVLDFQN-LG-----------S
A0A316JZ08      TKPVY--ESSLMLQIS-NQD-------------KA--ADVIDFEN-IN-----------T
A0A2W1NDY9      TKPIY--ESRAIIQRS-LKD-------------EG--QRILEFKD-FN-----------T
A0A5C8AQR5      TKAIY--SSNTLIQIE-NKD-------------QA--KDVLNMEN-IN-----------S
A0A1G0CI31      TKPIY--DSSMVIQLG-EKD-------------QG--KEIVEIEN-IN-----------T
A0A556N0M0      TKPVY--DSTMVIQLV-EKD-------------QA--KELLELDN-IN-----------K
F2IKD6          TKPVY--DSTTLIQLV-EKD-------------QG--KQLLEIDN-IN-----------K
A0A1I7BM74      TKPVY--QSQMVIQID-NED-------------QG--ANVLDLKN-VN-----------N
A0A2G2FJ17      TKPVY--ESKMLIQIS-NED-------------QG--ADVLDFKN-IK-----------E
A0A1H4ADG3      ANPTYKAMATVLIKDN-T-----G---------QNNSPQSNGISSLQSLGLF-------P
A0A5B8VUR8      TSPTYKAMATVLIKDN-D-----G---------KSPAPQNNGIGSLESLGLY-------P
A0A1V5IPN7      QPRIYSASGRILMENQ-S----------------------SGADILLLTNQG-------G
A0A7G7G5F9      ATPEYSIVSTIQIKDD-KKD-------------PGA----AKSDAFNDLDIF-------A
A0A2N3U785      ATPQYLISSTLLIQDN-NKG-------------ASV----YENSFFSELGIF-------Q
A0A0D3L8Q3      TTPQYLITTSILIKSD-QQS-------------GGL----TESAVFNDIPGF-------K
A0A519U664      AIPQYVVSSTMLIKDD-KGG-------------QGL----SNADALSDLTTF-------K
A0A519MA34      AIPQYVVSSTMLIKDE-KGG-------------QGL----SNADALSDLTTF-------K
A0A519UCX0      AIPQYVVSSTLMIKDD-KST-------------QGL----SSADALSDLTTF-------K
A0A5B6TJH8      TSVQYKVASRLLIKEN-QRG-------------QGI----SGAGTFSDLDMF-------N
A0A7Y0AA98      AVPQYNVYSTLLLKDD-KSG-------------QEL----SNADALNDLGVA-------K
A0A0E3ZG78      TIPKYSVYSTVLIKDD-KSD-------------SHL----SNESAFSDLEIF-------Q
A0A1I6BRK6      AVPQYIVSGTMLIKDD-KSG-------------QSL----SNADALSDLNTF-------K
A0A243WAB1      AVPQYHVYSTLLVKDD-KSG-------------QSV----SNAEALSDLTML-------K
A0A6G8C8X6      AVPQYWTESTLLIKDD-KSG-------------QGL----ANADAFSDLPAF-------K
A0A4R5DL69      STPRYEITSTILVKDD-TKG-TDL----------------GEAAILENLGLA-------P
A0A1M4YED3      TPPVYSAYSTMMIKDE-KRG---V----------------NESKMEESLDFY-------Q
A0A7T9DAA2      TPKSYLVGASIMLSEK-SRSAFGS----------------SNEEFLKGTGYL-------R
A0A7Y5V8S3      TPKQFLISATMLMGEK-SRNSFGG----------------GQDEFLKGMSFL-------R
A0A126PFG0      VQPAYEVRASLLVEGE-KKT---P----------------AEKSALQELDLV-------T
A0A7V5VRT5      ATATYKSDATIQLDFS-Q-V---S----------------FVKTDKGGGSFI-------P
A0A3M1N7Z3      TEATYQTTAVVQVNLA-QAV---G----------------GFQTQNTAGSFF-------P
A0A7V1R2A1      TEATYQTTAVVQVNLA-QAV---G----------------GLQTQNAVGGFF-------P
A6EBM4          TPKTYATTAILKFEEQ-K----------------------TALSDIADALNT-------N
A0A7X8C760      WMPIYQSVGTIIINEN-KYR---S----------------ATQNFMQGFGLE-------D
A0A501VZX6      AIPSYETSASLIIKDE-NKG---V----------------NDAKMTESIDAF-------T
A0A399SH26      ATPVYEIAATLIIKDE-KKG---V----------------DDARMTESINAF-------A
A0A501W1A9      ATPTYSTSASLIVKDE-KKG---V----------------NASKIEESIDAF-------N
A0A0E3ZGV6      ATPTYAITASLIIRDE-EKG---V----------------NASKITESIDAF-------S
A0A1I2N4S1      TIPSYAVTASLLIKDE-EKG---V----------------NASKIMESIDAF-------S
A0A2T5YE44      TIPSYAVSASLLIKDE-EKG---M----------------NASKIMESIDAF-------N
A0A4Q8RX32      AEPIYEIGAKVVVHER-QRN---IADPTSFLPGSEL---------------F-------S
A0A1M6TTV4      TKPIYSSESILKLDIK-SEA---GILGIQNPMDQDI------------------------
K0X1U5          AKPVYEVSADILVNED-EKK---G-GGGLSSLMGGISGGGFSLDG------M-------I
R5EXK3          AKPVYEVSADILVNED-EKK---G-GGGLSSLMGDIAGGGFSLDG------M-------I
A0A401UAP7      TKNVYEAEAEIKLEVN-NEA---N---------------EFGITKIME---D-------Q
A0A523GAC0      TKPLFESYSDIKLNVK-K---------------DANFLGFLEINE------E-------Q
L8JW09          TKPLYESESELKLDVK-S---------------DASELGLLGLSE------N-------K
A0A364XUP5      SKDIYQSVSELKLDIK-NEA---T---------------ELGIAT-ITSDEP-------Q
A0A1M5RLA9      TKNLYESSSELKLDIK-NEA---T---------------EFGIKP-TVED---------P
A0A385SFR9      TKNVYESSSELKLDIK-KEA---T---------------EFGIKP-TVED---------P
A0A5M4A9J4      TNPLYAVSASLLINED-KGS---N-----PLEGSGGSGSLNASDVFQGFGLF-------Q
A0A5M4B1C7      TNPQYAVSASLLVNES-KGN---N-----PLDGSSSGTSFNASDVFQGFDLF-------Q
A0A0D3LFR6      TKPLFQSNSELQLTEN-K-P---A---------ASFGFVDSD---------K-------A
M7N6D4          TKPLYRSDSELQLGVN-K-Q---A---------DFLGYRSLDSDP------N-------Q
A0A5C7MX19      APKIYESNATMLFSTE-KKA---Q------------------ILGVEKIAVE-------Q
A0A1M5BA90      AKPVYQISANILIKDE-KKG---A----------------DESKILEALNI--------T
A0A512B879      TKPIYEISADILIKDE-KKG---A----------------DESKILDALNIY-------S
A0A559PPI3      T-PIYEVSATLIIKDE-NKG---V----------------DNSKMVESMSPF-------D
A0A1T5CS78      T-PIYEASASIMIKDE-EKG---V----------------DNSRIMESINPF-------D
A0A0Q9Z8F1      T-PIYEASASIMIKDE-EKG---V----------------DDSKIMESINPF-------D
A0A2N0U0M7      T-PIYEASASIMIKDE-EKG---V----------------DDSKIMESINPF-------D
A0A1Q3ZMZ7      TKSVYESSAIIQIQDN-D-Q---G---------KEV----LELEN------I-------N
A0A7Y3KMD1      APRWYEESTTIQLSFA-N-N---A---------NKV----LQNSNGLY---E-------A
A0A3C1ITV0      AQRIYQRSASVMLRSD-NKG---Q---------AQI----SELAAFADLGIG-------S
R7HN19          AQRIYQRSASVMLRSD-NKG---Q---------AQI----SELAAFADLGIG-------S
A0A2W2AFF7      STPAYKINATVLINDD-QKA---G---------NMDGKQLLEDLG-----FL-------S
A0A845PZ37      SPFVYSSTEVVMIKTP-SNT---P------------------TTARITRVSA-------T
A0A077ENE7      TPFVYNSSEIVMVKTP-SNT---P------------------TTARITRSFG-------A
A0A854FRG7      SPFVYSRSEVVMIKTA-SNT---P------------------TTARITRSSV-------A
T0NN57          SPFVYSRSEVVMIKTA-SNT---P------------------TTARITRSSV-------A
R7PCR1          QPQVYQRTAVLEIEDN-NDS---GSMGRAGRGANML----LELNG------V-------S
A0A2N5YXE2      TRPVYKTTTVLQIKNE-N-K---T---------NQILGINAGVME---------------
A0A2U1FKU2      QSPVYHAQATVLIKSA-EKN---G----VSGGLSQFQDLGLLMGN---------------
A0A0A2F954      QSPIYHAQATVLIKSA-EKS---G----ATSGLQQFQELGLMTGN---------------
A0A0A2FW91      QSPIYHAQATVLIKSA-EKS---G----ATSGLQQFQELGLMTGN---------------
A0A2D2N2N1      QSPIYHAQATVLIKSA-EKS---G----ATSGLQQFQELGLMIGN---------------
Q7MWZ2          QSPIYHAQATVLIKSA-EKS---G----ATSGLQQFQELGLMIGN---------------
A0A212FSE5      QSPIYHAQATVLIKSA-EKS---G----ATSGLQQFQELGLMIGN---------------
T2NDT6          QSPIYHAQATVLIKSA-EKS---G----ATSGLQQFQELGLMIGN---------------
A0A1R4AFZ0      QSPIYHAQATVLIKSA-EKS---G----ATSGLQQFQELGLMIGN---------------
A0A1R4DVZ7      QSPIYHAQATVLIKSA-EKS---G----ATSGLQQFQELGLMIGN---------------
A0A1V9FHD0      ATPVYETYATVMVKDE-KKG---V----------------DESGMGEALQIF-------P
A0A4V4H170      STPVYETYATIMVKDE-KKG---V----------------DESGVLEALQIY-------P
A0A1V9F098      SIPVYETYATIMVKDE-KKG---V----------------DESGVLEALQIY-------P
A0A4R2VU64      SIPVYETYATIMVKDE-KKG---V----------------DESGVLEALQIY-------P
A0A0K8QSK7      SMPVYQSSSSLLILER-SGG---SPFSQTESAISSQAFEGFGIMG---------------
A0A7C0WKI7      TPPVYEAESSVIISQK-GGI---E---------NTL----FGVTP-----FG-------K
A0A1T5K9D4      TPFSYRSNATIIIKNP-SNT---R----------------ATTKLDNYSNLI-------N
A0A5M4B212      AHPTYAVSATMLIHEQ-QNQ---S---------PLTTPTDSEANVFQGFGLF-------Q
A0A3D1KEX9      QPRVYSRQSTLLIENN-DNN---G-----KYANNSALNALKQLNG------V-------Q
A0A358Y7S2      SVPIYQTKALVQVVEE-NKT---R---------DILGKDALNVEKALN------------
A0A2J6HHN3      TQPIYESSTIVQLNSD-D-K---G---------QML----FETKNLYD------------
A0A1Y3WMT8      AKPQYAISADILVNED-DKQ---GGGGALSSLVGDVTGGGFSLDG------M-------I
A0A1Y4GQU1      AKPQYEVLADILVNED-EKK---GSSGSLSSLMSGVSGGGFSLDG------M-------I
A0A6A0R272      KKQVFSAKATIKIDDK-SSN---V---------TDFLAIDMFSES------F-------N
A0A1V5W8T5      TPPIFDAYTVIQINEE-QNE---D---------------LLKIDN------I-------Y
A0A2T8HKA9      TPFVYSKAAILMIKTP-QNT---NVTA--RFTRSSM----MNTVS---------------
A0A1X7J248      TNVKFQSYAELKLNKR-SEA---SVFG--FNPLSEE---------------S-------S
E4TQD2          TNVKFQSYAELKLNKR-SEA---SVFG--FNPLKEE---------------N-------S
A0A2I0QZ80      TKPVYESRMLIQINSE-N-Q---G---------ADL----LDLSD------V-------R
A0A3E1F1A3      TKPIYESKMLIQINSE-N-Q---G---------ADV----LGFAE------A-------R
A0A2U2XBJ3      TKPVYESSMLIQLNSE-N-Q---G---------ADV----LDFKD------I-------R
A0A4Q4KU94      TKPVYESKMLIQLNSE-N-Q---G---------ADL----LDFKD------A-------R
A0A3B8INU3      TKPLYESVSDIKLNFK-S---------------EATLFGFSNFNE------N-------P
A0A7V6V2N8      TKPVYQAKAVIQLNIE-NRA---S---------EVISSSALNKDN---------------
A0A414ZBF2      TPKTFSRTATILVKDE-QGG---G---------------NMGESAAFRDVFS-------L
A0A7X9D3Q8      TPKTFRRTATVLVQDD-RRG---G---------------VMSESAAFEDLFF-------S
A0A1Q3Q573      TPRIYEATTKMILQLE-KS--------------TQI----LGIDNLVF---E-------K
A0A662BAY3      ATPIYEITSSLLLEVG-NSN---S---------PLTNKNANEDNVFQGFGIT-------D
A0A4U3L369      TEPVYQVNAGIMVEDQ-S-G---GSSG--SSSLSASSGIFQDLGGAFSMA----------
A0A4S8HY23      ATPVYETYATIMVKDE-KKG---V----------------DESGVQEALQIY-------P
A0A1V9F383      AVPVYETNATVMVKDE-KKG---V----------------DESGSMEALQIY-------P
G8TRZ6          AVKQYESYATVMVKDN-KKG---V----------------DESGAMEALQVY-------P
A0A357YNR3      TLPKYMIQTSILFNDD-QKG---G---------ASEVTTFREMGI------V-------S
A0A7X6YKE8      TLPKYMIQTSILFNDD-QKG---G---------ASEVTTFREMGI------V-------S
A0A5E8AX52      TKPVYESESQLKLNIQ-N---------------EAVI---LGVQNPLE---N-------S
A0A1V6CN82      TTTMYSARASIMILEE--GS---TTFW--RQAGGFSGEALRGFG---------------T
A0A1M4XZ45      TTPVYEIKASMLVEEG-KAS---SPLS--GAMGGAQQSIFQGLGG------M-------N
A0A399D319      TTPIYEISSSLLVEEE-KAG---SPLA--SGAGGSSEGIFQGLGM------M-------N
A0A7Y1YS85      ATFEYATSAKLLIKDV-G-T---S---------GNLSESGILVEDLGI---G-------S
F4KK08          SSHQYSRSASLLIKSE-T-S---I---------NSA----IERLAQFTGDKH-------S
A0A7V5VE02      VTPEYEASSKVIVQEE-GNM---G---------MSL----FDIGS-LM---Q-------Q
A0A496LCF9      FVPTYNSTLRMLLKQE-S---------------GSL----SYMQNMTQNFGV-------V
A0A5P2G2A9      SAPRYNVNATVMVDDD-Q-K---GGMS--GMLGSSSSGSNSSFGD-LSSLLN-------V
A0A3C0ZQC7      TSPVYESTATVLVDTK-G---------------QQSQMPLFDVTG------I-------G
A0A3N2N6F7      SPKIYTRTAQVVVQDD-E-A---GSSS--QSITSALSDMGLFTTS---------------
A0A419VXB7      TPATYRVKSLLFIKDK-ESS---G----------------VDLQNIFSSSPL-------K
A0A1Q6E6I7      RPDVYRSSAMVLIDEQ-YNR---S---------SNSDLTGFMPGRMMY---R-------T
A0A3B9CNN6      RPDVYRSSAMVLIDEQ-YNR---S---------SNSDLTGFMPGRMMY---R-------T
R5X290          RPDVYRSSAMVLIDEQ-YNR---S---------SNSDLTGFMPGRMMY---R-------T
C3J7R8          TPNVYKREASILVKDK-M-D---A---------SNVLSELFESSALTS---L-------G
A0A1G8BVM8      TPKTYSRTATILIKDD-KKG---G---------GGI----SEAAA-FQDMFS-------M
A0A1I1FXP9      TRPTYEAYSVLKLDIK-Q-Q---A---------SGL----LSRVYSATGEEM-------Q
A0A4P7VVU7      TPETYTRTASVMINED-TES---G---------SQGVASALSDIG-LF---Q-------S
A0A2V1ILM4      TPETYTRTASVMINED-TES---G---------SQGVASALSDIG-LF---Q-------S
A0A3N2L0E8      TPETYTRTASVMINED-TES---G---------SQGVASALSDIG-LF---Q-------S
A0A3N2LFC5      TPETYTRTASVMINED-TES---G---------SQGVASALSDIG-LF---Q-------S
A0A7K3KWJ8      TPETYTRTASVMINED-TES---G---------SQGVASALSDIG-LF---Q-------S
A0A3N4H5N3      ATPVYEISGSVIIKEG-D-R---P---------TTV----AESSVLNELDNL-------K
A0A2P8EAX2      ATPFYEITSSVLIREG-E-R---A---------GNL----TESPILSDLENI-------K
A0A4V2F6N9      ATPYYEITSSVLIREG-E-R---A---------GNL----TESPILSDLENI-------K
A0A838T9G8      TPPTYEVSAALIVKPI-N-T---A---------QALN---IENNNNLFQGKN-------S
A0A3B9FXJ0      SVPRYSAKSVVQFKEF-DPS---S---------S------LDFADILR---P-------G
A0A848SUJ0      TPRIFQSVSTLMLKTQ-E-----T---------SQV----LGISD-LM---R-------D
A0A847ALW2      KAPLYKIYSTLLVEEG-NVN---SVFG--TGRGSDAGGLFQGLGV------I-------N
B2RKZ8          QSPAYIAQAAVLIKSA-EKS---G---------APRSMKQFEEIG-LF---M-------D
A0A0K2J6Z0      QSPAYIAQAAVLIKSA-EKS---G---------APRSMKQFEEIG-LF---M-------D
A0A212GC82      QSPAYIAQAAVLIKSA-EKS---G---------APRSMKQFEEIG-LF---M-------D
A0A0E2M2Y7      QSPAYIAQAAVLIKSA-EKS---G---------APRSMKQFEEIG-LF---M-------D
A0A829KSZ7      QSPAYIAQAAVLIKSA-EKS---G---------APRSMKQFEEIG-LF---M-------D
R5GSU5          QPRVYQRQAVIEIEGA-D-G---S---------SGSRRMPSNMNALLELNGI-------T
A0A7X8I6A2      TPPLYEAKTVMQMTNE-D-N---P---------NKL----LKLSE-VY---G-------E
A0A0A2G557      TPNSYERTASVLVNTK-S-D---I---------SGPLADIMKISGTDIGGIK-------G
A0A1T4PT95      TPNSYEKTASVLINTE-S-N---M---------SGPLADIMKISG-AELGFK-------G
A0A6I6JYY3      ATPVYELSTTVLVEED-K-V---T---------SPLEESGVSANVFQGFGVM-------N
A0A651GU15      NAPVYQASTIIQLSKS-D-N---A---------TKI----LQVNK------I-------Y
A1ZKR2          TKPVYKSSSTLKLAIK-D-E---G---------VGM----LGIKGLIPGGSY-------S
A0A1Q3GX01      TKPIYESSSNLKLAIK-D-E---G---------VQM----LGIKQLITNNN--------S
A0A349DQI4      TKPVYESSSSLKLAIK-D-E---G---------VQM----LGIKQLITSNS--------I
A0A4P5TMD1      TTPLYEVTAQIMIKQV-N-T---S---------SSLGIG-VTSGG-VNSADQ-------M
A0A3Q9FR88      TPRIYEASTLNQIKLT-S-S---S---------QDF----AEKFG-IMNNSL-------N
A0A553GEX3      TPRIYEASTLNQIKLT-S-S---S---------QDF----AEKFG-IMNNSL-------N
A0A150ADJ9      SPRIYEATTLNQIKLT-S-S---S---------QEF----AEKLG-LMSNSL-------N
A0A7X9P1P7      SPRIYEATTLNQIKLT-S-S---S---------QEF----AEKFG-IMNNSL-------N
A0A7X8SM94      TPRIFEAKTLNQVKLT-S-S---S---------QEF----AEKFG-ITSSSL-------E
A0A1S1Z228      TPEIYQAHTLNQVKLT-S-S---S---------QEF----AEKFG-IANSSL-------E
A0A1B1FWQ4      TPEIYQANTLNQVKLT-S-S---S---------QEF----AEKFG-ITNSSL-------E
A0A7X9Y5D2      TPEIYQANTLNQVKLT-S-S---S---------QEF----AEKFG-ITNSSL-------E
A0A7X8ISG0      TPSVYQAKAVIQEDKN-N-N---E---------DIL----KRAFSGVITRNT-------G
A0A2N3IIZ0      TKPIFQSTANLKMEFK-D-E---S---------AGLDLR-IGLNQ------E-------N
A0A7X8Q7Q7      TQPVYEAKCLVQINND-N-K---A---------DKL----FEKKS-FY---D-------D
A0A2N2WFW8      TLPVYEASSVVQINSD-D-K---A---------QKL----FESKN-FY---D-------E
A0A1F3IU95      TQPVYESACIVQINTD-D-K---A---------EKL----FDNKT-YY---E-------D
A0A3D0VUF6      TQPVYESACIVQINTD-D-K---A---------EKL----FDNKT-YY---E-------D
A0A7K3WUF2      TAPVYEARTIIQLSNK-D-N---A---------KQI----LNVNQ-FY---E-------D
A0A497D5Z2      TTPLYKICSSILIEEK-N-T---G---------SPLSGNMNNGDVFQGFSLM-------G
A0A662B170      TTPLYKICSSILIEEK-N-T---G---------SPLSGNMNNGDVFQGFSLM-------G
A0A7X7FWB7      TPNMYQARAVIQEDQN-NNE---D---------ILK----KAFSG-VATRRM-------G
A0A7X8DM61      TPSIYQAKAVIQDDKN-NNE---D---------ILK----KAFSG-VPTRYI-------G
A0A3M1CDV2      SERIYSSQSIIQIVNS-D-----A---------HQI----LQLNP-AN--TE-------G
A0A1F3SJM1      TKPIYESSMILQLSDK-D-E---A---------KDV----LNIDN-LN---V-------R
A0A2G2EB96      TKPTFESSMVLQLGDQ-D-S---A---------KDV----LDIEN-IN---S-------R
A0A2G6PRA9      TKPTYESSMVLQLGDK-D-N---A---------KDV----LNIEN-IN---S-------R
A0A7Y7A9N2      TKPTYESSMVLQLGDQ-D-N---A---------KDV----LNIEN-IN---S-------R
A0A6C1QGZ7      TPPVFQTSAIIQMEGQ-F-Q---A---------TRI----LPTAG-IY------------
A0A7W1EH85      SQAIYESKAILQINDG-N-K---A---------DNI----LKLDN-IE---A-------P
A0A2E3XZI5      KPEIYKTETRLQLAVK-D-E---P---------LEF----MQMNP-LS---S-------N
A0A6I7QXV0      TQPIYETSSEIIQKTE---K---T---------AQI----LGTDE-LL---R-------G
A0A7Y3V126      TVPVYESSTIIQIVSN-N-A---A---------QQV----LSVEN-PF---E-------K
A0A7Y5C3U1      TVPVYESSTIIQIVSN-N-A---A---------QQV----LSVEN-PF---E-------K
A0A2M7NLQ9      TKRVYSSSSTLKLEMK-G-----T---------SEL----LGRGI-FSSDEN-------V
I4AFR0          THRIYNSSSTLKLEMK-G-----T---------SEL----LGKGI-FASDEN-------A
A0A2N2Y3E5      TQPLFQASAIIQLKDE-ADK---T---------NKI----LNIQN-IY---D-------E
A0A2D9D7T6      TKPIFQSKAVIQIVEE-D-R---V---------KEV----LGKDA-FTDRES-------A
A0A1F3PPL5      TPPLYQSITVLQISNN-N-N---A---------DKV----LEIEN-LR---E-------E
A0A357QK06      TPPLYQSITVLQISNN-N-N---A---------DKV----LEIEN-LR---E-------E
A0A7X9JJJ8      TPPLYKASSVIQIKND-VDK---T---------NQI----LEINT-SK---S-------D
A0A522EYA6      TPEVFESRTILQVNND-N-Q---A---------SRI----LNVDN-FN---E-------A
A0A662AEA4      TPPVYKSVSIIQINNE-GSK---A---------QKI----LNIED-IY---E-------K
A0A0S2HYK8      TAPLYEAKSVIQIQED-K-K---T---------SQV----FQLDD-LY---E-------D
A0A2N5ZWN6      TSPVFEAKSVLQIQED-N-K---N---------TQV----FQLDN-LY---E-------D
A0A2E0FJ09      TPPQYKAKALIQRTSQ-D-N---A---------RRI----LNVKN-PL---Q-------E
A0A1F3FZ62      THPVFEASSVIQLSSS-N-S---A---------NKV----LQTAN-IY---D-------G
A0A1F3K211      THPVFEASSVIQLSSS-N-S---A---------NKV----LQTAN-IY---D-------G
A0A7Y1UDU0      THPVYQASTIVKVKAE-N-N---A---------NTI----LDINS-SFYADQ-------S
A0A1V6I2U9      STPRYKTSTIIQVKNE-N-K---T---------NQI----LGISS-NL---M-------E
A0A2H0B957      TQLIYKSVSIIQLKNE-NTN---A---------NKI----LNLTN-AV---E-------E
A0A1F3CFW6      TLPIYKSSSIIQLKNE-GTT---A---------NKV----LNLTT-AV---E-------E
A0A2M7E2T8      TLPIYKSSSIIQLKNE-GTT---A---------NKV----LNLTT-AV---E-------E
A0A2M7NC69      TLPIYKSSSIIQLKNE-GTT---A---------NKV----LNLTT-AV---E-------E
A0A1F3KLL5      TPPIYQSNSILQINEQ-N-Q---T---------AEI----LGFKN-NF---I-------K
A0A359D1M1      TPPIYQSNSILQINEQ-N-Q---T---------AEI----LGFKN-NF---I-------K
A0A0F2NS19      TVPIYQSKLVLQVGSE-N-T---A---------NKV----LQVDN-FS---K-------T
A0A2A5H8X6      TVPIYQSKLVLQVGSE-N-T---A---------NKV----LQVDN-FS---K-------T
A0A2H0GAU8      TIPIYQSQLVLQVGSE-N-T---A---------NKV----LQVDN-FS---Q-------K
A0A2M8FTK1      TIPIYQSQLVLQVGSE-N-T---A---------NKV----LQVDN-FS---Q-------K
A0A2A5B3B0      TTPIYESVLVYQVSSL-N-T---A---------SKV----LEVRE-FQ---E-------T
A0A5C6RXM7      TIPVYQSNLIFQVGSL-N-T---A---------NQV----LNVDN-FH---E-------N
A0A7W1FWM4      TPPVFESDSIIQIQTN-D-Q---A---------NKL----LNVEN-IT---E-------S
A0A7T9QP55      TAPTYASSVLLQLGQS-N-N---A---------QMV----LKVND-LM---E-------N
A0A7V9MK11      TPPIYEASSIIQVNYE-N-N---A---------SKV----LGVDN-LH---D-------Q
A0A1F3C1M2      TLPTYKSSSIIQINTK-N-Q---T---------NQL----LNIEN-VS---D-------N
A0A1F3DS87      TLPTYKSSSIIQINTK-N-Q---T---------NQL----LNIEN-VS---D-------N
A0A7Y5QSG1      TAPIFKSGAVLQIRES-N-N---A---------QLV----LEMNQ-FV---E-------D
A0A7Y2EX06      TIPIYEASTIIQLERD-D-D---A---------SRV----LNVSN-VV---E-------E
A0A7Y7NV14      TLPLYETSTLVQLNTD-N-Q---A---------NKI----LGTES-IY---E-------D
A0A6A0R6K9      TAPIFSSQSIIQIKKS-N-Q---A---------NRL----LDVED-YY---E-------T
A0A2E7CT70      TPKTYQTSATLQINIK-D-K---A---------DEL----LEIYS-FQ---Q-------K
A0A2D5V560      TPKTYQTSSIIQVAVK-E-Q---P---------NGF----SDLYS-YN---I-------N
A0A2D7K5A8      TPKTYQTGALIQVAVK-E-Q---P---------NGF----SDLYT-YN---I-------N
A0A2E1XQ82      TPKTYETGALIQVAVK-E-Q---P---------NGF----SDLYT-YN---I-------N
A0A1F3K695      TPPLYRASSVIQINDQ-N-Q---A---------DKL----LNLES-VY---E-------N
A0A353KZR1      TPPLYRASSVIQINDQ-N-Q---A---------DKL----LNLES-VY---E-------N
A0A2N2WYB5      TQPLYSTQTIIQINEN-D-R---T---------TRL----LNIED-VY---Q-------N
A0A1F3K4G0      TQPVYQTQSIIQINET-N-N---T---------TKV----LKIED-VY---Q-------D
A0A356H8Y3      TQPVYQTQSIIQINET-N-N---T---------TKV----LKIED-VY---Q-------D
A0A351HSA6      TQPVYQTQSIIQINET-N-N---T---------TKV----LKIED-VY---Q-------D
A0A2A4PYG9      TPLLFEASALLQMTSQ-N-T---A---------QKV----LNVEN-IY---E-------Q
A0A350JJ90      TQPKYESTSIIQIINE-N-Q---A---------NRI----LNVGD-IY---E-------D
A0A2A4YXP3      TAPVYEAKLVYQVNSL-N-T---A---------SSV----LNVGG-GF---K-------E
A0A1F3R158      TVPLYQSQLVLQVGSK-N-T---A---------DQV----LKVDN--F---E-------E
A0A2M8ADX2      TIPLYQSQLVLQVGSK-N-T---A---------DQV----LKVDN--F---Q-------E
A0A1J5B2H0      TPPIYETHSIIQLSSD-N-E---A---------QKI----FQTNNINV---E-------E
A0A1V5N756      TYPKYETSGTIQIYTE-E-E---V---------RQV----FGKKT---------------
A0A4P5U6G4      TPPLYEVGSTLMIKPE-N-T---S---------KAIGLDNIGLEA-SR---G-------N
A0A2E2TFD1      YQPMYQSTSILQLKES-N-Q---A---------SQL----LEIDF-GK---N-------Q
A0A2E4ELE6      TQPIYSSSSILQLKEQ-N-R---A---------TQV----LDLE--RM---N-------E
A0A2A3UE91      SQPIYESRAIIQINDA-N-Q---A---------DDI----LKLNS-LS---N-------N
A0A7V9SRJ9      SQPVFESKAVLQINDA-N-K---A---------DDI----LKLNN-FG---N-------N
A0A2E6SYP1      TTPTYYASSVVKISEK-N-D---V---------NQM----MNFEN-IY---E-------T
A0A2E5RLE8      TTPQYSASSIVKISEK-N-D---V---------NQM----MNFEN-IY---E-------T
A0A2E7TQF6      TTPQYSASSIVKISEK-N-D---V---------NQM----MNFEN-IY---E-------T
A0A2E6GVY9      TTPQYYSSSIVKISEK-N-D---V---------NQM----MNFEN-IY---E-------T
A0A2A5FYT6      TPPIYESIGIIQVRTD-N-T---A---------SQI----LEATP-AY---L-------R
A0A6N9NIX1      SVPTYRVSSVIQIEKN-D-R---A---------NQL----LEVQG-FN---E-------T
A0A1F3Q014      TTPIFESSSVLQIETT-N-Q---A---------SKL----LNVGN-IT---E-------P
A0A2D5KD44      TAPVYRASADIQIEKS-N-Q---A---------NRL----LDVED-YY---E-------S
A0A7Y2F301      TIPVYKSTTTLQLEKS-D-Q---A---------EKI----LNVSG-YQ---D-------A
A0A0E3V905      KQPIYKIQASLLVQDQ---Q--------------------KGSEQSSSLKEL-GV-F--A
A0A553ETH6      TKPLYESTSELKLDVE-ANA--------------------SELGLVNFGEN--------N
A0A2D4ZVH1      QTPIFQSTGTLIVSES-KNR--------------------YSYAGAGIENLLTST-YGIG
A0A6P1P355      AVPTYKTSATIIIKDE---K--------------------KGVDESRMTQSI-DA-F--T
A0A3D0MYJ7      LPNIYQSKVQINVEKK---Q--------------------QSILTGL---SV-PE-G--S
A0A4Q5WS95      ATPVYEANATILIKDE---K--------------------KGAEESSLSESM-NV-L--S
A0A7V9RTA1      TTPVYATSSTLLINDE---K--------------------KGADENKIEESL-NL-L--S
A0A5C8KAD6      ATPVYEASASLLIKDE---K--------------------KGVNDSKMTESI-DA-F--I
A0A5N1J695      SVPTYEVSASLLIKDE---K--------------------KGINDPRMMEAI-DA-F--A
L8JI02          ATKVYLVKASILLKSE--RK--------------------NDLGGKEFLRGM-GL-F--T
A0A1Q3PII2      QTPHYTIKASLLVRDD-SRG--------------------SDFNESALLEEL-GL-P--N
A0A351BXT2      AKDIYKSSATIKINRP---Q--------------------GSVLSSSLIPEF-QD-F--I
A0A2K8Z965      KQPVYKIQASLLVQDQ---Q--------------------KGSEQNNTLKEL-GV-F--T
A0A418M8U8      KQPVYKIQASLLIQDE---K--------------------KGNERDQPLKEL-DA-Y--V
I2GTA4          KQPIYKTQASLLIQDE---K--------------------KGNERDQPLKEL-DA-Y--V
A0A2K8ZAJ2      QPLVYNVQASVLIKDE---R--------------------KGISEQSAMKET-NI-F--T
A0A368JPA3      TEPIYRVQASLLVKDE-PPK--------------------SGVSSDGILKDL-TT-Y--S
A0A5N1JI29      TEPIYRVQASLLVKDE-PPK--------------------SGVSGDGILKDL-TA-Y--S
A0A7K0EGC9      TEPIYRIQASLLVKDE---Q--------------------KGLGNDGVLKEL-NI-Y--S
A0A3P1BT12      TEPIYRIQASLLVKDD---Q--------------------KSPSDNGVLKEL-NI-Y--S
A0A3P1CI15      TEPIYRIQASLLVKEG---K--------------------DNVADEGLLKQL-HI-Y--S
A0A4R8CUK1      TEPVYRIQASVLVQEE-PRI--------------------GADESIPADPDN----R--N
A0A7Y6XX71      MTPIYRASSSLLIEAE-EAK--------------------VVSIEEIYGLNS-------G
A0A2H3NSN0      VAPEYEAAATVQVEKP-NQA--------------------Q-------TVRF-------D
A0A800J4N3      APNEYQSTARLYVESD-GGD--------------------AATQVMPGGEGF-------L
A0A2P6C324      MPQVYEAGAVVSVER-------------------------EAAPARM-MVGL-------N
A0A7V2F6E1      LPPVYESSAIVFIDTR-SSS--------------------NTPTTLT-AFTL-------G
A0A1M6XHU0      LPPVYESSAIVFVDTR-GSG--------------------NAPVSVA-AFTP-------I
G2SF81          LPPVYESSAIVFVDTR-GSG--------------------NAPVSVA-AFTP-------I
A0A5S9EYW1      LPPVYESSAIVFVDTR-GGE--------------------NAPVSVA-AFTP-------I
D0MHQ9          LPPVYESSAIVFVDTR-GGG--------------------NAPVSVA-AFTP-------I
A0A662AH13      AKDIYTATVAMKIQK--PSS--------------------GGILDAPLLPEF-SS-F--G
A0A5C7QA01      TPNTYSVDALIQVEDS-KGA--------------------SS----ALLGDLSSM-I--E
A0A3D3LS70      AKDIYKSSTSLLIQK---PQ--------------------GSLLTSNMIPGF-SD-Y--A
A0A1G1TM36      AQPTYEVQASILVEEG-NKQ--------------------PG--ERSALQEL-DF-A--N
A0A1G7ZF38      KTPHYTITASLLVRDD-SRG--------------------SDFHETALLEEL-GL-P--D
C6VS52          KTPRYQVTASLMVRDD-SRG--------------------SDLHETALLEEL-GL-P--D
                                                                            

A0A7V5RJC2      DPTLFDLRNQKLM-SRTFAEEIVREL----------------------------------
A0A7C1LGX3      STINLDNQIEILT-SYRILSEVVKEL----------------------------------
A0A1T5MMH4      NTDLISGEIEMIR-SRLFLDQVLDSL----------------------------------
A0A2W4R1L8      NLNIMSGEIEIIQ-SKLFLARVLDSL----------------------------------
A0A7L9BFB6      NVNLISSEIETIK-SKLFLSSVIDSL----------------------------------
A0A5C8A5B4      NSVDLEDNLAVLT-SNKIMTSTLQRL----------------------------------
A0A2E5CV79      DRSDMSNEIEVLR-SRRLAKDVVKLF---------------------------WDSNRRN
A0A2A4G4B1      SASTLEDEIQLFR-SRPLIKQMVEKH----------------------------------
A0A0P7X1V8      MGSSIENEIHVLQ-SRTFTGELAQRI----------------------------------
A0A4Y9ITE2      GKSSVDDEIAIMY-SHSLFSEIVKKF----------------------------------
A0A3N2M1H3      SNTSVYNELISLK-SPAVMYEVARRL----------------------------------
A0A4S2G8T2      SNTSVYNELISLK-SPAVMYEVARRL----------------------------------
A0A212K7W5      SNTNINNEILTFK-SPLLMQEVVQRM----------------------------------
F5IU11          SNTNINNEILTFK-SPLLMREVVQRM----------------------------------
A0A7C1QWC7      QSRNLENDINSLR-SFSLVSETIKKL----------------------------------
A0A7Z8P8P1      TGSGVENEMYILR-SHQLVREVVNRL----------------------------------
K0XJ09          SGSGVENEIYILQ-SHQLMREVVGRL----------------------------------
R5EUZ0          SGSGVENEIYILQ-SHQLMREVVGRL----------------------------------
W0EQS0          SVGSVDNEIYILQ-SHQLMREVVERL----------------------------------
A0A1Y3WE15      SGSGVDNEIYILQ-SRQLMREVVERL----------------------------------
A0A1Y4GUK3      SGSGVENEIYILQ-SRQLMREVVERL----------------------------------
A0A352Z1R7      QSNSIDAELEIIK-SRTNIEQVAKRL----------------------------------
A0A7X7BZF5      SNTKVIDEVGILQ-SPASMADVVRRL----------------------------------
A0A0A2F501      SNTNVNNELISIQ-SPTLTLEVVRRL----------------------------------
R5B7P0          VKSNVNNELHAFE-SPDIMSEVVARL----------------------------------
R5B0L5          TNSNVNDEISKLQ-SPDIMLEVAKRL----------------------------------
A0A6I1TEC0      TKSNVNNELIAIK-SPSVLLEVGKQL----------------------------------
A0A3R5XWG1      TKSNVNNELIAIK-SPSVLLEVGKQL----------------------------------
A0A5P0Y910      TKSNVNNELIAIK-SPSVLLEVGKQL----------------------------------
A0A414YFM3      TKSNVNNELIAIK-SPSVLLEVGKQL----------------------------------
A0A6A7UIA7      TKSNVNNELIAIK-SPSVLLEVGKQL----------------------------------
A0A6A7VPS3      TKSNVNNELIAIK-SPSVLLEVGKQL----------------------------------
A0A374THP7      AKSNVNNELIAIQ-SPAVLLETGKRL----------------------------------
A0A6G1VND1      AKSNVNNELIAIQ-SPAVLLETGKRL----------------------------------
A0A0A2EVS5      KSTNVHNELVSLR-SPATLLEVIKRL----------------------------------
A0A1T4NAJ7      KSTNVHNELVSLR-SPATLLEVIKRL----------------------------------
A0A255T941      SNTNIKNELSTIK-SPNLMTEVVKRL----------------------------------
A0A4P7VSV0      NKTNIQNEITTLK-SADLMEEVVRRL----------------------------------
A0A7J0AX49      NKTNIQNEITTLK-SADLMEEVVRRL----------------------------------
A0A3N2KCL3      NKTNIQNEITTLK-SADLMEEVVRRL----------------------------------
A0A2V1IJY1      NKTNIQNEITTLK-SADLMEEVVRRL----------------------------------
A0A4P7VXK7      NKTNIQNEITTLK-SADLMEEVVRRL----------------------------------
A0A1Y4CHN5      SNTNVNNEVIALQ-SPAIMTDVVKRL----------------------------------
A0A7Y5JED7      SNTNINNELLTIS-SPTLMTEVVKRL----------------------------------
A0A1M6I2S6      SNTNINNELLTLK-SPTLMTEVVRRL----------------------------------
A0A1Y3V692      SNTNINNELLTLK-SPTLMTEVVRRL----------------------------------
F3PXM2          SNTNINNELLTLA-SPTLMTEVVKRL----------------------------------
A0A174JCE8      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A3E4JMC4      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A412SND6      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A414IEQ9      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A7K0HNT3      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A0M1W8D8      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A3R6GKX5      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A7V4S1          SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
B0NU19          SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
D4V601          SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A4Q0U3M9      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A7J5G2G2      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A7J5HH13      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A397WLT5      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A6N8DDD8      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A6A2J529      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A7S9QIA5      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A015XH67      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A078RZN2      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A6L0K5          SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A7ACT5          SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A6KY94          SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A173UQR8      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A3R6HK75      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A412B7D1      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A412VNY9      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A414LTU9      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A8B2YHC3      SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
I9Q4U4          SNTNINNELLTLK-SPTLMTEVVKRL----------------------------------
A0A373ISF0      SNTNINNELFTLK-SPALMTEVVRRL----------------------------------
U6RF62          SNTNINNELFTLK-SPALMTEVVRRL----------------------------------
A0A662ZZD5      SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A0A415NEB6      SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A7AJ60          SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A0A6A2JF01      SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A0A7J5MKN5      SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A0A015UXN7      SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A0A642KJV3      SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A0A6I2NTL0      SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A0A6I2Q447      SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A0A016E4F9      SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A0A6N3HG44      SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A0A7K0HSP7      SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A0A7K1HEJ5      SNTNINNELLTLK-SPTLMTEVVQRL----------------------------------
A0A6H9P0U9      SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
A0A108TH71      SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
I8VXH0          SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
A0A412S0N6      SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
A0A412IIJ0      SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
A0A0P0FM97      SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
R6KTP3          SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
A0A139LU87      SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
A0A1C6B3Y5      SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
A0A6L3KCD1      SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
E2NMQ4          SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
A0A412YDB9      SNTNINNELLTLK-SPTLMTEVVSRL----------------------------------
R7DY01          SNTNINNELLTLK-SPTLMTEVVSRL----------------------------------
A0A414LGK8      SNTNINNELLTLK-SPTLMTEVVSRL----------------------------------
A0A415IPQ4      SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
A0A3E5BRW7      SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
K9DXS6          SNTNINNELLTLK-SPTLMTEVVNRL----------------------------------
A0A1M6KFV3      SNTNINNELLTLK-SPTLMTEVVSRL----------------------------------
A0A1Q6G7L3      SNTNINNELLTLK-SPTLMTEVVSRL----------------------------------
A0A413H235      SNTNINNELLTLK-SPTLMTEVVSRL----------------------------------
A0A358R8U0      TTTNVNNELLVLQ-SPSIMLEVVKRL----------------------------------
R6WSB6          TTTNVNNELLVLQ-SPSIMLEVVKRL----------------------------------
A0A401LPX7      TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
A0A6G0GNY9      TNTNVYNEMGTLQ-SPDIMREVVSRL----------------------------------
A0A6I1BFM0      TNTNVYNEMGTLQ-SPDIMREVVSRL----------------------------------
A0A3A5Z900      TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
A0A7K0GW19      TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
A0A285TGL6      TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
A0A3A5RFX4      TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
A0A1Q6IUW9      TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
A0A413XDP6      TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
A0A6N8CVT6      TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
K6AP24          TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
A0A6I2NHV3      TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
A0A662ZYI7      TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
A0A078RYI7      TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
C7XEQ8          TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
D7INX6          TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
K5ZG55          TNTNVYNEMGTLK-SPDIMREVVSRL----------------------------------
A0A7Y5MWI8      TNTNVNNEIQSLQ-SPAVMLDVVKRL----------------------------------
A0A1M5B2J8      TNTNVNNEMGTLQ-SPDLMREVVTRL----------------------------------
A0A255RCT5      TNTNVNNEMGTLQ-SPDLMREVVRRL----------------------------------
A0A1Y4GLF5      SSTNVNNELLAFQ-SPAVMTEVVKRL----------------------------------
A0A1H3XSC0      SSTNVNNELVALQ-SPAVMTEVVRRL----------------------------------
A6LE40          SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A4Y1VPX5      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A6N2XMM4      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A7U8L0B4      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
B3JI46          SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A3N2N9B8      TKTDVENEIINLR-SGELMEEVVSRL----------------------------------
A0A3N2NMI0      SSTSVANEITNLR-SGDLMEEVVRRL----------------------------------
A0A359I8H7      SNTNVNNELISLS-SPAVMYEVVKNL----------------------------------
A0A3N2KA63      SNTNVNNELISLS-SPAVMYEVVKNL----------------------------------
A0A4Q0IMT7      SNTNVNNELISLS-SPAVMYEVVKNL----------------------------------
A0A7J0B660      SNTNVNNELISLS-SPAVMYEVVKNL----------------------------------
A0A3B9FAU3      DQSNVNNEMAAIQ-APSNVLETVKRL----------------------------------
A0A3C1E5L7      DQSNVNNEMAAIQ-APSNVLETVKRL----------------------------------
A0A4Q0UAV1      NSGDLANEMIVIR-SVDLLTDVVATL----------------------------------
A0A354SN68      SYMNTNDEVAIIN-SQTIALEVVQSL----------------------------------
A0A6L5XFL0      SNTNLYNEMITLK-SPTYMEEVVREL----------------------------------
A0A3N2N595      NKTNIQNEMTTFM-SSDLMTEVVKRL----------------------------------
A0A7J0ACS3      SNTNIQNEMSNLK-AKDLMEEVVRRL----------------------------------
A0A0A2DUD9      SNTNVNNELLSMK-SPMLMEEVVRRL----------------------------------
A0A3P1ZBJ5      -NTSVSNEILSFQ-SPALMEDVVKRL----------------------------------
R5FHS9          NSNYVNNELIALQ-SPSIMLEVVKRL----------------------------------
A0A413TW79      GKSNVNNELIAIQ-SPAVLLEAGKQL----------------------------------
A0A7K0AAG2      GKSNVNNELIAIQ-SPAVLLEAGKQL----------------------------------
A0A7K0ASF1      GKSNVNNELIAIQ-SPAVLLEAGKQL----------------------------------
A0A3E5E9M7      GKSNVNNELIAIQ-SPAVLLEAGKQL----------------------------------
A0A3E4SK73      GKSNVNNELIAIQ-SPAVLLEAGKQL----------------------------------
A0A415GGC6      GKSNVNNELIAIQ-SPAVLLEAGKQL----------------------------------
A0A413DBH9      GKSNVNNELIAIQ-SPAVLLEAGKQL----------------------------------
A0A495WI87      ANTNVNNEIISLQ-SPAIMTDVVKRL----------------------------------
A0A354M4S6      ANTNVNNEIISLQ-SPAIMTDVVKRL----------------------------------
R7DH52          ANTNVNNEIISLQ-SPAIMTDVVKRL----------------------------------
A0A7J5IAE7      SGTNVNNELIAFQ-SPALITEIVKRL----------------------------------
A0A016CWA4      SNTNVNNELIAFQ-SPALMTEVVKRL----------------------------------
A0A4P8LP09      SNTNVNNELIAFQ-SPALMTEVVKRL----------------------------------
A0A0M1W0V2      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A139KA16      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A174VQ92      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A1Q6HCG0      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A1Y4JYM9      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A3A5QW67      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A3A5RQE6      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A3A6BP07      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A3E5E153      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A3Q9IP20      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A412WV15      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A413ICP6      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A414KYB9      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A5B3FWR2      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A7J5QHB9      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
E5WX00          SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
K0X3P3          SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A1C6H117      SSTNVNNELITFQ-SPALMTEVVKRF----------------------------------
A0A6I1AQV4      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A5C6L2P1      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A3E4WKT5      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A3A5YY33      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A1E9CFZ7      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A373FYU5      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A3A5XBP2      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A3A6MEG9      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A3E4JP35      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A3E4KP40      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A3E4NX82      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A3E4XFU8      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A412RG70      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A412TD37      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A413GAA4      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A414M7I4      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A496BTA0      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A496D2V6      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A5C6KCA6      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A5M5AHM5      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A6I0Y5K7      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A6I1BFB8      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A6I2P5W5      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A6N8DC51      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A7J5HGP0      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A7J5HVL8      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A7J5JHD3      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A8B3EKM1      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
E5UZA2          SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A069SMG6      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
C3RFN5          SSTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A3A5Z014      SGTNVNNELITFQ-SPSLMTEVVKRL----------------------------------
A0A7J5GD93      SGTNVNNELITFQ-SPSLMTEVVKRL----------------------------------
A0A7K0HGR5      SGTNVNNELITFQ-SPSLMTEVVKRL----------------------------------
A0A078S3Q8      SGTNVNNELITFQ-SPSLMTEVVKRL----------------------------------
A0A069SJV7      SGTNVNNELITFQ-SPSLMTEVVKRL----------------------------------
A0A3E5DXI5      SGTNVNNELITFQ-SPSLMTEVVKRL----------------------------------
A0A3E5EM98      SGTNVNNELITFQ-SPSLMTEVVKRL----------------------------------
A0A6N2YYD4      SGTNVNNELITFQ-SPSLMTEVVKRL----------------------------------
I9T3G6          SGTNVNNELITFQ-SPSLMTEVVKRL----------------------------------
A0A3E4SYU0      SSTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A6LGY1          SSTNVNNELITFQ-SPALMTEVVKRL----------------------------------
K5ZSH4          SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A6A2RTB3      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A7J5PEN4      SGTNVNNELITFR-SPSLMTEVVKRL----------------------------------
A0A1M4YZ07      SGTNVNNELITFQ-SPSLMTEVVKRL----------------------------------
A0A7J5I238      SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A0P0FQW1      SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A7K0I229      SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A5M5C0W6      SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A642NJ89      SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A6L3JTQ2      SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A7J5FQU6      SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A7J4YLH7      SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A6N3AEV2      SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A6G0G4T5      SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A6L3KG29      SGTNVNNELITFQ-SPALMTEVVKRL----------------------------------
A0A1Y4PQK7      SATNVNNELIALQ-SPSVMTEVVKRL----------------------------------
A0A1Y4IH41      SATNVNNELVALQ-SPAVMTEVVKRL----------------------------------
A0A3A6AAP4      SATNVNNELVALQ-SPSVMTEVVKRL----------------------------------
A0A6I0ZRD2      SATNVNNELVALQ-SPSVMTEVVKRL----------------------------------
A0A1Y4DYA7      TGTNVNNEIQSLQ-SPAVMYDVVKRL----------------------------------
A0A1Y3X4I9      TNTNVNNEMQSLQ-SPAVMYDVVKRL----------------------------------
A0A1Y4FNK8      TSTNVNNEIQSLQ-SPSVMLDVVKRL----------------------------------
A0A355FD59      ANVNVNNELIAIQ-SPAVILETIKRL----------------------------------
A0A359CEZ9      ANVNVNNELIAIQ-SPAVILETIKRL----------------------------------
A0A353Q7B4      ANVNVNNELIAIQ-SPAVILETIKRL----------------------------------
F8X3A5          PNTNVNNELIAIQ-SPAIILETVKRL----------------------------------
A0A1M3KVR9      PNTNVNNELIAIQ-SPSIILETVKRL----------------------------------
A0A4Y9IJS3      PNTNVNNELIAIQ-SPSIILETVKRL----------------------------------
A0A416GA42      LSGNVENEILIFK-SLHLAEQVVRRL----------------------------------
A0A1T3IYP5      NVVSVKDEIIQLK-SKELMRLVVDKV----------------------------------
A0A7Z6RZU4      ANSNLANEQIMLK-SRFLMSKVINRL----------------------------------
A0A4D7K1D4      NMNALSGEMELLR-SKVFFSRLIDSL----------------------------------
A0A846MP44      WDNLIAGELEVIR-SPLIYSRIVELL----------------------------------
A0A1G9E2A9      QVENITGEIEFIK-SRLVYNRVIDSM----------------------------------
A0A098LL25      KLSTISGEIEFLK-SRYLYEKIVDRM----------------------------------
A0A6J4H627      GMANMSGEIELIR-SKLIYDEVIRRM----------------------------------
A0A6C0GJI1      MSANLSGEIELIR-SKLIYDEVIKRM----------------------------------
A0A839GQ17      EIGKLQGEVDLIK-SDLVYERLKQSM----------------------------------
A0A127B287      DLGKLQGEVDLIK-SDLVYDRLKKSM----------------------------------
A0A6P1P2P6      DLGKLQGEVDLIK-SDLVYDRLKKNM----------------------------------
A0A2T2YJE8      TLSNLSGEIEIIK-SNFTFERLQQKL----------------------------------
A0A7L7LEW0      TLSNLSGEIEIIK-SNFTYERLQEKL----------------------------------
A0A3M9N829      GAGKLQGEVDLIK-SDIVYERLKKTM----------------------------------
A0A0P0CSF9      GIGQLQGEVDLIK-SNIVFERLKKTM----------------------------------
A0A5M8QQB8      GIGKLQGEVDLIK-SNIVFERLKETM----------------------------------
A0A3M9MNC3      GIGKLQGEVDLIK-SNIVYERLKKTM----------------------------------
A0A5B6TAX2      GVGKLQGEVDLIK-SNIVYERLKKTM----------------------------------
A0A7L5A132      SSKNLAGEVELIK-SSVIYQRLRDSL----------------------------------
A0A512AYT3      SMASLSGEVELIK-SDLIYENLKRRL----------------------------------
A0A5M6CYN7      AISSLSGEIELIK-SDLIYENLKRRL----------------------------------
A0A369QP10      NLSNLSGEIEIIK-SNLTYERLQQKL----------------------------------
A0A7G7G7M4      TIANLSGEIEIIK-SNLTYERLQQKL----------------------------------
A0A126PDF2      ASSKLAGEVQLIK-SEIIYKELRDSL----------------------------------
A0A2Z3GKA1      ASSKLAGEVQLIK-SEIIYKELRDSL----------------------------------
A0A502GZP7      GASKLAGEVQLIK-SEIIYKQLRDSL----------------------------------
A0A0M3RW20      SMNNLSGEVELIK-SNLIYRQLRDSL----------------------------------
A0A495VFX4      SMNNLSGEVEFIK-SNLIYRQLRDSL----------------------------------
A0A246FQC0      NLNSLSGEIEVIK-SDIIYQRLKDSL----------------------------------
A0A372E5P8      SLTKLSGEVELIK-SDIIYSRLNDSL----------------------------------
A0A7Y7PLY0      SLTKLSGEVELIK-SDIIYSRLNDSL----------------------------------
A0A1H3EMW1      SLNKLSGEIELIK-SDIIYRRLNDSL----------------------------------
A0A1H9ZSN3      SLTKLSGEIELIK-SDIIYSRLNDSL----------------------------------
A0A7W9SXN1      SINKLSGEVELIK-SDIIYRRLKDSL----------------------------------
A0A418R9X5      TLNKLSGEVELIK-SDIIYRRLKDSL----------------------------------
A0A428JSJ3      NLNKLSGEVELIK-SDIIYRRLKDSL----------------------------------
A0A428KI59      TLNKLSGEIELIK-SDIIYRRLKDSL----------------------------------
W8F1I6          TLNKLSGEIELIK-SDIIYRRLKDSL----------------------------------
A0A1S9B3W0      SMSQLAGEVELIK-SDLIYTRLRDSL----------------------------------
A0A1W1VRL3      PGANLEGEVELIK-SNLIYRRLKDSL----------------------------------
A0A7G6YQJ9      SLNNLSGEVELIK-SDLIYRRLKDSL----------------------------------
A0A1M6R305      SISKLSGEVELIK-SNIIYRRLKDSL----------------------------------
A0A7G7W8X3      NISKLSGEVELIK-SNIIYRRLKDSL----------------------------------
A0A4Z0PHK3      SLNKLSGEVELIK-SNIIYERLKDSL----------------------------------
A0A2M9B9H9      NVNKLSGEVELIK-SNIIYQRLKDSL----------------------------------
A0A4Z0QCY9      SLNKLSGEVELIK-SNIIYQRLKDSL----------------------------------
A0A7Y0AH93      PSSKLAGEIELIK-SEITYNRLKKLI----------------------------------
A0A519SBU8      --AQLAGEVELIK-SNLTYKNLKERL----------------------------------
A0A4Q3JNZ3      --NQLAGEVELIK-SNLTYQHLKERL----------------------------------
A0A519Q9V3      --NQLAGEIELIK-SNLTYQHLKERL----------------------------------
A0A5N1J2M4      GTNQLSGEIELLK-SNLIYEKVRQSM----------------------------------
A0A519S476      PANQLAGEVELIK-SKLTYQALKERL----------------------------------
A0A4Q3JRW8      TTNQLAGEIELIK-SNLTYKNLKDRL----------------------------------
A0A519M923      PGAQLAGEVELIK-SNLTYQHLKERL----------------------------------
A0A4Z0ENW1      QASQLAGEVELIK-SGLTYKRLKQTV----------------------------------
A0A519UDB4      NSSQLSGEVELIK-SNLTYKRLKQVV----------------------------------
A0A3S0QKV1      NVNKLAGEVELIK-SDLIYSRLRDSL----------------------------------
A0A328BL48      GMSKLSGEVELIQ-SDLIYTRLRDSL----------------------------------
A0A5R8WLY4      GISKLSAEVALIQ-SDLIYTRLRDSL----------------------------------
A0A1I5WSL8      RGGKLAGEVEVIK-SNIIYRRLKDSL----------------------------------
A0A0U3JVM7      R-TKLAGEVELIK-SNIIYRRLKDSL----------------------------------
A0A1G1SSV2      R-TKLAGEVELIK-SNIIYQRLKDSL----------------------------------
A0A1G1SXV7      R-AKLAGEVELIK-SNIIYQRLKDSL----------------------------------
A0A6G8CBJ6      ELANLSGEVELIK-SNLIYRRLKDSL----------------------------------
A0A0W8EDI5      NAKNLAGEVELIK-SNLIYRKLQDSL----------------------------------
A0A3B7RBP8      NSKNLAGEVELIK-SNIIYRKLQDSL----------------------------------
A0A3R9P8H7      NLNKLSGEIELIK-SDIIYRRLKDSL----------------------------------
A0A238WIA7      TVTQLSGEMELIN-SDLIYRRLRDSL----------------------------------
A0A212UCJ7      TMTQLSGEIELIK-SDLIYRRLRDSL----------------------------------
A0A4Z0MQE1      STSQLSGEIELIK-SNLIYRRLRDSL----------------------------------
A0A4Z0PCF4      TIAQLSGEIELIK-SDLIYRRLRDSL----------------------------------
A0A6M6BED0      TIAQLSGEIELIK-SDLIYRRLRDSL----------------------------------
A0A5D6VDG1      NMNNLSGEIELIK-SNLIYRQLKDSL----------------------------------
A0A243WHR7      SGNKLSGEIELIK-SNIIYEHLKDSL----------------------------------
A0A5B8A0P6      NINKLSGEVELIK-SNIIYRRLKESL----------------------------------
A0A076HRT9      SLNKLSGEVELIK-SNIIYRRLRDSL----------------------------------
A0A4Z0PVM7      SLNKLSGEVELIK-SNIIYQRLKDSL----------------------------------
A0A1M6DHW8      SINKLSGEVELIK-SNIIYRRLKDSL----------------------------------
A0A4Q5LC61      TLNKLSGEVELIK-SNIIYRRLKDSL----------------------------------
A0A060RD97      TSSLVDNEIFILR-SASLMRTVVQKL----------------------------------
A0A350IHV0      SGANVYNEMESFT-SPDIMSVVVDRL----------------------------------
A0A2A8CVM9      QQRDLASEVGVLQYSAELASRVVAEL----------------------------------
R5RVP0          --SNVYNEIEAIS-SPDIMQTVVKRL----------------------------------
A0A2L2WX98      VGDNLKNEVFILS-SQRIMERVVDSL----------------------------------
A0A2E3R1D0      QERNLSNELLVLD-QSMPLAEAVAAR----------------------------------
A0A800J826      AEPNLQNEILVLE-EDIGLAEIAARE----------------------------------
A0A2T2USC0      SQNNLANEVLVAN-QSEAITRNVATR----------------------------------
A0A2T2V0F3      SRRNLANEVLVAN-QSEAITRNVAVR----------------------------------
A0A2T2S682      QRRSLSNQILVIN-QSEALAQEVAVR----------------------------------
A0A840DJZ8      SSASLRNELMFLR-NSQALRERVAKR----------------------------------
D5H561          SSSSLRNELMFLR-NSQALRERVAER----------------------------------
A0A2H3NWA9      GNRSLSNQLFVLR-QSRELAQRVADR----------------------------------
A0A2A8CVB6      ESRTLQNELFVLQ-QSMTIPNRVADS----------------------------------
A0A2P6C1S6      QDQTLQNELLILR-QSRTIANRVARQ----------------------------------
A0A2T2UTM4      RDQTLQNELLILR-QSRTIARRVAKR----------------------------------
R6A0L2          VGDNLKNEIFIIS-SKRLMSRVVDKL----------------------------------
R7LG80          VGDNLKNEIFILS-SKRLMTRVVDKL----------------------------------
A0A7W5UEN4      VGDNLKNEMFILT-SERLMTRVVDSL----------------------------------
G5GD56          VGDNLKNEMFILT-SERLMTRVVDSL----------------------------------
R5KD55          DNTNVNNVIAAIK-SPDVMSEVVDRL----------------------------------
A0A174QNT3      GGSSVENEVYILR-SYQLLNDVVQRL----------------------------------
A0A4S2FGS1      GGSSVENEVYILR-SYQLLNDVVQRL----------------------------------
A0A7K3KG59      GGSGVENEVYILR-SYQILNDVVQRL----------------------------------
R9I0H0          GGSGVENEVYILR-SYQILNDVVQRL----------------------------------
K5BUT9          TGTSVDNEIYILR-SHQLLREVVNRL----------------------------------
A0A174FPA3      TGTSVDNEIYILR-SHQLLREVVNRL----------------------------------
R6S9Y6          TGTSVDNEIYILR-SHQLLREVVNRL----------------------------------
A0A7J4YSB2      TGTSVDNEIYILR-SHQLLREVVNRL----------------------------------
C9KX15          TGTSVDNEIYILR-SHQLLREVVNRL----------------------------------
A0A6H0KRK1      TGSGVENEMFILR-SHQLVREVVNRL----------------------------------
R6DAG6          TGSGVENEMFILR-SHQLVREVVNRL----------------------------------
A0A3L8AAP1      TGSGVENEMFILR-SHQLVREVVNRL----------------------------------
A0A4S2AYX2      TGSGVENEMFILR-SHQLVREVVNRL----------------------------------
A0A7J0A2L4      TGSGVENEMFILR-SHQLVREVVNRL----------------------------------
A0A7K3MN31      TGSGVENEMFILR-SHQLVREVVNRL----------------------------------
R6CQ93          -KVNVANEILQFR-SKRLMREVVQRL----------------------------------
A0A3D1NQW3      QRRNVDNEIYILQ-SRRLMTEVVKQL----------------------------------
B0MT10          QRRNVDNEIYILQ-SRRLMTEVVKQL----------------------------------
R7JGW9          QRRNVDNEIYILQ-SRRLMTEVVKQL----------------------------------
A0A3D2BF46      ARRNVDNEIIVLK-SRNLMTEVVRRL----------------------------------
A0A358R538      NRRSVDNEVFILQ-SRRLMAEVVRRL----------------------------------
A0A1Y4AAB8      SRNSVDNEIYILQ-SRRLMQEVVRTL----------------------------------
A0A1Y3WWY9      TQRSVDNEIYILQ-SRRLMSEVVRRL----------------------------------
A0A1Y4U5L4      TQRSVDNEIYILQ-SRRLMSEVVRRL----------------------------------
A0A1Y3VCJ1      SRKSIDNELFILQ-SRKLMTEVVRRL----------------------------------
A0A1Y3QTW7      NRRNVDNEVYILQ-SHRLMSEVVKRL----------------------------------
R6XWY7          NRRNVDNEVYILQ-SHRLMSEVVKRL----------------------------------
A0A4Y1X9Y9      NRRNVDNEVYILQ-SHRLMSEVVKRL----------------------------------
A0A4Y1WM66      NRRNVDNEVYILQ-SHRLMSEVVKRL----------------------------------
A0A6N4GYT3      NRRNVDNEVYILQ-SHRLMSEVVKRL----------------------------------
A0A174AVF1      NRRNVDNEVYILQ-SHRLMSEVVKRL----------------------------------
A0A1Q6EIY0      NRRNVDNEVYILQ-SHRLMSEVVKRL----------------------------------
A0A5B5VN71      NRRNVDNEVYILQ-SHRLMSEVVKRL----------------------------------
E4M8L3          NRRNVDNEVYILQ-SHRLMSEVVKRL----------------------------------
I3YQ50          NRRNVDNEVYILQ-SHRLMSEVVKRL----------------------------------
R5UEY8          NRRNVDNEVYILQ-SHRLMSEVVKRL----------------------------------
A0A1H4D866      NRRSVDNEVFILQ-SRRLMTEVVKRL----------------------------------
A0A5B3G4Y7      NRRNVDNEVFILQ-SRRLMTNVVKQL----------------------------------
A0A374A9J5      NRRNVDNEVFILQ-SRRLMTNVVKQL----------------------------------
A0A5B3GQN5      NRRNVDNEVFILQ-SRRLMTNVVKQL----------------------------------
A0A1Q6E9S3      NRRNVDNEVFILQ-SRRLMTNVVKQL----------------------------------
D4IJ36          NRRNVDNEVFILQ-SRRLMTNVVKQL----------------------------------
A0A414Q925      GGSTVDNEVGIFK-SKRLMRTVVETL----------------------------------
A0A415PUS9      GGSTVDNEVGIFK-SKRLMRTVVEIL----------------------------------
A0A108TCU0      GGSTVDNEVGIFK-SKRLMRTVVETL----------------------------------
A0A413BA42      GGSTVDNEVGIFK-SKRLMRTVVETL----------------------------------
S3Y344          GGSTVDNEVGIFK-SKRLMRTVVEIL----------------------------------
A0A7J5LEW3      GGSTVDNEVGIFK-SKRLMRTVVEIL----------------------------------
A0A412TGL3      GGSTVDNEVGIFK-SKRLMRTVVETL----------------------------------
A0A413VJ33      GGSTVDNEVGIFK-SKRLMRTVVEIL----------------------------------
A0A414L0W6      GGSTVDNEVGIFK-SKRLMRTVVETL----------------------------------
A0A412DP39      GGSTVDNEVGIFK-SKRLMRTVVETL----------------------------------
A0A413ZSE8      GGSTVDNEVGIFK-SKRLMRTVVEIL----------------------------------
B0NP84          GGSTVDNEVGIFK-SKRLMRTVVEIL----------------------------------
R6AK43          GGSTVDNEVGIFK-SKRLMRTVVEIL----------------------------------
A0A412N2D9      GGSTVDNEVGIFK-SKRLMRTVVETL----------------------------------
A0A1Y4JYS9      GGSTVDNEVGIFK-SKRLMRTVVETL----------------------------------
R6LHA4          GGSTVDNEVGIFK-SKRLMRTVVETL----------------------------------
A0A3E5HPT8      GQVNVASEILQFK-SKELMRKVIDRL----------------------------------
C6IJ48          GQVNVASEILQFK-SKELMRKVIDRL----------------------------------
Q8A3U2          GQVNVASEILQFK-SKELMRKVIDRL----------------------------------
A0A3R6S1H6      TKSSVDNEVLVFQ-SRNLMIEVVRRL----------------------------------
A0A3R6SD81      TKSSVDNEVLVFQ-SRNLMIEVVRRL----------------------------------
A0A354WXN6      GSRNVDNEVLVFK-ANRLMEMVVKRL----------------------------------
A0A7G1HW11      VRSSAETEMLIFQ-SYRLMQDVVSQL----------------------------------
R5IP14          VRSSAETEMLIFQ-SYRLMQDVVSQL----------------------------------
A0A316SZX7      IKSNVDNEILLFE-SKRLMEEVVRLL----------------------------------
A0A1Y4AIY1      IQRNVDNEVIVFK-TYRLMEKVARRL----------------------------------
A0A0J6CIR2      VKSNVDNEVLVFK-SKRLMSVVAERL----------------------------------
A0A3D8HG59      MKSSVDNEVLVFQ-SRQLMQNVVKRL----------------------------------
A0A3R6S408      MKSSVDNEVLVFQ-SRQLMQNVVKRL----------------------------------
F3ZRU7          LKSSVDNEILIFQ-SNSLLREVSTRL----------------------------------
A0A1C5Q1F3      IQSTVDNEVLIFK-SKRLMIEVARKL----------------------------------
R7A239          IQSTVDNEVLIFK-SKRLMIEVARKL----------------------------------
A0A3R6HIK7      LQRNVDNEVIVFK-AYRLMEMVARRL----------------------------------
K5ZVW7          LQRNVDNEVIVFK-AYRLMEMVARRL----------------------------------
A0A1Y4D5Z0      LQRNVDNEVIVFK-TYRLMETVARRL----------------------------------
A0A413VXJ7      GKRNVDNEVLIFQ-SRHLMEEVARRL----------------------------------
I9RSN9          GKRNVDNEVLIFQ-SRHLMEEVARRL----------------------------------
U6RJK5          GKRNVDNEVLIFQ-SRHLMEEVARRL----------------------------------
A0A1Q6GA32      GKRNVDNEVLIFQ-SRHLMEEVARRL----------------------------------
I9RPU6          GKRNVDNEVLVFQ-SRHLMEEVARRL----------------------------------
I8YFS5          GKRNVDNEVLVFQ-SRHLMEKVARRL----------------------------------
A0A7J4XCM0      GKRNVDNEVLVFQ-SRHLMEKVARRL----------------------------------
I8Y597          GKRNVDNEVLVFQ-SRHLMEKVARRL----------------------------------
A0A1Q6GBF5      GKRNVDNEVLVFQ-SRHLIEEVARRL----------------------------------
I8YFZ3          GKRNVDNEVLVFQ-SRHLMEEVAHRL----------------------------------
A0A7J4XFW0      GKRNVDNEVLVFQ-SRHLMEEVARRL----------------------------------
A0A1Q6GDH2      GKRNVDNEVLVFQ-SRHLMEEVARRL----------------------------------
U6RSB0          GKRNVDNEVLVFQ-SRHLMEEVARRL----------------------------------
I9GXM2          GKRNVDNEVLVFQ-SRHLMEEVARRL----------------------------------
I9SIK1          GKRNVDNEVLVFQ-SRHLMEEVARRL----------------------------------
A0A7J4XIJ5      GKRNVDNEVLVFQ-SRHLMEEVARRL----------------------------------
I9TP59          GKRNVDNEVLVFQ-SRHLMEEVARRL----------------------------------
R5S343          VKSNVDNEVQVFK-STRLMSSVVRKL----------------------------------
A0A1M6K7I9      GARSVDNELLVFQ-SRSIMENVVRRL----------------------------------
A0A5M6A8C8      GARSVDNELLVFQ-SRSIMENVVRRL----------------------------------
A0A7J4XCJ1      GKRNVDNEVLVFQ-SRNLMEKVARRL----------------------------------
A0A7J4XNQ7      GKRNVDNEVLVFQ-SRYLMEKVARRL----------------------------------
A0A3R5ZMK1      TKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
A0A7K1HMX0      TKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
A0A1Y3ZIA4      TKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
K5Y1A4          TKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
A0A7K1HDC0      SKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
A0A3R6K8X4      TKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
A0A6N8D6C8      TKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
A0A3R6BKI7      TKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
A0A412M2W1      TKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
K5ZX55          TKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
A0A415BDM7      SKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
A0A1Q6I3T6      SKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
A0A414XX40      SKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
A7AEU7          SKRNVDNEVLVFK-SRRLMTEVARNL----------------------------------
A0A5F0U645      MKRSVDNELLVFK-SKQLMKSVVKRL----------------------------------
K5ZBN2          MKRSVDNELLVFK-SKQLMKSVVKRL----------------------------------
A0A0J6CKW3      MKRSVDNELLVFK-SKQLMKSVVKRL----------------------------------
A0A0F5IQM7      MKRSVDNELLVFK-SKQLMKSVVKRL----------------------------------
A0A496CDT3      MKRSVDNELLVFK-SKQLMKSVVKRL----------------------------------
A0A6G1ZKM3      MKRSVDNELLVFK-SKQLMKSVVKRL----------------------------------
S0GLB0          MKRSVDNELLVFK-SKQLMKSVVKRL----------------------------------
A0A3R6NLC1      MKRSVDNELLVFK-SKQLMKSVVKRL----------------------------------
A0A416WYC9      MKRSVDNELLVFK-SKQLMKSVVKRL----------------------------------
A0A7W7AX81      MKRSVDNELLVFK-SKQLMKSVVKRL----------------------------------
A0A0F5IT40      VKSNVDNEVLVFK-SKRLMSVVAERL----------------------------------
A0A496CX20      VKSNVDNEVLVFK-SKRLMSVVAERL----------------------------------
A0A5F0UBI0      VKSNVDNEVLVFK-SKRLMSVVAERL----------------------------------
A0A6G1ZHG0      VKSNVDNEVLVFK-SKRLMSVVAERL----------------------------------
S0GSI7          VKSNVDNEVLVFK-SKRLMSVVAERL----------------------------------
K5YB65          VKSNVDNEVLVFK-SKRLMSVVAERL----------------------------------
A0A0F5IWP9      VKSNVDNEVLVFK-SKRLMSIVAERL----------------------------------
A0A0F5IZT8      VKSNVDNEVLVFK-SKRLMSIVAERL----------------------------------
A0A417LKQ2      VKSNVDNEVLVFK-SKRLMNIVAERL----------------------------------
A0A416TME1      VKSNVDNEVLVFK-SKRLMNIVSERL----------------------------------
A0A7W7F3X3      VKSNVDNEVLVFK-SKRLMNIVSERL----------------------------------
A0A416XPE8      VKSNVDNEVLVFK-SKRLMNIVSERL----------------------------------
A0A3B0C2S4      PGINLDNEIQVLK-SYRILGQVVEAL----------------------------------
A0A5M8NYX7      KIGSFDNEIEVLQ-SKTLMKEVVDSL----------------------------------
A0A1M6GR99      RSQNIQNELEIIK-SFPNISQTVRNL----------------------------------
A0A7C5M4P4      AYNLMSSEIELIT-SRLFFNKIIESV----------------------------------
A0A1W2GF52      DIKGIAGEIEILR-SRLFFSKVVDAI----------------------------------
A0A2G5L7B8      DIKGLSGEIEILK-SRLFASQVVDAV----------------------------------
A0A2D8JJW3      DKK-LEDKIRNIG-LRPIAQATIDKL----------------------------------
A0A6B5PK86      KKDVFFSEVELLR-SELLFKQAMNSL----------------------------------
A0A2G2F510      RDNQLSGVVELLR-SELLFKRAVKSL----------------------------------
A0A316JZ08      LDDDISAVVELLR-SELLFERAVDKL----------------------------------
A0A2W1NDY9      ENN-LSADVELLR-SPFLMEKVLMNL----------------------------------
A0A5C8AQR5      KSN-VSSEIELLK-SQFLFEKAIDKL----------------------------------
A0A1G0CI31      KDN-IASEIELLR-SELLFGMAVERL----------------------------------
A0A556N0M0      IDD-ISSEIELLR-SQLLFEMAISKM----------------------------------
F2IKD6          RID-ISTEIELLR-SQLLFDMTIARM----------------------------------
A0A1I7BM74      DGN-ISKEIELLR-SQFLFEEALKRL----------------------------------
A0A2G2FJ17      DAS-ISREIELLR-SEYLFEKALDRL----------------------------------
A0A1H4ADG3      GASNVDNERDILV-SYPLIHQVVSDL----------------------------------
A0A5B8VUR8      RSSTVDNEREILV-SYPLIHQVVTDL----------------------------------
A0A1V5IPN7      GKNSINNQIELMR-SKPILNAAYEIM----------------------------------
A0A7G7G5F9      STKNIHNEIEVLK-AKSLMQRVLTEL----------------------------------
A0A2N3U785      TNQSINDEIELLK-SISLMQRVVKDL----------------------------------
A0A0D3L8Q3      SHTNIDNEIRLLK-SQSLMHRVFNEL----------------------------------
A0A519U664      STRSIDNEIEVLR-SASIMERVAKEL----------------------------------
A0A519MA34      TTRSVDNEIEVLK-SASIMERVAKEL----------------------------------
A0A519UCX0      STRSIDNEMEVLK-SVSIMERVAKEL----------------------------------
A0A5B6TJH8      STKVVDNEILILD-SKTLMERVVQDL----------------------------------
A0A7Y0AA98      STKNIDNEIEVIK-SKSLMTRVVKEL----------------------------------
A0A0E3ZG78      ATKNINNEIEVLQ-SESLMKRVASEL----------------------------------
A0A1I6BRK6      ATRNVDNEIEVLK-SKGLMERVIREL----------------------------------
A0A243WAB1      SARNIDNEIEVLR-SESLMEKVVSEL----------------------------------
A0A6G8C8X6      STRNIDNEIEVLR-SKTLMERVVNEL----------------------------------
A0A4R5DL69      GKSNVDNEVEILK-SRTLIESVVSDL----------------------------------
A0A1M4YED3      SNKVVENEIVVLS-SKGLMEKVISNL----------------------------------
A0A7T9DAA2      NSADIEDQIAVLR-SQTMLRKTLTNL----------------------------------
A0A7Y5V8S3      SGGDIEDHIAILT-SRTNVEKTLKRL----------------------------------
A0A126PFG0      TPKVVESEMEILK-SRKLMLSVVRDL----------------------------------
A0A7V5VRT5      IESMTDAYVELFS-TYELVDKIVREM----------------------------------
A0A3M1N7Z3      PEVLTEAYLELWS-RYDLIAQVVQQL----------------------------------
A0A7V1R2A1      MEVFTEAYLELWS-RYDLIAQVVEQL----------------------------------
A6EBM4          TATNMQSESFAIE-SRHLLLNAIKRL----------------------------------
A0A7X8C760      AYQSVNNQVIILN-SYDLIGKVVDSL---------------------------------P
A0A501VZX6      SNKIVENEIKVLY-SRTLLKEVVEDL----------------------------------
A0A399SH26      SKKIVENEIEVIQ-SRALMKKVALGL----------------------------------
A0A501W1A9      ANKTVENELNVLR-SYALMSQVVREL----------------------------------
A0A0E3ZGV6      SNKIVENELNVLR-SNALMNQVVNEL----------------------------------
A0A1I2N4S1      TNKTVENELNVLR-SSALMSQVVHKL----------------------------------
A0A2T5YE44      TNKTVENELNVLR-SSALMSQVVHKL----------------------------------
A0A4Q8RX32      GRNTFHNSLLTLQ-ARPLLEKVLNKL----------------------------------
A0A1M6TTV4      --KGLSGEIEILK-SRLFASQVVNAV----------------------------------
K0X1U5          GGGSVNDEILVIS-SHSLIREMVQRL----------------------------------
R5EXK3          GGGSVNDEILVIS-SHSLIREMVQRL----------------------------------
A0A401UAP7      NLNLISGEIELIQ-SNLFLSRVIDSL----------------------------------
A0A523GAC0      NLNNISGEIELIK-SKLFFDKVIKTL----------------------------------
L8JW09          NLNIISGEIELIK-SKLFFSKVIETV----------------------------------
A0A364XUP5      NADLISGEIEIIR-SKLFLNIVLDSI----------------------------------
A0A1M5RLA9      NFNLLSGEIELIE-SRLFLGRVLDSS----------------------------------
A0A385SFR9      NLNLLSGEIELIE-SRLFLGRVLDSS----------------------------------
A0A5M4A9J4      GKQNLENQIQILQ-SWTLVSKAVNEM----------------------------------
A0A5M4B1C7      GKQNLENQRQILK-SWTIISDAVDKL----------------------------------
A0A0D3LFR6      TMEGMSSEIELIK-SKLFLNKVLSAL----------------------------------
M7N6D4          NMNGMSEEIELIK-SKLFLTRVLKAV----------------------------------
A0A5C7MX19      DNAAINREIQLFK-SRLLVERIVDSL----------------------------------
A0A1M5BA90      SNKTVDNEVEVIQ-SGELLNEVIDSL----------------------------------
A0A512B879      SNKIVENEIEVIQ-SKELLKKVVNSL----------------------------------
A0A559PPI3      SKKIVENEIKVIQ-SPDIMKKVVDTL----------------------------------
A0A1T5CS78      SKKIVENEIEVLK-SRDLMKSVVRDL----------------------------------
A0A0Q9Z8F1      SKKIVENEIEVLK-SRDLMKAVVRDL----------------------------------
A0A2N0U0M7      SKKIVENEIEVLK-SRDLMKSVVRDL----------------------------------
A0A1Q3ZMZ7      SKKSLSSNIELLK-SPVLFENAIKKL----------------------------------
A0A7Y3KMD1      GDDELEAAVELMR-SKLFLERIFNAL----------------------------------
A0A3C1ITV0      TGIDVYNELQAFQ-SPLLMQDVVNQL----------------------------------
R7HN19          TGIDVYNELQAFQ-SPLLMQDVVNQL----------------------------------
A0A2W2AFF7      GKGNVDNEVEIFK-SRSLMESVVRDM----------------------------------
A0A845PZ37      NYISVTDEILQLK-SKELMRQTVDRI----------------------------------
A0A077ENE7      NTISVKDEILQLK-SKELMRLVVDKV----------------------------------
A0A854FRG7      SSVSVKDEILQLK-SKELLRQAIDRT----------------------------------
T0NN57          SSVSVKDEILQLK-SKELLRQAIDRT----------------------------------
R7PCR1          VGNSLQDETFILQ-SYRLMERVVSRL----------------------------------
A0A2N5YXE2      --TDLAPVIELVR-SNEFLKTVVASL----------------------------------
A0A2U1FKU2      --SEVENELLVFK-AKRLTAIVVDKL----------------------------------
A0A0A2F954      --SEVENEILLLK-SKRLTAVVVDKL----------------------------------
A0A0A2FW91      --SEVENEILLLK-SKRLTAVVVDKL----------------------------------
A0A2D2N2N1      --SEVENEILMLK-SKRLTAIVVDKL----------------------------------
Q7MWZ2          --SEVENEILMLK-SKRLTAIVVDKL----------------------------------
A0A212FSE5      --SEVENEILMLK-SKRLTAIVVDKL----------------------------------
T2NDT6          --SEVENEILMLK-SKRLTAIVVDKL----------------------------------
A0A1R4AFZ0      --SEVENEILMLK-SKRLTAIVVDKL----------------------------------
A0A1R4DVZ7      --SEVENEILMLK-SKRLTAIVVDKL----------------------------------
A0A1V9FHD0      TKNIVENEMEVIH-SRKLITDVINQL----------------------------------
A0A4V4H170      TKNIVENEMEVIH-SRKLMEKVVEQL----------------------------------
A0A1V9F098      TKNIVENEMEVIH-SRKLMEKVVEQL----------------------------------
A0A4R2VU64      TKNIVENEIEVIH-SRKLMEKVIEGL----------------------------------
A0A0K8QSK7      QNNNIYNQIEVLK-SWPIIEEAVQEL----------------------------------
A0A7C0WKI7      QMTEINNQVEILK-SRSLAGKVVDDL----------------------------------
A0A1T5K9D4      S-VSMSNEMLQLK-SKTLMAEVVKDL----------------------------------
A0A5M4B212      GTQNTENQIQILK-SWTQIRKTLEHF----------------------------------
A0A3D1KEX9      VTDNLKNEIFILQ-SRRLMEMVVERM----------------------------------
A0A358Y7S2      ----LNQEVELLR-SELLINKVIEKL----------------------------------
A0A2J6HHN3      --EDIYRKIEVMR-SPVFIRRVVSRL----------------------------------
A0A1Y3WMT8      GGGSVNDEILVIS-SHTIIREMVQRL----------------------------------
A0A1Y4GQU1      GGGSVNDEILVIS-SHTIIREMVQRL----------------------------------
A0A6A0R272      QYNKILTEARIIS-SRTMIEKALEKL----------------------------------
A0A1V5W8T5      GQTSITNLIELIR-SREFLKRTLHKL----------------------------------
A0A2T8HKA9      ----VASEILQLK-SKELMRHTIATI----------------------------------
A0A1X7J248      NLNTLSGEVELIR-SKLFLKQVINKL----------------------------------
E4TQD2          NLNTLSGEVELIR-SKLFLKQVIDKL----------------------------------
A0A2I0QZ80      TEGSIAKEIELLR-SQLLFKKAIKQL----------------------------------
A0A3E1F1A3      SDGSIAKEIELLR-SQMLFEKAVQNL----------------------------------
A0A2U2XBJ3      KEGTIAKEIELLR-SQLLFEKAVADL----------------------------------
A0A4Q4KU94      KDGSIAKEIELLR-SQLLFEKAIDDL----------------------------------
A0A3B8INU3      NLNYLSGEIELLK-SRLFFSQVISAL----------------------------------
A0A7V6V2N8      ----IYTSVEVLS-SPEFIKRVIKQL----------------------------------
A0A414ZBF2      GNSKVDNEMGFFK-SKRLMMEVTRQL----------------------------------
A0A7X9D3Q8      ARASVDNEIGVFK-SKRLMYDVAKQL----------------------------------
A0A1Q3Q573      DPTEINREMQVLK-STMLLGKIADKL----------------------------------
A0A662BAY3      SDRNIFNQLIVLT-STPILNRTLEEL----------------------------------
A0A4U3L369      --STVNNEEEILL-TRSLMYRVVKDL----------------------------------
A0A4S8HY23      IKNIVENEMEVIH-SRKLMEKVVEQL----------------------------------
A0A1V9F383      TKNIAENEIEVIH-SRKLMEQVIVQL----------------------------------
G8TRZ6          MQNIAENEIEVLQ-SKTLMTDVVNQL----------------------------------
A0A357YNR3      RRNNADNEVEILK-KTMIVEKVVRDL----------------------------------
A0A7X6YKE8      RRNNADNEVEILK-KTMIVEKVVRDL----------------------------------
A0A5E8AX52      GVNSLSGEIELLK-SNLFFSRVVEAI----------------------------------
A0A1V6CN82      SYQGIQNQMIIMK-SQPVVAKAIREL----------------------------------
A0A1M4XZ45      SMQNIYNQMVVLS-STPIISRTLNEL----------------------------------
A0A399D319      SMRNIYNQMVILN-STPIVSRTLNEL----------------------------------
A0A7Y1YS85      GRKDMDNEIEILK-SRPLLTAAVEKI----------------------------------
F4KK08          YSDDVSNQIIILG-TERVVSETVRRL----------------------------------
A0A7V5VE02      E-TMINNQVEILK-SRTLAETVLQRL----------------------------------
A0A496LCF9      DKTNIENQILLLR-SQDLIARTIDSL---------------------------------P
A0A5P2G2A9      K-SSVDNELLILQ-TRDLMHKVVVDM----------------------------------
A0A3C0ZQC7      AVKNIKNELEILK-SRSLAEAVAVRL----------------------------------
A0A3N2N6F7      --TNVANELLAFQ-SPALIGDVIERL----------------------------------
A0A419VXB7      SDVKLSNHIEILK-SFSLNYEVLENL----------------------------------
A0A1Q6E6I7      N-SGVEDELLIMG-SRSIMERVVAEL----------------------------------
A0A3B9CNN6      N-SGVEDELLIMG-SRSIMERVVAEL----------------------------------
R5X290          N-SGVEDELLIMG-SRSIMERVVAEL----------------------------------
C3J7R8          GRSAVENELFILK-TDFLIDQVIERL----------------------------------
A0A1G8BVM8      GSNSVYNEMGILK-SRQLMLQVVEQL----------------------------------
A0A1I1FXP9      S-SNLSGEIELIT-SFMLYNKVIDKM--------------------------------GE
A0A4P7VVU7      S-ANVNNEMLAFQ-SPAIIADVIQRL----------------------------------
A0A2V1ILM4      S-ANVNNEMLAFQ-SPAIIADVIQRL----------------------------------
A0A3N2L0E8      S-ANVNNEMLAFQ-SPAIIADVIQRL----------------------------------
A0A3N2LFC5      S-ANVNNEMLAFQ-SPAIIADVIQRL----------------------------------
A0A7K3KWJ8      S-ANVNNEMLAFQ-SPAIIADVIQRL----------------------------------
A0A3N4H5N3      TSIKLENEIEKLK-SKSLMNEAVISN----------------------------------
A0A2P8EAX2      TTVKLDNEIEKLR-SKSLLNEAVISK----------------------------------
A0A4V2F6N9      TTVKLDNEIEKLR-SKSLLNEAVISK----------------------------------
A0A838T9G8      N-IDIEKDIQIMK-SNMIIDRVIDSL----------------------------------
A0A3B9FXJ0      NVDRLNEEMTVIT-SKSYKYNALQEL----------------------------------
A0A848SUJ0      DESEINREIQLLK-SRLILDRALATL----------------------------------
A0A847ALW2      SMRNINNQMEVLH-STPIIAKTLSEL----------------------------------
B2RKZ8          N-SEVENEILVLK-SKRLTAIVVDKL----------------------------------
A0A0K2J6Z0      N-SEVENEILVLK-SKRLTAIVVDKL----------------------------------
A0A212GC82      N-SEVENEILVLK-SKRLTAIVVDKL----------------------------------
A0A0E2M2Y7      N-SEVENEILVLK-SKRLTAIVVDKL----------------------------------
A0A829KSZ7      N-SEVENEILVLK-SKRLTAIVVDKL----------------------------------
R5GSU5          AGDQLQNEIFILQ-SHRLIERVVTRL----------------------------------
A0A7X8I6A2      DNKNLNKTITLLR-SKEFIKRCMTQL----------------------------------
A0A0A2G557      N-DKIENEIIIFR-TERLLSRVIDEL----------------------------------
A0A1T4PT95      T-DKIENEIIIFR-THNMLSQVVNRL----------------------------------
A0A6I6JYY3      SMRNIFNQMVIMH-STPLITRTINEL----------------------------------
A0A651GU15      EEKTLSAELELLR-SKLLLQETVKRL----------------------------------
A1ZKR2          G-GNLVGEIEFIR-SQIIFNDVINAM----------------------------------
A0A1Q3GX01      N-GNLIGEIEFIR-SQIIFNAVINTM----------------------------------
A0A349DQI4      N-GNLIGEVEFIR-SQIIFNSVIDAM----------------------------------
A0A4P5TMD1      DHNELQKNIQIMK-SNVILDRVIDQL----------------------------------
A0A3Q9FR88      D-GKLESEMALIT-SGVTYNRVIDSL---------------------------------I
A0A553GEX3      D-GKLESEMALIT-SGVTYNRVIDSL---------------------------------I
A0A150ADJ9      D-GKLESEMALIT-SGVTYNRILDSL---------------------------------I
A0A7X9P1P7      D-GKLESEMALIT-SGVTYNRILDSL---------------------------------I
A0A7X8SM94      E-GKLESEMALIT-SGVTYNRIIDSL---------------------------------I
A0A1S1Z228      E-GKLESEMALIT-SGVMYERITDSL---------------------------------I
A0A1B1FWQ4      E-GKLESEMALIT-SGVMYERIVDSL---------------------------------I
A0A7X9Y5D2      E-GKLESEMALIT-SGVMYERIVDSL---------------------------------I
A0A7X8ISG0      E-NSTLKSVNFIT-SPIFLNKVLDSL----------------------------------
A0A2N3IIZ0      PIDNIAGELEVIR-SPLIYEEVLKNI----------------------------------
A0A7X8Q7Q7      D---LYRKIEVMQ-SPVFIHRVLSKL----------------------------------
A0A2N2WFW8      D---IYRKIEIMR-SPVFMERVIEKL----------------------------------
A0A1F3IU95      D---IYRKIEIMR-SPVFMQRVVSNL----------------------------------
A0A3D0VUF6      D---IYRKIEIMR-SPVFMQRVVSNL----------------------------------
A0A7K3WUF2      N-T-ILAEIELMK-SKLLVTRVVKQL----------------------------------
A0A497D5Z2      SDYNLFNQMAVLK-SKPLIRRVVDEL----------------------------------
A0A662B170      SDYNLFNQMAVLK-SKPLIRRVVDEL----------------------------------
A0A7X7FWB7      E-NDILKSVNLIT-SPIFLNQVLDNL----------------------------------
A0A7X8DM61      DASSILKAVNFIT-SPVFLDEVLDKL----------------------------------
A0A3M1CDV2      N-NKVAEAIEQIR-SKTFLERIINNL----------------------------------
A0A1F3SJM1      G-DQLSSVVELLR-SELLFERAIAHL----------------------------------
A0A2G2EB96      D-NEISSVVELLR-SELLFERALNKL----------------------------------
A0A2G6PRA9      E-NDMSGVVELLR-SELLFEKALNKL----------------------------------
A0A7Y7A9N2      E-NDMSGVVELLR-SELLFEKALNKL----------------------------------
A0A6C1QGZ7      E-EDIARQLELMR-SDVFLQRALSRL----------------------------------
A0A7W1EH85      D-NVLAEAIEQIR-SKVFLRRVVEKL----------------------------------
A0A2E3XZI5      S-TNLKSELAIIK-SQKSILRLIKKL----------------------------------
A0A6I7QXV0      D-DDVSREIQIIR-SRLLVARALEHL----------------------------------
A0A7Y3V126      N-D-IQAEVEFLK-SKFLLERALKKL----------------------------------
A0A7Y5C3U1      N-D-IQAEVEFLK-SKFLLERALKKL----------------------------------
A0A2M7NLQ9      T-NFLVGEIELIL-SRSVYEEAVKRL----------------------------------
I4AFR0          I-NFLSGEIELIL-SRSVYEEAVKKL----------------------------------
A0A2N2Y3E5      F-N-PNQTIELIR-SKEFIKRVIKSL----------------------------------
A0A2D9D7T6      D-GGLSKYIELLK-SEFIFEKAVERL----------------------------------
A0A1F3PPL5      N-T-IAQTIELLR-SQEFLKRVFSKL----------------------------------
A0A357QK06      N-T-IAQTIELLR-SQEFLKRVFSKL----------------------------------
A0A7X9JJJ8      E-VNLNQTIELLR-SPEFLKRTFNKL----------------------------------
A0A522EYA6      Q-NDIAKSIELLR-AKVFFKRVLATL----------------------------------
A0A662AEA4      K-D-ISNVIELLR-SKEFLKRVFKKL----------------------------------
A0A0S2HYK8      N-KKLNKTIALIR-SKEFLKRTFAKL----------------------------------
A0A2N5ZWN6      N-KKLSKTIALIR-SKEFLKRTFSKL----------------------------------
A0A2E0FJ09      D-ETLTGDVELLR-SPLLMEKTVASL----------------------------------
A0A1F3FZ62      E-NDISKTVELLK-SKVFLKRVFSKL----------------------------------
A0A1F3K211      E-NDISKTVELLK-SKVFLKRVFSKL----------------------------------
A0A7Y1UDU0      K-TKLAGDIELIR-SNIISQRAAAKL----------------------------------
A0A1V6I2U9      K-D-LAPVIELIR-SNEFLKTVVEVL----------------------------------
A0A2H0B957      I-N-SIQTIELIR-SKEFLKKTFNKL----------------------------------
A0A1F3CFW6      I-N-SMQVIELIR-SKEFLKRTFNKL----------------------------------
A0A2M7E2T8      I-N-SMQIIELIR-SKEFLKRTFNKL----------------------------------
A0A2M7NC69      I-N-SMQIIELIR-SKEFLKRTFNKL----------------------------------
A0A1F3KLL5      P-SELPAVMELIR-SNEFLKRVFVKL----------------------------------
A0A359D1M1      P-SELPAVMELIR-SNEFLKRVFVKL----------------------------------
A0A0F2NS19      E-D-VAKDVELLR-SKLLLKRALSKL----------------------------------
A0A2A5H8X6      E-D-VAKDVELLR-SKLLLKRALSKL----------------------------------
A0A2H0GAU8      E-D-IAKDVELLK-SKLLFKRALSKL----------------------------------
A0A2M8FTK1      E-D-IAKDVELLK-SKLLFKRALSKL----------------------------------
A0A2A5B3B0      N-S-LSKDVEILK-SKLLFKRALKRI----------------------------------
A0A5C6RXM7      N-T-IDKDIEILR-SKLLFRRAISRL----------------------------------
A0A7W1FWM4      S-NGLAEGVELLR-SQVFLKRVLSKL----------------------------------
A0A7T9QP55      N-T-LQADVQLLR-SKFFVAKAVALL----------------------------------
A0A7V9MK11      Q-D-ISREIELLR-SKLFLKQALTNL----------------------------------
A0A1F3C1M2      N-E-LAQIIELIR-STEFLKRTFNKL----------------------------------
A0A1F3DS87      N-E-LAQIIELIR-STEFLKRTFNKL----------------------------------
A0A7Y5QSG1      K-N-LLADVELLR-SKFFIDKVLRKI----------------------------------
A0A7Y2EX06      E-Q-ISSEIELLK-SNFLINRTLDKL----------------------------------
A0A7Y7NV14      --D-LAKKIELLK-SPVFLQRVFSKL----------------------------------
A0A6A0R6K9      N-D-ISAELEILQ-SNIIVERAIKSL----------------------------------
A0A2E7CT70      T-N-INSEVELLK-SQIIIDKAIKKL----------------------------------
A0A2D5V560      T-N-LNSEIALMN-SEKAIEKVIRDI----------------------------------
A0A2D7K5A8      T-N-LNSEIALMK-SQKAIDRVIEDL----------------------------------
A0A2E1XQ82      T-N-LKSEIALMK-SQKAIDRLVEDL----------------------------------
A0A1F3K695      T-N-LAHVVELIR-SKEFLKRAFEKL----------------------------------
A0A353KZR1      T-N-LAHVVELIR-SKEFLKRAFEKL----------------------------------
A0A2N2WYB5      D-D-ISKVIELLR-SKEFLKRAFSNL----------------------------------
A0A1F3K4G0      N-D-ILKVIELLR-SKEFLKRTFLKL----------------------------------
A0A356H8Y3      N-D-ILKVIELLR-SKEFLKRTFLKL----------------------------------
A0A351HSA6      N-D-ILKVIELLR-SKEFLKRTFLKL----------------------------------
A0A2A4PYG9      D---VAGEIELIR-SRAFLSNALSRI----------------------------------
A0A350JJ90      A-D-ISKDIELLR-SPEFFKRVIANL----------------------------------
A0A2A4YXP3      S-NSLAKDVEILR-SKLLFKRALRKI----------------------------------
A0A1F3R158      K-EDVEKDVELLK-SKFLLKRALSKL----------------------------------
A0A2M8ADX2      Q-EDVAKDVELLK-SKFLLKRSLLKL----------------------------------
A0A1J5B2H0      D-NNLAKQIELMR-SSLFLNRVISKL----------------------------------
A0A1V5N756      Q-VDLAKKVELLN-SSMFLSRVFSKL----------------------------------
A0A4P5U6G4      A-D-LQRDIQVMK-SNLIMDRVLDKL----------------------------------
A0A2E2TFD1      N-EDMMSDLEVIR-SKEFLKTIFKKL----------------------------------
A0A2E4ELE6      K-ADISADIEIIR-SKEFLKTIFAKL----------------------------------
A0A2A3UE91      G-NVLAEAIEQIR-SKVFLKRVVEKL----------------------------------
A0A7V9SRJ9      N-NLIAEAIEQIK-SRVFLRRVVEKL----------------------------------
A0A2E6SYP1      N---LVAEMSRLK-SKKMLSEALADL----------------------------------
A0A2E5RLE8      N---LVAELSRLK-SKKMLSEALNTL----------------------------------
A0A2E7TQF6      N---LVAELSRLK-SKKMLSEALNTL----------------------------------
A0A2E6GVY9      N---LVAELSRLK-SKKMLSEALKTL----------------------------------
A0A2A5FYT6      Q-D-ISGDIEFLR-SKEFFKNILNTL----------------------------------
A0A6N9NIX1      G-D-ISGEIELLK-SKYLILKTIENL----------------------------------
A0A1F3Q014      D-NGLAEGIELLK-SKVFLKRVLSQL----------------------------------
A0A2D5KD44      N-D-ISSEIELLK-SPLLMEATLEKL----------------------------------
A0A7Y2F301      N-N-LSSDIELLR-SRFMIYRTLEGL----------------------------------
A0A0E3V905      HKQVVENEIEILR-SFTLMNRVADKL----------------------------------
A0A553ETH6      NINVISGEIELIQ-SRLFFNKVIDNI----------------------------------
A0A2D4ZVH1      VGSTIANELQIMK-SRKLSYDLAERI----------------------------------
A0A6P1P355      SNNIVENEIKVIQ-SRALARKVIDEL----------------------------------
A0A3D0MYJ7      AGSDIQSQIAIMK-GYYVREIVAKSI----------------------LDTLNTIKDIDK
A0A4Q5WS95      SKKIVENEVVVLQ-SRNLADKIVAGL----------------------------------
A0A7V9RTA1      SNKIVENEIEVIK-SRKLMEEVVKDL----------------------------------
A0A5C8KAD6      TSKIVENEINVIH-SRTLMKQVVNKL----------------------------------
A0A5N1J695      SSKLVDNEIKVIQ-SRGLMNKVVDTL----------------------------------
L8JI02          SDTELEDEIGILK-SYGMVSNAIRSL----------------------------------
A0A1Q3PII2      ATSSVENEIEILR-SRTLLSQVVADL----------------------------------
A0A351BXT2      TDRYISNEIEVLK-SYKIREMVAENL----------------------------------
A0A2K8Z965      PKQVVENEIEVLR-SFTLMNRVVEKL----------------------------------
A0A418M8U8      PKKVVENETEILR-SYTLMNRVVDKL----------------------------------
I2GTA4          PKKVVENETEILR-SYTLMNRVVDKL----------------------------------
A0A2K8ZAJ2      QTKLVENEIEILR-SYSLMDRVVTNL----------------------------------
A0A368JPA3      PGKVIENEIEILK-SSSLMKKVVDSL----------------------------------
A0A5N1JI29      PGKVIENEIEILK-SNSLMKKVVDSL----------------------------------
A0A7K0EGC9      PSKVVENEIEILK-SNSLMKKVVDSL----------------------------------
A0A3P1BT12      PSKVVENEIEILK-SNSLMKKVVDSL----------------------------------
A0A3P1CI15      PNKVVENEIEILK-SNSLMKKVVDSL----------------------------------
A0A4R8CUK1      QQTVVDNELEILT-SNSLMKKVIDTL----------------------------------
A0A7Y6XX71      GEEYFQTQYEILK-SRHIAEKVVDKL----------------------------------
A0A2H3NSN0      IQPELSSEIGILT-NSGSLAMRVITE----------------------------------
A0A800J4N3      QQSPIADELYILQ-NAEDLAEATAEE----------------------------------
A0A2P6C324      EQRDLSSEIGLLK-NSGELARRVVST----------------------------------
A0A7V2F6E1      EQRALSNELGILR-NSAELATRVATA----------------------------------
A0A1M6XHU0      ERRALSNELGILK-NSAELATRVAKA----------------------------------
G2SF81          ERRALSNELGILR-NSAELATRVAEA----------------------------------
A0A5S9EYW1      ERRALSNELGILR-NSAELATRVAEA----------------------------------
D0MHQ9          ERRALSNELGILR-NSAELATRVAEA----------------------------------
A0A662AH13      DDRFIANEIEILK-SYRLRTMVANAL----------------------------------
A0A5C7QA01      QKSPAQAEIEILR-SRLVLGEVIGQLHLDVQLSSQEDNFKNRFLGANHYDTVYSNDAVIF
A0A3D3LS70      SDRSISNEIEILK-SQTIRSLTATAL----------------------------------
A0A1G1TM36      GNNVLESEMEILR-SRRLMQQVVQTLGLSTV---------------------YQRPGRFS
A0A1G7ZF38      ATSSVENEIEILK-SRTLLSQIISDLHLTTQ---------------------YFAAGTLK
C6VS52          AAGSVENEIEILK-SRTLLGQVVDDLHLTIQ---------------------YFASGLLK
                                                                            

A0A7V5RJC2      G---LVL-----------------------------------------------------
A0A7C1LGX3      Q---LDV-TYY-------------LKGKLKDK----------------------------
A0A1T5MMH4      N---IDV-TYY-------------SKGEVLNH----------------------------
A0A2W4R1L8      K---IDV-SYY-------------NKGEILNY----------------------------
A0A7L9BFB6      N---LHV-SYY-------------SIGKILNT----------------------------
A0A5C8A5B4      D---FGI-SYY-------------ATKYFLKQ----------------------------
A0A2E5CV79      SLALFNTRKYY------------------PRG----------------------------
A0A2A4G4B1      N---LHI-RYY-------------SKNSFKNT----------------------------
A0A0P7X1V8      ----YDE-RYQ------------------PDG----------------------------
A0A4Y9ITE2      Q---LNK-TYI------------------VKENFLKKK----------------------
A0A3N2M1H3      H---LDM-NYD-------------RLGGFHPV----------------------------
A0A4S2G8T2      H---LDM-NYD-------------RLGGFHPV----------------------------
A0A212K7W5      K---LDE-DYS-------------TKGFFRNK----------------------------
F5IU11          K---LDE-DYS-------------IKGFFRNR----------------------------
A0A7C1QWC7      G---LEI-AYYRESDNLLKQTSQIYNSNYYTV----------------------------
A0A7Z8P8P1      H---LDV-SYE-------------EDGFFRNT----------------------------
K0XJ09          H---LDV-TYQ-------------VKNWLHYD----------------------------
R5EUZ0          H---LDV-TYQ-------------VKNWLHYD----------------------------
W0EQS0          H---LDV-AYR-------------VKDWLHYK----------------------------
A0A1Y3WE15      H---LDV-TYQ-------------VKDFLHNK----------------------------
A0A1Y4GUK3      N---LDV-TYQ-------------VKDFLHNK----------------------------
A0A352Z1R7      H---LDW-QVT-------------KKSKDLDF----------------------------
A0A7X7BZF5      S---LDV-EYW-------------VDGSFHDE----------------------------
A0A0A2F501      G---LNV-EYY-------------ADGRYYKE----------------------------
R5B7P0          R---LYM-SYT-------------VDGTFHRN----------------------------
R5B0L5          S---LDE-TYN-------------IDGRFHKD----------------------------
A0A6I1TEC0      K---LNV-DYA-------------VDGRFHRN----------------------------
A0A3R5XWG1      K---LNV-DYA-------------VDGRFHRN----------------------------
A0A5P0Y910      K---LNV-DYA-------------VDGRFHRN----------------------------
A0A414YFM3      K---LNV-DYA-------------VDGRFHRN----------------------------
A0A6A7UIA7      K---LNV-DYA-------------VDGRFHRN----------------------------
A0A6A7VPS3      K---LNV-DYA-------------VDGRFHRN----------------------------
A0A374THP7      K---LDV-DYA-------------IDGAFHKE----------------------------
A0A6G1VND1      K---LDV-DYA-------------IDGAFHKE----------------------------
A0A0A2EVS5      N---LDI-DYK-------------VDGRFHRS----------------------------
A0A1T4NAJ7      N---LDI-DYK-------------VDGRFHRS----------------------------
A0A255T941      R---LNE-VYS-------------VREGLKRV----------------------------
A0A4P7VSV0      N---LDM-NYY-------------IPGRFHDV----------------------------
A0A7J0AX49      N---LDM-NYY-------------IPGRFHDV----------------------------
A0A3N2KCL3      N---LDM-NYY-------------IPGRFHDV----------------------------
A0A2V1IJY1      N---LDM-NYY-------------IPGRFHDV----------------------------
A0A4P7VXK7      D---LDM-NYY-------------IPGRFHDV----------------------------
A0A1Y4CHN5      H---LDV-NYK-------------VDGRFYDR----------------------------
A0A7Y5JED7      G---LNE-TYT-------------IRKGLKRV----------------------------
A0A1M6I2S6      G---LNE-TYT-------------VRKGLKDV----------------------------
A0A1Y3V692      G---LNE-TYT-------------VRKGLKDV----------------------------
F3PXM2          G---LDE-TYT-------------VRRGLRRV----------------------------
A0A174JCE8      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A3E4JMC4      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A412SND6      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A414IEQ9      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A7K0HNT3      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A0M1W8D8      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A3R6GKX5      G---LNE-IYT-------------IRRGLKRI----------------------------
A7V4S1          G---LNE-IYT-------------IRRGLKRI----------------------------
B0NU19          G---LNE-IYT-------------IRRGLKRI----------------------------
D4V601          G---LNE-IYT-------------IRRGLKRI----------------------------
A0A4Q0U3M9      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A7J5G2G2      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A7J5HH13      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A397WLT5      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A6N8DDD8      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A6A2J529      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A7S9QIA5      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A015XH67      G---LNE-IYT-------------IRRGLKRI----------------------------
A0A078RZN2      G---LNE-IYT-------------IRRGLKRI----------------------------
A6L0K5          G---LNE-IYT-------------IRRGLKRI----------------------------
A7ACT5          G---LNE-IYT-------------IRRGLKRI----------------------------
A6KY94          G---LNE-IYT-------------VRRGLKRI----------------------------
A0A173UQR8      G---LNE-IYT-------------VRRGLKRI----------------------------
A0A3R6HK75      G---LNE-IYT-------------VRRGLKRI----------------------------
A0A412B7D1      G---LNE-IYT-------------VRRGLKRI----------------------------
A0A412VNY9      G---LNE-IYT-------------VRRGLKRI----------------------------
A0A414LTU9      G---LNE-IYT-------------VRRGLKRI----------------------------
A0A8B2YHC3      G---LNE-IYT-------------VRRGLKRI----------------------------
I9Q4U4          G---LNE-IYT-------------VRRGLKRI----------------------------
A0A373ISF0      R---LNE-TYT-------------VRKGLKNV----------------------------
U6RF62          R---LNE-TYT-------------VRKGLKNV----------------------------
A0A662ZZD5      G---LNE-TYT-------------VRKGLKDV----------------------------
A0A415NEB6      G---LNE-TYT-------------VRKGLKDV----------------------------
A7AJ60          G---LNE-TYT-------------VRKGLKDV----------------------------
A0A6A2JF01      G---LNE-TYT-------------VRKGLKDV----------------------------
A0A7J5MKN5      G---LNE-TYT-------------VRKGLKDV----------------------------
A0A015UXN7      G---LNE-TYT-------------VRKGLKDV----------------------------
A0A642KJV3      G---LNE-TYT-------------VRKGLKDV----------------------------
A0A6I2NTL0      G---LNE-TYT-------------VRKGLKDV----------------------------
A0A6I2Q447      G---LNE-TYT-------------VRKGLKDV----------------------------
A0A016E4F9      G---LNE-TYT-------------IRKGLRTI----------------------------
A0A6N3HG44      G---LNE-SYT-------------VRKGLRTI----------------------------
A0A7K0HSP7      G---LNE-SYT-------------VRKGLRTI----------------------------
A0A7K1HEJ5      G---LNE-SYT-------------VRKGLRTI----------------------------
A0A6H9P0U9      G---LNE-TFT-------------IRKGLKNV----------------------------
A0A108TH71      G---LNE-TFT-------------IRKGLKNV----------------------------
I8VXH0          G---LNE-TFT-------------IRKGLKNV----------------------------
A0A412S0N6      G---LNE-TYT-------------IRKGLKNV----------------------------
A0A412IIJ0      G---LNE-TFT-------------IRKGLKNV----------------------------
A0A0P0FM97      G---LNE-TFT-------------IRKGLKNV----------------------------
R6KTP3          G---LNE-TFT-------------IRKGLKNV----------------------------
A0A139LU87      G---LNE-TFT-------------IRKGLKNV----------------------------
A0A1C6B3Y5      G---LNE-TFT-------------IRKGLKNV----------------------------
A0A6L3KCD1      G---LNE-TFT-------------IRKGLKNV----------------------------
E2NMQ4          G---LNE-TFT-------------IRKGLKNV----------------------------
A0A412YDB9      G---LNE-TFT-------------VRRGLKKV----------------------------
R7DY01          G---LNE-TFT-------------VRRGLKKV----------------------------
A0A414LGK8      G---LNE-VFT-------------VRKGLKKV----------------------------
A0A415IPQ4      G---LNE-TFT-------------IRRGLKSV----------------------------
A0A3E5BRW7      G---LND-IFT-------------VRRGLKNV----------------------------
K9DXS6          G---LND-IFT-------------VRRGLKNV----------------------------
A0A1M6KFV3      G---LNE-SFT-------------VRRGLKNV----------------------------
A0A1Q6G7L3      G---LNE-SFT-------------VRRGLKNV----------------------------
A0A413H235      G---LNE-SFT-------------VRRGLKNV----------------------------
A0A358R8U0      H---LDM-NYH-------------IPGRFQDR----------------------------
R6WSB6          H---LDM-NYH-------------IPGRFQDR----------------------------
A0A401LPX7      H---LEM-NYQ-------------TDGRFHKQ----------------------------
A0A6G0GNY9      H---LEM-NYQ-------------TDGRFHKQ----------------------------
A0A6I1BFM0      H---LEM-NYQ-------------TDGRFHKQ----------------------------
A0A3A5Z900      H---LEM-NYQ-------------TDGRFHKQ----------------------------
A0A7K0GW19      H---LEM-NYQ-------------TDGRFHKQ----------------------------
A0A285TGL6      H---LEM-NYQ-------------TDGRFHKQ----------------------------
A0A3A5RFX4      H---LEM-NYQ-------------TDGRFHKQ----------------------------
A0A1Q6IUW9      H---LEM-NYQ-------------TDGRFHKQ----------------------------
A0A413XDP6      H---LEM-NYQ-------------TDGRFHKQ----------------------------
A0A6N8CVT6      H---LEM-NYQ-------------TDGRFHKQ----------------------------
K6AP24          H---LEM-NYQ-------------TDGRFHKQ----------------------------
A0A6I2NHV3      H---LEM-NYQ-------------TDGRFHKQ----------------------------
A0A662ZYI7      H---LEM-NYQ-------------TDERFHKQ----------------------------
A0A078RYI7      H---LEM-NYQ-------------TDGRFHKQ----------------------------
C7XEQ8          H---LEM-NYQ-------------TDGRFHKQ----------------------------
D7INX6          H---LEM-NYQ-------------TDGRFHKQ----------------------------
K5ZG55          H---LEM-NYQ-------------TDGRFHKQ----------------------------
A0A7Y5MWI8      H---LDI-SYH-------------TDGGFYKK----------------------------
A0A1M5B2J8      H---LEM-NYL-------------VEGRFHKN----------------------------
A0A255RCT5      H---LDM-NYL-------------VDGRFHKV----------------------------
A0A1Y4GLF5      Q---LGT-TYY-------------LPGKFHRV----------------------------
A0A1H3XSC0      H---LDM-NYT-------------VPGRFHRQ----------------------------
A6LE40          R---LDM-NYF-------------VPGKFHRK----------------------------
A0A4Y1VPX5      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A6N2XMM4      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A7U8L0B4      R---LDM-NYF-------------VRGKFHRQ----------------------------
B3JI46          R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A3N2N9B8      K---LDM-DYY-------------SHGRFHDE----------------------------
A0A3N2NMI0      N---LDV-NYF-------------RKGRFHNI----------------------------
A0A359I8H7      G---LDV-NYS-------------TPGRFHEK----------------------------
A0A3N2KA63      G---LDV-NYS-------------TPGRFHEK----------------------------
A0A4Q0IMT7      G---LDV-NYS-------------TPGRFHEK----------------------------
A0A7J0B660      G---LDV-NYS-------------TPGRFHEK----------------------------
A0A3B9FAU3      N---LDM-NYT-------------MEGRWHKN----------------------------
A0A3C1E5L7      N---LDM-NYT-------------MEGRWHKN----------------------------
A0A4Q0UAV1      D---LNN-MYY-------------VDNGLHNK----------------------------
A0A354SN68      H---LEV-SYS-------------ISDRLKEI----------------------------
A0A6L5XFL0      H---LDM-QYA-------------VKGTFHDN----------------------------
A0A3N2N595      K---LDM-NYF-------------KDGTFHKE----------------------------
A0A7J0ACS3      G---LDI-NYY-------------HSGRFHDV----------------------------
A0A0A2DUD9      E---LWT-SYE-------------APGAFHDH----------------------------
A0A3P1ZBJ5      H---LDI-DYS-------------VEGFFHDI----------------------------
R5FHS9          G---LNV-SYL-------------TDSTFYKG----------------------------
A0A413TW79      K---LDV-NYS-------------EGGTFHPV----------------------------
A0A7K0AAG2      K---LDV-NYS-------------VDGTFHPV----------------------------
A0A7K0ASF1      K---LDV-NYS-------------EDGTFHPV----------------------------
A0A3E5E9M7      K---LDV-NYS-------------EDGTFHPV----------------------------
A0A3E4SK73      K---LDV-NYS-------------EDGTFHPV----------------------------
A0A415GGC6      K---LDV-NYS-------------EDGTFHPV----------------------------
A0A413DBH9      K---LDV-NYS-------------EDGTFHPV----------------------------
A0A495WI87      H---LNM-DYH-------------VDGGFYRE----------------------------
A0A354M4S6      H---LNM-DYH-------------VDGGFYRE----------------------------
R7DH52          H---LNM-DYH-------------VDGGFYRE----------------------------
A0A7J5IAE7      R---LDM-NYF-------------FPGKFHQQ----------------------------
A0A016CWA4      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A4P8LP09      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A0M1W0V2      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A139KA16      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A174VQ92      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A1Q6HCG0      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A1Y4JYM9      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A3A5QW67      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A3A5RQE6      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A3A6BP07      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A3E5E153      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A3Q9IP20      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A412WV15      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A413ICP6      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A414KYB9      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A5B3FWR2      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A7J5QHB9      R---LDM-NYF-------------VPGKFHRQ----------------------------
E5WX00          R---LDM-NYF-------------VPGKFHRQ----------------------------
K0X3P3          R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A1C6H117      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A6I1AQV4      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A5C6L2P1      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A3E4WKT5      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A3A5YY33      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A1E9CFZ7      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A373FYU5      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A3A5XBP2      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A3A6MEG9      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A3E4JP35      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A3E4KP40      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A3E4NX82      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A3E4XFU8      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A412RG70      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A412TD37      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A413GAA4      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A414M7I4      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A496BTA0      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A496D2V6      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A5C6KCA6      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A5M5AHM5      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A6I0Y5K7      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A6I1BFB8      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A6I2P5W5      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A6N8DC51      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A7J5HGP0      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A7J5HVL8      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A7J5JHD3      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A8B3EKM1      R---LDM-NYF-------------VRGKFHRQ----------------------------
E5UZA2          R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A069SMG6      R---LDM-NYF-------------VRGKFHRQ----------------------------
C3RFN5          R---LDM-NYF-------------VPGKFHRK----------------------------
A0A3A5Z014      H---LDM-NYF-------------VPGKFHRQ----------------------------
A0A7J5GD93      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A7K0HGR5      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A078S3Q8      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A069SJV7      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A3E5DXI5      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A3E5EM98      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A6N2YYD4      R---LDM-NYF-------------VPGKFHRQ----------------------------
I9T3G6          R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A3E4SYU0      R---LDM-NYF-------------VPGKFHRQ----------------------------
A6LGY1          R---LDM-NYF-------------VPGKFHRQ----------------------------
K5ZSH4          R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A6A2RTB3      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A7J5PEN4      R---LDM-NYF-------------VRGKFHRQ----------------------------
A0A1M4YZ07      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A7J5I238      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A0P0FQW1      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A7K0I229      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A5M5C0W6      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A642NJ89      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A6L3JTQ2      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A7J5FQU6      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A7J4YLH7      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A6N3AEV2      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A6G0G4T5      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A6L3KG29      R---LDM-NYF-------------VPGKFHRQ----------------------------
A0A1Y4PQK7      H---LDM-SYY-------------APGRFHDR----------------------------
A0A1Y4IH41      H---LDM-SYY-------------APGRFHDR----------------------------
A0A3A6AAP4      H---LDM-SYY-------------APGRFHDR----------------------------
A0A6I0ZRD2      H---LDM-SYY-------------APGRFHDR----------------------------
A0A1Y4DYA7      H---LNI-NYY-------------TKGVFYNH----------------------------
A0A1Y3X4I9      H---LNI-NYS-------------TDGTFYKQ----------------------------
A0A1Y4FNK8      H---LDI-NYY-------------TDGGFYKK----------------------------
A0A355FD59      H---IDV-DYQ-------------INGPFHRK----------------------------
A0A359CEZ9      H---IDV-DYQ-------------INGPFHRK----------------------------
A0A353Q7B4      H---IDV-DYQ-------------INGPFHRK----------------------------
F8X3A5          H---LDV-NYQ-------------IKDAFYKK----------------------------
A0A1M3KVR9      H---LDV-NYQ-------------IKDSFYKK----------------------------
A0A4Y9IJS3      H---LDV-NYQ-------------IKDSFYKK----------------------------
A0A416GA42      D---LDV-CYQ------------------VKG--FWRP-T--------------------
A0A1T3IYP5      G---ADK-SYK------------------IHS--GLRD-Y--------------------
A0A7Z6RZU4      G---LET-EYS------------------MKD--GFRR-K--------------------
A0A4D7K1D4      D---LDV-TIR------------------TTF-GSLKN-E--------------------
A0A846MP44      P---LRV-SYH------------------AEG--RILE-K--------------------
A0A1G9E2A9      D---LAV-SYY------------------VVG--DVVN-S--------------------
A0A098LL25      K---MNV-SYF------------------AYG--NILY-E--------------------
A0A6J4H627      D---LAV-SYF------------------AYGRSRIKN-E--------------------
A0A6C0GJI1      D---MSV-SYY------------------AYG--QILE-E--------------------
A0A839GQ17      P---LQT-SYY------------------VKA--RVLD-A--------------------
A0A127B287      P---LQV-SYH------------------VEA--RILE-V--------------------
A0A6P1P2P6      P---LQT-SYH------------------VEA--RVLE-V--------------------
A0A2T2YJE8      P---LDI-NYY------------------SIG--NVLN-E--------------------
A0A7L7LEW0      P---LDI-SYY------------------SIG--NVLN-E--------------------
A0A3M9N829      P---LQV-SYH------------------VDA--RVLD-A--------------------
A0A0P0CSF9      P---LQV-SYF------------------VEA--RVLD-A--------------------
A0A5M8QQB8      P---LQV-SYF------------------VEA--RVLD-A--------------------
A0A3M9MNC3      P---LQV-SYH------------------IEA--RVLD-A--------------------
A0A5B6TAX2      P---LQV-SYH------------------VEA--RVLD-A--------------------
A0A7L5A132      D---LDV-NYF------------------AEG--TVLA-S--------------------
A0A512AYT3      N---LNV-SYY------------------ALG--NVLS-E--------------------
A0A5M6CYN7      N---LNV-SYY------------------ALG--NVLS-E--------------------
A0A369QP10      P---LDI-SYY------------------AIG--NILN-E--------------------
A0A7G7G7M4      P---LDI-SYY------------------AIG--NILN-E--------------------
A0A126PDF2      D---LYV-NYY------------------VQG--TVLE-S--------------------
A0A2Z3GKA1      D---LYV-NYY------------------VQG--TVLE-S--------------------
A0A502GZP7      N---LNV-NYY------------------VQG--TVLE-S--------------------
A0A0M3RW20      E---LDV-NYY------------------AQG--TVLE-S--------------------
A0A495VFX4      E---LDV-NYY------------------AQG--TVLE-S--------------------
A0A246FQC0      D---LDV-NYY------------------VQG--TVLE-S--------------------
A0A372E5P8      A---LDV-NYY------------------VQG--TVLE-T--------------------
A0A7Y7PLY0      A---LDV-NYY------------------VQG--TVLE-T--------------------
A0A1H3EMW1      A---LDV-NYY------------------VQG--TVLE-T--------------------
A0A1H9ZSN3      A---LDV-NYY------------------VQG--TVLE-T--------------------
A0A7W9SXN1      N---LSV-SYY------------------AQG--TVLE-N--------------------
A0A418R9X5      T---LDV-NYY------------------VQG--TVLE-S--------------------
A0A428JSJ3      E---LDV-NYY------------------VQG--TVLE-S--------------------
A0A428KI59      A---LDV-NYY------------------VQG--TVLE-S--------------------
W8F1I6          A---LDV-NYY------------------VQG--TVLE-S--------------------
A0A1S9B3W0      P---LDV-NYY------------------AEG--TVLE-T--------------------
A0A1W1VRL3      A---LDV-NYY------------------VEG--TVLE-S--------------------
A0A7G6YQJ9      M---LDV-NYY------------------AEG--TVLE-R--------------------
A0A1M6R305      D---LDV-NYY------------------AEG--TVLE-T--------------------
A0A7G7W8X3      D---LDV-NYY------------------AEG--TVLE-S--------------------
A0A4Z0PHK3      E---LDV-NYY------------------VEG--TVLE-N--------------------
A0A2M9B9H9      E---LNV-NYY------------------VEG--TVLE-N--------------------
A0A4Z0QCY9      E---LNV-NYY------------------VEG--TVLE-T--------------------
A0A7Y0AH93      P---LDI-NYY------------------AKG--TVLE-N--------------------
A0A519SBU8      A---LDV-NYY------------------VQG--TVLE-T--------------------
A0A4Q3JNZ3      A---LDV-NYY------------------VQG--TVLE-A--------------------
A0A519Q9V3      A---LDV-NYY------------------VQG--TVLE-A--------------------
A0A5N1J2M4      N---LEV-SYF------------------VRG--NVLD-Q--------------------
A0A519S476      A---LDI-NYY------------------VQG--TVLE-S--------------------
A0A4Q3JRW8      A---LDV-NYY------------------VQG--TVLE-A--------------------
A0A519M923      A---LDV-NYY------------------VQG--TVLE-A--------------------
A0A4Z0ENW1      A---LDI-NYY------------------TQG--TVLE-N--------------------
A0A519UDB4      P---LDI-NYY------------------TQG--TVLE-T--------------------
A0A3S0QKV1      P---LDV-NYY------------------AEG--TVLE-T--------------------
A0A328BL48      E---LDV-NYY------------------TEG--TVLE-T--------------------
A0A5R8WLY4      E---LDV-NYY------------------TEG--TVLE-T--------------------
A0A1I5WSL8      A---LDV-NYY------------------VQG--TVLE-A--------------------
A0A0U3JVM7      A---LDI-NYY------------------VQG--TVLE-S--------------------
A0A1G1SSV2      A---LDV-NYY------------------VQG--TVLE-S--------------------
A0A1G1SXV7      A---LDV-NYY------------------VQG--TVLE-S--------------------
A0A6G8CBJ6      A---LDV-NYY------------------VEG--TVLE-S--------------------
A0A0W8EDI5      N---LNV-SYF------------------VEG--TVLA-S--------------------
A0A3B7RBP8      N---LNV-GYF------------------VEG--TVLA-N--------------------
A0A3R9P8H7      T---LDV-NYY------------------VQG--TVLE-T--------------------
A0A238WIA7      E---LEV-AYY------------------AEG--TVLE-T--------------------
A0A212UCJ7      D---LEV-NYY------------------AEG--TVLE-T--------------------
A0A4Z0MQE1      D---LEV-NYY------------------AEG--TVLE-T--------------------
A0A4Z0PCF4      D---LEV-NYY------------------AEG--TVLE-T--------------------
A0A6M6BED0      D---LEV-NYF------------------AEG--TVLE-T--------------------
A0A5D6VDG1      D---LDV-NYY------------------SQG--TVLE-S--------------------
A0A243WHR7      A---LDV-NYY------------------VEG--TVLE-N--------------------
A0A5B8A0P6      A---LDV-NYY------------------AEG--AVLE-S--------------------
A0A076HRT9      D---LDV-NYY------------------AEG--TVLE-S--------------------
A0A4Z0PVM7      E---LNV-NYY------------------VEG--TVLE-N--------------------
A0A1M6DHW8      D---LDV-NYY------------------VEG--TVLE-N--------------------
A0A4Q5LC61      D---LDV-NYY------------------VEG--TVLE-N--------------------
A0A060RD97      D---LNV-SYS------------------YMG--RFRK-L--------------------
A0A350IHV0      G---LEA-SYV------------------EKQ--FLRS-R--------------------
A0A2A8CVM9      R---ATE-SAL------------------EEK--G-------------------------
R5RVP0          G---LET-TYV------------------EKQ--FLRS-R--------------------
A0A2L2WX98      H---LDV-DYT------------------IKE--SLHE-V--------------------
A0A2E3R1D0      L---IEA-ETV------------------PGT----------------------------
A0A800J826      V---MQY-ERD------------------PET----------------------------
A0A2T2USC0      L---DSM-ETN------------------PYT----------------------------
A0A2T2V0F3      L---DTM-ETH------------------PRT----------------------------
A0A2T2S682      L---DTM-GTH------------------PRT----------------------------
A0A840DJZ8      L---LKR-GEA------------------RRV--LTSQ-G--------------------
D5H561          L---LEQ-GEA------------------RRV--LSSQ-G--------------------
A0A2H3NWA9      M---DEM---Y------------------PEG----------------------------
A0A2A8CVB6      L---LAL-GRH------------------PET----------------------------
A0A2P6C1S6      L---QRM-GTH------------------PDT----------------------------
A0A2T2UTM4      L---QDL-GTH------------------PET----------------------------
R6A0L2          N---LDV-DYT------------------TKE--KLHS-I--------------------
R7LG80          D---LDV-DYL------------------MPV--SLHK-V--------------------
A0A7W5UEN4      G---LDV-DYT------------------TSA--GLHS-V--------------------
G5GD56          G---LDV-DYT------------------TSA--GLHS-V--------------------
R5KD55          G---LDV-SYT------------------TRG--TFYD-K--------------------
A0A174QNT3      H---LDI-NYV------------------VRN--GLRH-D--------------------
A0A4S2FGS1      H---LDV-EYT------------------LRN--GLRH-D--------------------
A0A7K3KG59      H---LDV-DYT------------------IRD--GLRR-D--------------------
R9I0H0          H---LDV-DYT------------------IRD--GLRR-D--------------------
K5BUT9          H---LDV-DYA------------------KDG--ILRD-T--------------------
A0A174FPA3      H---LDV-GYA------------------KDG--ILRD-A--------------------
R6S9Y6          H---LDV-GYA------------------KDG--ILRD-A--------------------
A0A7J4YSB2      H---LDV-GYA------------------KDG--ILRD-A--------------------
C9KX15          H---LDV-GYA------------------KDG--ILRD-A--------------------
A0A6H0KRK1      H---LDV-SYE------------------KDG--FFRN-T--------------------
R6DAG6          H---LDV-SYE------------------KEG--FFRN-T--------------------
A0A3L8AAP1      H---LDV-SYE------------------KEG--FFRN-T--------------------
A0A4S2AYX2      H---LDV-SYE------------------KEG--FFRN-T--------------------
A0A7J0A2L4      H---LDV-SYE------------------KEG--FFRN-T--------------------
A0A7K3MN31      H---LDV-SYE------------------KEG--FFRN-T--------------------
R6CQ93          H---ADV-DYR------------------VEK--GLRM-N--------------------
A0A3D1NQW3      G---LTV-QYE------------------TKD--GLRP-Q--------------------
B0MT10          G---LTV-QYE------------------TKD--GLRP-Q--------------------
R7JGW9          G---LTV-QYE------------------TKD--GLRP-Q--------------------
A0A3D2BF46      N---LHV-NYV------------------VKH--GLRT-E--------------------
A0A358R538      G---LTT-DYS------------------VRD--RLRA-R--------------------
A0A1Y4AAB8      R---LTT-GYS------------------KRS--GLRT-Q--------------------
A0A1Y3WWY9      N---LTE-AYS------------------IHE--HLRD-R--------------------
A0A1Y4U5L4      N---LTE-AYS------------------IHE--HLRD-R--------------------
A0A1Y3VCJ1      N---LTV-NYT------------------VDG--RFQD-R--------------------
A0A1Y3QTW7      H---LTV-NYS------------------VRD--GLRT-L--------------------
R6XWY7          H---LTV-NYS------------------VRD--GLRT-L--------------------
A0A4Y1X9Y9      H---LTV-NYS------------------VRD--GLRT-L--------------------
A0A4Y1WM66      H---LTV-NYS------------------VRD--GLRT-L--------------------
A0A6N4GYT3      H---LTV-NYS------------------VRD--GLRT-L--------------------
A0A174AVF1      H---LTV-NYS------------------VRD--GLRT-L--------------------
A0A1Q6EIY0      H---LTV-NYS------------------VRE--GLRT-A--------------------
A0A5B5VN71      H---LTV-NYS------------------VRE--GLRT-A--------------------
E4M8L3          H---LTV-NYS------------------VRE--GLRT-A--------------------
I3YQ50          H---LTV-NYS------------------VRE--GLRT-A--------------------
R5UEY8          H---LTV-NYS------------------VRE--GLRT-A--------------------
A0A1H4D866      D---LTV-SYS------------------VRE--RLRR-R--------------------
A0A5B3G4Y7      N---LTV-NYS------------------VSE--RLRR-R--------------------
A0A374A9J5      N---LTV-NYS------------------VSD--GLRR-R--------------------
A0A5B3GQN5      N---LTV-NYS------------------VSD--GLRR-R--------------------
A0A1Q6E9S3      N---LTV-NYS------------------VSD--GLRR-R--------------------
D4IJ36          N---LTV-NYS------------------VSD--GLRR-R--------------------
A0A414Q925      H---LDI-SYK------------------EWD--GLRK-K--------------------
A0A415PUS9      H---LDI-SYK------------------EWD--GLRK-K--------------------
A0A108TCU0      H---LDI-SYK------------------EWD--GLRK-K--------------------
A0A413BA42      H---LDI-SYK------------------EWD--GLRK-K--------------------
S3Y344          H---LDI-SYK------------------EWD--GLRK-K--------------------
A0A7J5LEW3      H---LDI-SYK------------------EWD--GLRK-K--------------------
A0A412TGL3      H---LDI-SYK------------------EWD--GLRK-K--------------------
A0A413VJ33      H---LDI-SYK------------------EWD--GLRK-K--------------------
A0A414L0W6      H---LDI-SYK------------------EWD--GLRK-K--------------------
A0A412DP39      H---LDI-SYK------------------EWD--GLRK-K--------------------
A0A413ZSE8      H---LDI-SYK------------------EWD--GLRK-K--------------------
B0NP84          H---LDI-SYK------------------EWD--GLRK-K--------------------
R6AK43          H---LDI-SYK------------------EWD--GLRK-K--------------------
A0A412N2D9      H---LNV-SYK------------------EWD--GLRK-K--------------------
A0A1Y4JYS9      H---LNV-SYK------------------EWD--GLRK-K--------------------
R6LHA4          H---LNV-SYK------------------EWD--GLRK-K--------------------
A0A3E5HPT8      H---ADV-SYM------------------VRD--GLRP-R--------------------
C6IJ48          H---ADV-SYM------------------VRD--GLRP-R--------------------
Q8A3U2          H---ADV-SYM------------------VRD--GLRP-R--------------------
A0A3R6S1H6      N---LNI-SYR------------------VEA--GLRE-I--------------------
A0A3R6SD81      N---LNI-SYR------------------VEA--GLRE-L--------------------
A0A354WXN6      H---LDI-NYS------------------IKE--GLRT-V--------------------
A0A7G1HW11      D---LDV-GYV------------------MQG--GLRD-R--------------------
R5IP14          D---LDV-GYV------------------MQG--GLRD-R--------------------
A0A316SZX7      K---LDV-NYT------------------EDM--GLQT-I--------------------
A0A1Y4AIY1      H---LDV-SYT------------------EKR--GLRT-V--------------------
A0A0J6CIR2      N---LDI-SYT------------------IKD--GLRT-E--------------------
A0A3D8HG59      K---LDI-SYT------------------QKR--GLRT-T--------------------
A0A3R6S408      K---LDI-SYT------------------QKR--GLRT-T--------------------
F3ZRU7          S---LNT-TYS------------------VRQ--GLRK-K--------------------
A0A1C5Q1F3      K---LDI-FYS------------------VKG--KFRD-W--------------------
R7A239          K---LDI-FYS------------------VKG--KFRD-W--------------------
A0A3R6HIK7      H---LDV-SYQ------------------VKR--GLRM-V--------------------
K5ZVW7          H---LDV-SYQ------------------VKR--GLRT-V--------------------
A0A1Y4D5Z0      H---LDI-SYT------------------VKQ--GLRT-V--------------------
A0A413VXJ7      H---LDI-SYK------------------IKE--GLRN-K--------------------
I9RSN9          H---LDI-SYK------------------IKE--GLRN-K--------------------
U6RJK5          H---LDI-SYK------------------IKE--GLRN-K--------------------
A0A1Q6GA32      H---LDI-SYK------------------IKE--GLRN-K--------------------
I9RPU6          H---LDM-SYK------------------VKN--GLRN-D--------------------
I8YFS5          H---LDM-SYK------------------VKN--GLRE-D--------------------
A0A7J4XCM0      H---LDM-SYK------------------VKN--GLRE-D--------------------
I8Y597          H---LDM-SYK------------------VKN--GLRE-D--------------------
A0A1Q6GBF5      H---LDM-SYK------------------VKN--GLRE-D--------------------
I8YFZ3          H---LDM-SYK------------------VKN--GLRN-D--------------------
A0A7J4XFW0      H---LDM-SYK------------------VKN--GLRN-D--------------------
A0A1Q6GDH2      H---LDM-SYK------------------VKN--GLRN-D--------------------
U6RSB0          H---LDM-SYK------------------VKN--GLRN-D--------------------
I9GXM2          H---LDM-SYK------------------VKN--GLRN-D--------------------
I9SIK1          H---LDM-SYQ------------------VKN--GLRN-D--------------------
A0A7J4XIJ5      H---LDM-SYQ------------------VKN--GLRN-D--------------------
I9TP59          H---LDM-SYQ------------------VKN--GLRN-D--------------------
R5S343          S---LEQ-IYT------------------TKR--GLCT-V--------------------
A0A1M6K7I9      S---LNM-SYK------------------VRI--GLRT-I--------------------
A0A5M6A8C8      S---LNM-SYK------------------VRI--GLRT-I--------------------
A0A7J4XCJ1      H---LDM-SYT------------------VKN--GLRD-D--------------------
A0A7J4XNQ7      C---LDM-SYK------------------IRN--GLRE-D--------------------
A0A3R5ZMK1      H---LDV-SYT------------------VKD--GLRT-V--------------------
A0A7K1HMX0      H---LDV-SYT------------------VKE--GLRT-V--------------------
A0A1Y3ZIA4      H---LDV-SYT------------------VKD--GLRT-V--------------------
K5Y1A4          H---LDV-SYT------------------VKD--GLRT-V--------------------
A0A7K1HDC0      H---LDV-SYT------------------VKD--GLRT-V--------------------
A0A3R6K8X4      H---LDV-SYT------------------VKD--GLRT-V--------------------
A0A6N8D6C8      H---LDV-SYT------------------VKD--GLRT-V--------------------
A0A3R6BKI7      H---LDV-SYT------------------VKD--GLRT-V--------------------
A0A412M2W1      H---LDV-SYT------------------VKD--GLRT-V--------------------
K5ZX55          H---LDV-SYT------------------VKD--GLRT-V--------------------
A0A415BDM7      H---LDV-SYT------------------VKD--GLRT-V--------------------
A0A1Q6I3T6      H---LDV-SYT------------------VKD--GLRM-V--------------------
A0A414XX40      H---LDV-SYT------------------VKD--GLRM-V--------------------
A7AEU7          H---LDV-SYT------------------VKD--GLRT-V--------------------
A0A5F0U645      D---LDI-SYS------------------IRE--GLRT-V--------------------
K5ZBN2          D---LDI-SYS------------------IRE--GLRT-V--------------------
A0A0J6CKW3      D---LDI-SYS------------------IRE--GLRT-V--------------------
A0A0F5IQM7      D---LDI-SYS------------------IRE--GLRT-V--------------------
A0A496CDT3      D---LDI-SYS------------------IRE--GLRT-V--------------------
A0A6G1ZKM3      D---LDI-SYS------------------IRE--GLRT-V--------------------
S0GLB0          D---LDI-SYS------------------IRE--GLRT-V--------------------
A0A3R6NLC1      D---LDI-SYS------------------IRE--GLRT-V--------------------
A0A416WYC9      D---LDI-SYS------------------IRE--GLRT-V--------------------
A0A7W7AX81      D---LDI-SYS------------------IRE--GLRT-V--------------------
A0A0F5IT40      N---LDI-SYT------------------IKD--GLRT-E--------------------
A0A496CX20      N---LDI-SYT------------------IKD--GLRT-E--------------------
A0A5F0UBI0      N---LDI-SYT------------------IKD--GLRT-E--------------------
A0A6G1ZHG0      N---LDI-SYT------------------IKD--GLRT-E--------------------
S0GSI7          N---LDI-SYT------------------IKD--GLRT-E--------------------
K5YB65          N---LDI-SYT------------------IKD--GLRT-E--------------------
A0A0F5IWP9      N---LDI-GYT------------------VKE--GLRT-V--------------------
A0A0F5IZT8      N---LDI-GYT------------------VKE--GLRT-V--------------------
A0A417LKQ2      N---LDV-SYT------------------VKE--GLRT-V--------------------
A0A416TME1      N---LDV-SYT------------------EKD--GLRT-V--------------------
A0A7W7F3X3      N---LDV-SYT------------------EKD--GLRT-V--------------------
A0A416XPE8      N---LDV-SYT------------------EKD--GLRT-V--------------------
A0A3B0C2S4      N---LDV-SYF------------------QKG-----N-I------------------KT
A0A5M8NYX7      N---LRV-AYY------------------TNG-----K-L------------------KK
A0A1M6GR99      N---LEV-SYY------------------EYK-----N-Y------------------QY
A0A7C5M4P4      Q---LSP-QYF------------------TYG-----Q-F------------------LV
A0A1W2GF52      G---MGI-SYY------------------HPG-----RSH------------------LV
A0A2G5L7B8      G---MNV-SYF------------------HPG-----RSH------------------LY
A0A2D8JJW3      S---EPVNSLF------------------LTP-----D-Y------------------KL
A0A6B5PK86      A---MNV-SIF------------------YKG-----K-I------------------LT
A0A2G2F510      S---LNV-SLY------------------SRG-----N-V------------------LT
A0A316JZ08      N---MSV-SMF------------------SRG-----K-L------------------LT
A0A2W1NDY9      N---LKI-SYF------------------SEG-----E-V------------------LI
A0A5C8AQR5      N---MNV-SLF------------------SKG-----K-I------------------LT
A0A1G0CI31      H---MNV-SLF------------------SKG-----R-I------------------LT
A0A556N0M0      N---MNV-SIF------------------AEG-----K-I------------------LT
F2IKD6          N---MNV-SVF------------------SKG-----K-I------------------LT
A0A1I7BM74      N---LEV-SHF------------------AKG-----E-F------------------LT
A0A2G2FJ17      D---LQV-SLF------------------AEG-----D-V------------------LT
A0A1H4ADG3      Q---LYL-NFS------------------TYK-----D-F------------------RS
A0A5B8VUR8      Q---LNL-SFS------------------TYK-----D-F------------------KS
A0A1V5IPN7      K----------------------------KNP-----D-W--------------------
A0A7G7G5F9      S---MDA-SYF------------------VEG-----P-I------------------KA
A0A2N3U785      S---LYV-NYY------------------VEG-----H-I------------------KT
A0A0D3L8Q3      D---LDV-TYY------------------GDG-----R-I------------------KD
A0A519U664      D---LFT-SYY------------------VEG-----K-V------------------VD
A0A519MA34      D---LFT-SYY------------------VEG-----K-I------------------ID
A0A519UCX0      D---LYT-SYY------------------VKG-----R-A------------------ID
A0A5B6TJH8      D---LFT-NYY------------------IEG-----Q-F------------------QD
A0A7Y0AA98      G---LVT-SYY------------------IEG-----K-I------------------KD
A0A0E3ZG78      S---LFI-GYY------------------IEG-----R-V------------------ND
A0A1I6BRK6      D---LVT-RYY------------------VEE-----R-I------------------TD
A0A243WAB1      N---LVA-NYY------------------VEG-----K-F------------------VN
A0A6G8C8X6      G---LFT-SYY------------------VEG-----K-V------------------KD
A0A4R5DL69      Q---LYI-SYF------------------VSG-----N-I------------------KT
A0A1M4YED3      N---LYT-EIK------------------EET-----Q-W------------------GL
A0A7T9DAA2      KDKPFGI-SYL------------------SKK-----N-Y------------------LT
A0A7Y5V8S3      D---FGI-TFY------------------EER-----R-F------------------LK
A0A126PFG0      Q---LST-LYQ------------------QRD-----H-L------------------GA
A0A7V5VRT5      G---LN------------------------------------------------------
A0A3M1N7Z3      R---LN------------------------------------------------------
A0A7V1R2A1      G---LN------------------------------------------------------
A6EBM4          Q---YHI-SFY------------------SYE-----R-L------------------LQ
A0A7X8C760      F---MKV-DYL------------------TIG-----R-F------------------KT
A0A501VZX6      K---LYA-PVF------------------EEG-----K-F------------------KT
A0A399SH26      H---LYA-PVY------------------EDT-----K-F------------------KE
A0A501W1A9      H---LYA-PIF------------------EES-----R-F------------------RT
A0A0E3ZGV6      K---LYA-PVY------------------EET-----K-L------------------RS
A0A1I2N4S1      K---LYA-PIY------------------EED-----R-F------------------KS
A0A2T5YE44      K---LYA-PIY------------------EED-----R-F------------------KS
A0A4Q8RX32      N---FSV-MYY------------------EEK-----L-L------------------YN
A0A1M6TTV4      G---MDV-SYF------------------RPG----RS-H------------------LS
K0X1U5          D---LNI-SYT------------------SKK-----N-F------------------FK
R5EXK3          D---LNI-SYT------------------SKK-----N-F------------------FK
A0A401UAP7      K---LDV-SYY------------------SVG-----E-F------------------LD
A0A523GAC0      D---LDI-SYY------------------AVG-----N-I------------------LE
L8JW09          D---LDL-SYY------------------TAG-----Q-V------------------LN
A0A364XUP5      N---LSV-SYF------------------NKG-----E-L------------------LN
A0A1M5RLA9      D---LNV-SYF------------------SVG-----R-V------------------LN
A0A385SFR9      D---LNV-SYF------------------SVG-----R-V------------------LN
A0A5M4A9J4      N---AEV-SYY------------------EVD--------------------------MG
A0A5M4B1C7      H---DEV-SYY------------------VVN--------------------------WG
A0A0D3LFR6      D---LDV-SYF------------------TQG-----K-I------------------LD
M7N6D4          D---LDV-SYF------------------EKG-----K-I------------------LD
A0A5C7MX19      P---LEM-SYF------------------KEGKT---K-F------------------IS
A0A1M5BA90      H---LYA-PIF------------------EDG-----P-I------------------VS
A0A512B879      S---LYA-PVF------------------EAT-----P-I------------------AS
A0A559PPI3      N---LYA-PVY------------------EEKDFFGLN-I------------------KS
A0A1T5CS78      D---LYA-PIY------------------EDG-----R-I------------------KA
A0A0Q9Z8F1      N---LYA-PIY------------------EDA-----G-I------------------KT
A0A2N0U0M7      N---LYA-PIY------------------EDT-----G-I------------------KT
A0A1Q3ZMZ7      D---LAV-GFF------------------NKG-----S-I------------------LT
A0A7Y3KMD1      P---MIV-SYY------------------TEG-----T-F------------------KD
A0A3C1ITV0      R---LNV-TY-------------------KSK-----N-W------------------IG
R7HN19          R---LNV-TY-------------------KSK-----N-W------------------IG
A0A2W2AFF7      Q---LNV-NYF------------------SSG-----R-V------------------KK
A0A845PZ37      G---ADI-SYK------------------VLK-----G-L------------------RE
A0A077ENE7      H---ADK-SYK------------------VHK-----G-L------------------RD
A0A854FRG7      G---SDI-SYK------------------VRY-----G-L------------------RE
T0NN57          G---SDI-SYK------------------VRY-----G-L------------------RE
R7PCR1          G---LDV-SYD------------------TKD-----G-L------------------RP
A0A2N5YXE2      P---LDV-SYY------------------RQG-----T-F------------------LY
A0A2U1FKU2      N---LDL-TLS------------------KDG-----F-W------------------RK
A0A0A2F954      D---LDV-SIS------------------KQG-----F-W------------------RN
A0A0A2FW91      D---LDV-SIS------------------KQG-----F-W------------------RN
A0A2D2N2N1      D---LDV-SIY------------------KQG-----F-W------------------RN
Q7MWZ2          D---LDV-SIY------------------KQG-----F-W------------------RN
A0A212FSE5      D---LDV-SIY------------------KQG-----F-W------------------RN
T2NDT6          D---LDV-SIY------------------KQG-----F-W------------------RN
A0A1R4AFZ0      D---LDV-SIY------------------KQG-----F-W------------------RN
A0A1R4DVZ7      D---LDV-SIY------------------KQG-----F-W------------------RN
A0A1V9FHD0      H---LYA-PVS-------------EAADFGSL-----K-M------------------HA
A0A4V4H170      Q---LYA-PVY-------------EAPDYKQG-----K-I------------------HA
A0A1V9F098      Q---LYA-PIY-------------EAAG-NKG-----K-I------------------KP
A0A4R2VU64      Y---LYA-PVY-------------EDAG-NKG-----K-L------------------KA
A0A0K8QSK7      G---FEV-SVY------------------SVG-----Q-I------------------LD
A0A7C0WKI7      ----------------------------------------------------------FN
A0A1T5K9D4      N---IDV-NYI------------------HHV-----G-L------------------RN
A0A5M4B212      N---FEV-SYL------------------QLG-----R-F------------------RT
A0A3D1KEX9      N---LDV-DYV------------------MMK-----G-L------------------QP
A0A358Y7S2      G---IHT-NLY------------------SKG-----T-I------------------LT
A0A2J6HHN3      P---LDV-SIF------------------AKG-----N-I------------------LN
A0A1Y3WMT8      E---LNK-IYT------------------SKK-----N-F------------------FN
A0A1Y4GQU1      E---LNK-VYT------------------SKK-----N-F------------------FS
A0A6A0R272      P---LDV-RYY------------------KKG-----R-F------------------SS
A0A1V5W8T5      N---LYT-SYY------------------LEG-----K-F------------------LT
A0A2T8HKA9      Q---GDI-SYS------------------KTE-----G-L------------------RN
A0A1X7J248      P---LDV-TYH------------------VIG-----R-F------------------KD
E4TQD2          P---LDV-SYH------------------VIG-----R-F------------------KN
A0A2I0QZ80      P---LQI-SLY------------------AKG-----E-F------------------LT
A0A3E1F1A3      P---LTV-SHY------------------AKG-----E-F------------------LT
A0A2U2XBJ3      P---LTV-SLY------------------AKG-----E-F------------------LT
A0A4Q4KU94      P---LNV-SLY------------------ARG-----E-F------------------LT
A0A3B8INU3      P---LQV-SYF------------------TQG-----K-I------------------LD
A0A7V6V2N8      P---LNT-SIY------------------AKG-----K-I------------------LD
A0A414ZBF2      R---LDV-SYK------------------ERN-----G-L------------------RK
A0A7X9D3Q8      R---LDV-SYK------------------IRD-----G-L------------------RD
A0A1Q3Q573      P---LDI-SYL------------------KEG-----K-S------------------KF
A0A662BAY3      D---FDI-NYY------------------SVG-----R-V------------------KS
A0A4U3L369      Q---LNV-SYY------------------KKE-----D-I------------------RT
A0A4S8HY23      H---LYA-PVF------------------EAP-----D-FKKR---------------KI
A0A1V9F383      L---LYA-PIN------------------EGP-----E-YSMG---------------KF
G8TRZ6          H---LYA-PIY------------------EGI-----D-FSQW---------------KF
A0A357YNR3      G---LYA-TYT------------------EMR-----P-LSLLARFGLKDNVPSFLIIKS
A0A7X6YKE8      G---LYA-TYT------------------EMR-----P-LSLLARFGLKDNVPSFLIIKS
A0A5E8AX52      N---YNV-SYH------------------YYG-----N-I------------------LT
A0A1V6CN82      G---FEV-SYH------------------NEG-----K-L------------------ST
A0A1M4XZ45      D---FEV-SYY------------------ALG-----R-V------------------AI
A0A399D319      D---FEV-SYY------------------AVG-----R-V------------------AV
A0A7Y1YS85      G---ANI-IYY------------------RQG-----R-I------------------KD
F4KK08          G---LDV-QYH------------------YDA-----G-L------------------RE
A0A7V5VE02      ----MQS-ELA------------------DNL-----E-I------------------LG
A0A496LCF9      Q---FSI-DFY------------------KKK-----Q-F------------------KN
A0A5P2G2A9      H---LNV-NYY------------------KRV-----P-L------------------GI
A0A3C0ZQC7      ----IKR-GYT------------------DST-----N-S------------------ER
A0A3N2N6F7      G---LRA-NYV------------------YKK-----R-L------------------RP
A0A419VXB7      G---WNV-SWY------------------RHM-----P-L------------------GD
A0A1Q6E6I7      D---ANI-VYA------------------TKS-----K-L------------------RY
A0A3B9CNN6      D---ANI-VYA------------------TKS-----K-L------------------RY
R5X290          D---ANI-VYA------------------TKS-----K-L------------------RY
C3J7R8          N---LDV-SYS------------------QSR-----G-I------------------RT
A0A1G8BVM8      G---LET-NYQ------------------VKD-----G-L------------------RF
A0A1I1FXP9      N---IHI-TYM------------------QKG-----N-F------------------VF
A0A4P7VVU7      G---LQT-DYI------------------YRH-----N-L------------------KN
A0A2V1ILM4      G---LQT-DYI------------------YRH-----N-L------------------KN
A0A3N2L0E8      G---LQT-DYI------------------YRH-----N-L------------------KN
A0A3N2LFC5      G---LQT-DYI------------------YRH-----N-L------------------KN
A0A7K3KWJ8      G---LQT-DYI------------------YRH-----N-L------------------KN
A0A3N4H5N3      K---AFI-FLY------------------DKI-----G-F------------------FK
A0A2P8EAX2      S---AFV-TFY------------------DKI-----G-I------------------FK
A0A4V2F6N9      N---AFV-TFY------------------DHN-----G-M------------------FK
A0A838T9G8      Q---LQV-SYY------------------VAG-----N-I------------------LD
A0A3B9FXJ0      P---IEI-SLI------------------ASG-----R-I------------------RN
A0A848SUJ0      P---LDV-SYF------------------RQG-----R-S------------------RF
A0A847ALW2      N---FEV-SYY------------------LTG-----P-L------------------SA
B2RKZ8          D---LDV-SIS------------------KDG-----F-W------------------RH
A0A0K2J6Z0      D---LDV-SIS------------------KDG-----F-W------------------RH
A0A212GC82      D---LDV-SIS------------------KDG-----F-W------------------RH
A0A0E2M2Y7      D---LDV-SIS------------------KDG-----F-W------------------RH
A0A829KSZ7      D---LDV-SIS------------------KDG-----F-W------------------RH
R5GSU5          K---LDV-DYS------------------VKN-----G-L------------------GQ
A0A7X8I6A2      A---FDV-RYF------------------IHG-----T-F------------------LN
A0A0A2G557      N---LRV-TYR------------------KKE-----G-L------------------RS
A0A1T4PT95      N---LRV-NYQ------------------RKE-----G-I------------------SS
A0A6I6JYY3      D---FEI-SYY------------------AVG-----R-V------------------KT
A0A651GU15      P---LKV-SYY------------------LKG-----D-I------------------LT
A1ZKR2          D---LWI-SYY------------------QQG-----N-I------------------LD
A0A1Q3GX01      D---LWV-SYY------------------EQG-----N-I------------------LE
A0A349DQI4      D---LWV-SYY------------------EQG-----N-I------------------LE
A0A4P5TMD1      P---LSI-SYF------------------NIG-----Q-I------------------LV
A0A3Q9FR88      D---LTV-TYQ------------------SVG-----D-V------------------RD
A0A553GEX3      D---LTV-TYQ------------------SVG-----D-V------------------RN
A0A150ADJ9      D---LRL-SYY------------------SVG-----E-I------------------RD
A0A7X9P1P7      D---LRL-SYY------------------SVG-----D-V------------------RD
A0A7X8SM94      D---LSV-DYH------------------SVG-----D-V------------------RD
A0A1S1Z228      D---LSV-DYY------------------SVG-----D-V------------------RD
A0A1B1FWQ4      D---LSV-EYY------------------SVG-----D-V------------------RD
A0A7X9Y5D2      D---LSV-EYY------------------SVG-----D-V------------------RD
A0A7X8ISG0      P---LDI-DYH------------------RKK-----I-I------------------RE
A0A2N3IIZ0      D---LSV-EYY------------------AEG-----R-I------------------LD
A0A7X8Q7Q7      P---VDV-SVF------------------IKG-----K-V------------------LN
A0A2N2WFW8      P---LDV-SIF------------------VKG-----N-I------------------LN
A0A1F3IU95      P---LGV-SVF------------------AKG-----N-I------------------LN
A0A3D0VUF6      P---LGV-SVF------------------AKG-----N-I------------------LN
A0A7K3WUF2      P---LEI-SYF------------------EKG-----K-V------------------LT
A0A497D5Z2      D---FEL-SYY------------------REG-----N-I------------------MT
A0A662B170      D---FEL-SYY------------------REG-----N-I------------------MT
A0A7X7FWB7      P---LNV-DYH------------------RKK-----I-I------------------RE
A0A7X8DM61      P---LDV-DYH------------------RKK-----I-I------------------RE
A0A3M1CDV2      N---LQI-SYY------------------NEG-----T-F------------------KN
A0A1F3SJM1      N---LNV-SLY------------------SRG-----K-I------------------LT
A0A2G2EB96      N---LNV-SLF------------------SRG-----Q-I------------------LT
A0A2G6PRA9      N---LSV-SLF------------------SRG-----E-I------------------LT
A0A7Y7A9N2      N---LSV-SLF------------------SRG-----E-I------------------LT
A0A6C1QGZ7      P---LDV-SYF------------------SKG-----R-V------------------LN
A0A7W1EH85      D---IGV-NYY------------------SEG-----T-F------------------RN
A0A2E3XZI5      K---LNI-LYY------------------NEG-----E-I------------------IS
A0A6I7QXV0      P---LDV-RYF------------------KEG-----R-T------------------RV
A0A7Y3V126      P---LEV-SYF------------------NKG-----Q-F------------------LS
A0A7Y5C3U1      P---LEV-SYF------------------NKG-----Q-F------------------LS
A0A2M7NLQ9      D---LNI-SYF------------------VKG-----R-W------------------WF
I4AFR0          D---LSV-SYF------------------VKG-----R-W------------------WF
A0A2N2Y3E5      P---LDV-SYY------------------SKG-----T-F------------------LE
A0A2D9D7T6      S---LYT-SVY------------------SEG-----K-L------------------LT
A0A1F3PPL5      P---IDI-QYF------------------NEG-----T-F------------------LS
A0A357QK06      P---IDI-QYF------------------NEG-----T-F------------------LS
A0A7X9JJJ8      P---LNV-TYF------------------SQG-----T-F------------------LA
A0A522EYA6      P---LKV-TYF------------------AEG-----T-F------------------KE
A0A662AEA4      P---LEI-EYY------------------TQG-----T-F------------------QS
A0A0S2HYK8      P---LDI-RYF------------------VEG-----A-F------------------LS
A0A2N5ZWN6      P---LET-RYY------------------IEG-----A-F------------------LS
A0A2E0FJ09      P---LQI-RYF------------------LEG-----K-I------------------LK
A0A1F3FZ62      N---FEV-SYY------------------IKG-----R-I------------------LN
A0A1F3K211      N---FEV-SYY------------------IKG-----R-I------------------LN
A0A7Y1UDU0      P---LNI-SYY------------------AKG-----N-F------------------LD
A0A1V6I2U9      P---LDI-SYY------------------RKG-----T-F------------------LS
A0A2H0B957      P---LGV-SYY------------------SQG-----T-F------------------LV
A0A1F3CFW6      P---LKI-SYF------------------SQG-----T-F------------------LE
A0A2M7E2T8      P---LKI-SYF------------------SQG-----T-F------------------LE
A0A2M7NC69      P---LKI-SYF------------------SQG-----T-F------------------LE
A0A1F3KLL5      P---FEI-SYF------------------SQG-----T-F------------------LS
A0A359D1M1      P---FEI-SYF------------------SQG-----T-F------------------LS
A0A0F2NS19      P---LEV-SYF------------------NQG-----K-I------------------LE
A0A2A5H8X6      P---LEV-SYF------------------NQG-----K-I------------------LE
A0A2H0GAU8      Q---LKV-SYY------------------NQG-----N-F------------------LN
A0A2M8FTK1      Q---LKV-SYY------------------NQG-----N-F------------------LN
A0A2A5B3B0      P---IDV-SYY------------------RKG-----E-I------------------LI
A0A5C6RXM7      P---LAI-SFY------------------NKG-----T-L------------------LE
A0A7W1FWM4      P---LQV-SYF------------------AEG-----T-F------------------QA
A0A7T9QP55      P---LEV-RYF------------------FRG-----Q-I------------------LT
A0A7V9MK11      P---LNV-AYF------------------NQG-----T-V------------------LE
A0A1F3C1M2      P---FQI-TYF------------------SEG-----T-F------------------LK
A0A1F3DS87      P---FQV-TYF------------------SEG-----T-F------------------LK
A0A7Y5QSG1      P---LEV-SYF------------------YKG-----Q-I------------------LT
A0A7Y2EX06      P---LTI-RYF------------------NQG-----E-I------------------LT
A0A7Y7NV14      P---LKI-SYY------------------NEG-----R-F------------------LN
A0A6A0R6K9      P---LEV-SYY------------------TQG-----Q-F------------------LT
A0A2E7CT70      N---ENV-RYY------------------SEG-----E-I------------------LT
A0A2D5V560      E---LKV-FYY------------------FEG-----E-X------------------IT
A0A2D7K5A8      N---LKV-FYY------------------FKG-----E-I------------------LT
A0A2E1XQ82      N---LKV-FYY------------------FEG-----E-I------------------LT
A0A1F3K695      P---LSI-AYY------------------SEG-----T-F------------------LT
A0A353KZR1      P---LSI-AYY------------------SEG-----T-F------------------LT
A0A2N2WYB5      P---LQV-SYF------------------SEG-----T-F------------------LS
A0A1F3K4G0      P---IQI-SYF------------------SEG-----T-F------------------LS
A0A356H8Y3      P---IQI-SYF------------------SEG-----T-F------------------LS
A0A351HSA6      P---IQI-SYF------------------SEG-----T-F------------------LS
A0A2A4PYG9      D---LGI-SYY------------------SKG-----K-I------------------LD
A0A350JJ90      P---VDV-SYY------------------AEG-----E-V------------------LN
A0A2A4YXP3      P---IDV-SYY------------------NQG-----E-I------------------LT
A0A1F3R158      P---LNV-SYF------------------NQG-----K-F------------------LT
A0A2M8ADX2      P---LEV-SYF------------------NKG-----K-F------------------LT
A0A1J5B2H0      P---LDI-SYY------------------TEG-----R-L------------------LN
A0A1V5N756      P---LDI-AYY------------------KKG-----R-F------------------LN
A0A4P5U6G4      P---LLV-SYY------------------NTG-----Q-I------------------LV
A0A2E2TFD1      P---LDI-SYF------------------NEG-----E-L------------------LN
A0A2E4ELE6      P---LTI-SYY------------------TEG-----E-F------------------LT
A0A2A3UE91      D---ISV-NYY------------------SEG-----V-F------------------KN
A0A7V9SRJ9      D---ISV-NYF------------------SEG-----T-F------------------KS
A0A2E6SYP1      K---LDV-NYY------------------SKG-----K-F------------------LN
A0A2E5RLE8      N---IDV-NYY------------------TKG-----K-F------------------LN
A0A2E7TQF6      N---IDV-NYY------------------TKG-----K-F------------------LN
A0A2E6GVY9      N---IDV-NYY------------------TKG-----K-F------------------LN
A0A2A5FYT6      D---LEV-SYF------------------SEG-----Q-V------------------MA
A0A6N9NIX1      P---MEV-SYY------------------SQG-----K-F------------------LE
A0A1F3Q014      P---LQA-SYY------------------AEG-----T-F------------------KN
A0A2D5KD44      P---LQV-SYF------------------SEG-----Q-F------------------LR
A0A7Y2F301      N---LPV-RYF------------------EQG-----T-V------------------RG
A0A0E3V905      H---LDV-RYF------------------QNT-----T-F------------------GK
A0A553ETH6      D---LNI-SYF------------------TTG-----N-V------------------LI
A0A2D4ZVH1      ------------------------------------------------------------
A0A6P1P355      G---LYA-PQF------------------EED-----K-F------------------RA
A0A3D0MYJ7      S---LYP-NLY------------------IKN-----K-E------------------NT
A0A4Q5WS95      R---LYA-PVF------------------ESG-----R-F------------------GD
A0A7V9RTA1      H---LYA-PVY------------------EEG-----K-V------------------KL
A0A5C8KAD6      S---LYA-PIY------------------EEG-----K-F------------------KS
A0A5N1J695      M---LYA-QVF------------------EED-----Q-F------------------RS
L8JI02          D---FGI-SYF------------------SKE-----S-F------------------RA
A0A1Q3PII2      H---LTT-QYF------------------ASG-----H-L------------------KT
A0A351BXT2      ---------------------------------------I------------------DT
A0A2K8Z965      H---LNV-RYY------------------EAT-----T-F------------------SK
A0A418M8U8      H---LDV-RYF------------------EKT-----A-F------------------GK
I2GTA4          H---LDV-RYF------------------EKT-----A-F------------------GK
A0A2K8ZAJ2      G---LDV-QYY------------------RPT-----R-T------------------LK
A0A368JPA3      G---LNI-RYF------------------RST-----P-F------------------GK
A0A5N1JI29      G---LNI-RYF------------------RST-----P-F------------------GK
A0A7K0EGC9      G---LNV-RYF------------------RST-----P-F------------------GK
A0A3P1BT12      G---LNI-RYF------------------RST-----P-F------------------GK
A0A3P1CI15      G---LNV-RFF------------------RST-----P-F------------------GK
A0A4R8CUK1      G---LNV-RYF------------------HKT-----A-F------------------GQ
A0A7Y6XX71      ------------------------------------------------------------
A0A2H3NSN0      ------------------------------------------------------------
A0A800J4N3      ------------------------------------------------------------
A0A2P6C324      ------------------------------------------------------------
A0A7V2F6E1      ------------------------------------------------------------
A0A1M6XHU0      ------------------------------------------------------------
G2SF81          ------------------------------------------------------------
A0A5S9EYW1      ------------------------------------------------------------
D0MHQ9          ------------------------------------------------------------
A0A662AH13      ---------------------------------------I------------------DS
A0A5C7QA01      K---DNL-KSL------------------HIK-----Q-F------------------DL
A0A3D3LS70      ---------------------------------------I------------------DS
A0A1G1TM36      A---QDL-YGK------------------SPV-----Q-L------------------TF
A0A1G7ZF38      T---TEL-YDK------------------TPY-----K-V------------------RF
C6VS52          T---TEL-YEK------------------APY-----R-V------------------RF
                                                                            

A0A7V5RJC2      ---EIDNDDDAEKRIFRQDVFSFFSTSENPVTGKYSLRFPGNG---TFALYKLPDDDDGR
A0A7C1LGX3      ---QVWDA--PFIVVKETSEELKKAQSLSVNFMANDIEVTDSNGN---------------
A0A1T5MMH4      ---ELFGNS-PIL-V-------------------------------SYKIENPAFFNQPF
A0A2W4R1L8      ---EFFGNL-PFT-V-------------------------------DYTITRPAFYGVPI
A0A7L9BFB6      ---ELHTSS-PFV-V-------------------------------EHQVNSPAYFDILF
A0A5C8A5B4      ---EQYAYP-PFF-VKLDSMA--------IQVIDVPIEVEVDRAARTYRVKAQGKNVRLY
A0A2E5CV79      ---EKYRRILKEI-----------------------------------------------
A0A2A4G4B1      ---ELFLDK-PFK-LEWLSPINDSYTFDFALLDSENFSLSINGSE---------------
A0A0P7X1V8      ---RLY----PVI-----------------------------------------------
A0A4Y9ITE2      ---LKYDNT-PVE-IVIPPMFSDTVSEPVIFKLTATKDGKVDIKLKKGRFSTIAETSGKT
A0A3N2M1H3      ---TLYGHTLPYI-VDMQGIEEQGGAS-------FKMELSADG--N-IKMREF-------
A0A4S2G8T2      ---TLYGHTLPYI-VDMQGIEEQGGAS-------FKMELSADG--N-IKMREF-------
A0A212K7W5      ---PLYKNS-PVI-VSIDSTNVNESFS-------FYIELLPQN--K-IRLANL-------
F5IU11          ---SLYKNS-PVI-VSTGPVNVNESFS-------FQIELLSQN--K-IRLSDL-------
A0A7C1QWC7      ---NIDKSHVQSI-NARFYIEALTDTT-------YRLRIAEDN----VSLYNY-------
A0A7Z8P8P1      ---SLFAES-PVE-VTFFD-PYHSFVS-------MNVTPLDVK--N-YTISNL-------
K0XJ09          ---QLYAES-PIR-VNFLD-AYTAPVS-------MEIKPLNGN--R-FLLNQL-------
R5EUZ0          ---QLYAES-PIR-VNFLD-AYTAPVS-------MEIKPLNGN--R-FLLNQL-------
W0EQS0          ---SLYAES-PIR-VNFID-PYTAPVF-------MKIRPLDDT--H-YLLKQF-------
A0A1Y3WE15      ---QLYAES-PIR-VDFLD-DYTAPVS-------MKIKPVDEN--R-FLLKQL-------
A0A1Y4GUK3      ---QLYAES-PLR-AHFLD-AYTLPVS-------MKVSPIDEN--H-YALKEL-------
A0A352Z1R7      ---KLLDFS-----------STAKTPS-------YRIEMTGADTFT--------------
A0A7X7BZF5      ---LLYGATLPIK-LQFLDLDDASSAT-------LTVDVNPEE--DSFRLKDI-------
A0A0A2F501      ---VLYGQELPYR-VKFLGLKDTDNAS-------LTLTILANG--Q-FAISNL-------
R5B7P0          ---VLYGTSLPIS-ADLLDVDENVGVG-------FTVS-ENGG--R-VTLNDF-------
R5B0L5          ---LLYGSSLPID-VDFSTLADGESGS-------VIVKINKKG--V-IVLSDL-------
A0A6I1TEC0      ---VLYGNDLPVT-VQFLTIGEEHYGS-------MTVYLKGGD--K-FELTDF-------
A0A3R5XWG1      ---VLYGNDLPVT-VQFLTIGEEHYGS-------MTVYLKGGD--K-FELTDF-------
A0A5P0Y910      ---VLYGNDLPVT-VQFLTIGEEHYGS-------MTVYLKGGD--K-FELTDF-------
A0A414YFM3      ---VLYGNDLPVT-VQFLTIGEEHYGS-------MTVYLKGGD--K-FELTDF-------
A0A6A7UIA7      ---VLYGNDLPVT-VQFLTIGEEHYGS-------MTVYLKGGD--K-FELTDF-------
A0A6A7VPS3      ---VLYGNDLPVT-VQFLTIGEEHYGS-------MTVYLKGGD--K-FELTDF-------
A0A374THP7      ---ALYGGDLPVT-VDFIGFTDDQSGS-------FQLQLKGDG--S-YVISKI-------
A0A6G1VND1      ---ALYGGDLPVT-VDFIGFTDDQSGS-------FQLQLKGDG--S-YVISRL-------
A0A0A2EVS5      ---TLYGSELPIV-VSIDRFYGALEWS-------LSVTVRGDG--M-VEVSDM-------
A0A1T4NAJ7      ---TLYGSELPIM-VSIDRFYGALEWS-------LSLTVRGDG--M-VEVSDM-------
A0A255T941      ---ELYGTS-PVE-VMMRK-QSKYPFS-------FVIKLNDEH--S-FTLYDF-------
A0A4P7VSV0      ---VAYGSNLPVR-VEMPGFAENGSAS-------FRVEVDGDG--K-VSVSDV-------
A0A7J0AX49      ---VAYGSNLPVR-VEMPGFAENGSAS-------FRVEVDGDG--K-VSVSDV-------
A0A3N2KCL3      ---VAYGSNLPVR-VEMPGFAENGSAS-------FRVEVDGDG--K-VSVSDV-------
A0A2V1IJY1      ---VAYGSNLPVR-VEMPGFAENGSAL-------FRVEVDGAG--K-VSVSDV-------
A0A4P7VXK7      ---VAYGSNLPVR-VEMPGFAENGSAL-------FRVEVDGAG--K-VSVSDV-------
A0A1Y4CHN5      ---VLYGQNLPVS-VSFLDLNDNESAS-------FTIKPAADG--T-LGFSDF-------
A0A7Y5JED7      ---QLYKVS-PVS-VMPKD-KNSI-VG-------FQIEMTDSI--K-FTLSDF-------
A0A1M6I2S6      ---GLYKSN-PVA-VSYRH-QDETPVS-------FKIDFSSKE--E-FTISDV-------
A0A1Y3V692      ---GLYKSN-PVA-VSYRH-QDETPVS-------FKIDFSSKE--E-FTISDV-------
F3PXM2          ---ELYRSA-PVA-VRFCG-KAERPVA-------FDLELTSRN--D-FLLSGF-------
A0A174JCE8      ---ELYKSS-PIL-VTYLV-DNKKNVS-------FDIEVDTQN--K-FYLSNF-------
A0A3E4JMC4      ---ELYKSS-PIL-VTYLV-DNKKNVS-------FDIEVDTQN--K-FYLSNF-------
A0A412SND6      ---ELYKSS-PIL-VTYLV-DNKKNVS-------FDIEVDTQN--K-FYLSNF-------
A0A414IEQ9      ---ELYKSS-PIL-VTYLV-DNKKNVS-------FDIEVDTQN--K-FYLSNF-------
A0A7K0HNT3      ---ELYKSS-PIL-VTYLV-DNKKNVS-------FDIEVDTQN--K-FYLSNF-------
A0A0M1W8D8      ---ELYKSS-PIL-VTYLV-DNKKNVS-------FDIEVDTQN--K-FYLSNF-------
A0A3R6GKX5      ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
A7V4S1          ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
B0NU19          ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
D4V601          ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A4Q0U3M9      ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A7J5G2G2      ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A7J5HH13      ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVDAQN--K-FYLSNF-------
A0A397WLT5      ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A6N8DDD8      ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A6A2J529      ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A7S9QIA5      ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A015XH67      ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A078RZN2      ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
A6L0K5          ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
A7ACT5          ---ELYKSS-PIL-VTYLF-DNKKSVS-------FDIEVGAQN--K-FYLSNF-------
A6KY94          ---ELYKSS-PIL-VTYLF-DDKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A173UQR8      ---ELYKSS-PIL-VTYLF-DDKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A3R6HK75      ---ELYKSS-PIL-VTYLF-DDKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A412B7D1      ---ELYKSS-PIL-VTYLF-DDKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A412VNY9      ---ELYKSS-PIL-VTYLF-DDKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A414LTU9      ---ELYKSS-PIL-VTYLF-DDKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A8B2YHC3      ---ELYKSS-PIL-VTYLF-DDKKSVS-------FDIEVGAQN--K-FYLSNF-------
I9Q4U4          ---ELYKSS-PIL-VTYLF-DDKKSVS-------FDIEVGAQN--K-FYLSNF-------
A0A373ISF0      ---GLYKAN-PVA-VTFGE-VMEKPVS-------FTIRIDSKD--A-FTISGL-------
U6RF62          ---DLYKAN-PVA-VTFGE-VMEKPVS-------FTIRIDSKD--A-FTISGL-------
A0A662ZZD5      ---ELYKSS-PLA-VTYRH-LDETPVG-------FTIDISSKE--T-FVISDM-------
A0A415NEB6      ---ELYKSS-PLA-VTYRH-LDETPVG-------FTIDISSKE--T-FVISDM-------
A7AJ60          ---ELYKSS-PLA-VTYRH-LDETPVG-------FTIDISSKE--T-FVISDM-------
A0A6A2JF01      ---ELYKSS-PLA-VTYRH-LDETPVG-------FTIDISSKE--T-FVISDM-------
A0A7J5MKN5      ---ELYKSS-PLA-VTYRH-LDETPVG-------FTIDISSKE--T-FVISDM-------
A0A015UXN7      ---ELYKSS-PLA-VTYRH-LDETPVG-------FTIDISSKE--T-FVISDM-------
A0A642KJV3      ---ELYKSS-PLA-VTYRH-LDETPVG-------FTIDISSKE--T-FVISDM-------
A0A6I2NTL0      ---ELYKSS-PLA-VTYRH-LDETPVG-------FTIDISSKE--T-FVISDM-------
A0A6I2Q447      ---ELYKSS-PLA-VTYRH-LDETPVG-------FTIDISSKE--T-FVISDM-------
A0A016E4F9      ---GLYKCN-PIA-VTYRH-LDEIPIS-------FTINLPSKK--E-FTISDV-------
A0A6N3HG44      ---GLYKCN-PIV-ITYRH-LDETPVS-------FTINLPSKK--E-FTISDV-------
A0A7K0HSP7      ---GLYKCN-PIV-ITYRH-LDETPVS-------FTINLPSKK--E-FTISDV-------
A0A7K1HEJ5      ---GLYKCN-PIV-ITYRH-LDETPVS-------FTINLPSKK--E-FTISDV-------
A0A6H9P0U9      ---DLYKVS-PVT-ITFCD-KIEVPLS-------FTIKFSSKE--A-FAISEL-------
A0A108TH71      ---DLYKVS-PVT-ITFCD-KIEVPLS-------FTIKFSSKE--A-FAISEL-------
I8VXH0          ---DLYKVS-PVT-ITFCD-KIEVPLS-------FTIKFSSKE--A-FAISEL-------
A0A412S0N6      ---DLYKVS-PVT-ITFCD-KIEVPLS-------FTIKFSSKE--A-FAISEL-------
A0A412IIJ0      ---DLYKVS-PVT-ITFCD-KIEVPLS-------FTIKFSSKE--A-FAISEL-------
A0A0P0FM97      ---DLYKVS-PVT-ITFCD-KTEVPLS-------FTIKFSSKE--A-FAISEL-------
R6KTP3          ---DLYKVS-PVT-ITFCD-KTEVPLS-------FTIKFSSKE--A-FAISEL-------
A0A139LU87      ---DLYKVS-PVT-ITFCD-KIEVPLS-------FTIKFSSKE--A-FAISEL-------
A0A1C6B3Y5      ---DLYKVS-PVT-ITFCD-KIEVPLS-------FTIKFSSKE--A-FAISEL-------
A0A6L3KCD1      ---DLYKVS-PVT-ITFCD-KIEVPLS-------FTIKFSSKE--A-FAISEL-------
E2NMQ4          ---DLYKVS-PVT-ITFCD-KIEVPLS-------FTIKFSSKE--A-FAISEL-------
A0A412YDB9      ---DLYKAA-PFT-VTFRD-QPEAPLS-------FTIEFSSKD--T-FTISDL-------
R7DY01          ---DLYKAA-PFT-VTFRD-QPEAPLS-------FTIEFSSKD--T-FTISDL-------
A0A414LGK8      ---DLYKAA-PFT-VTFRD-QPEAPLS-------FTIEFSSKN--T-FTISDL-------
A0A415IPQ4      ---DLYKGS-PVT-ITFCD-KIEVPLS-------FTIEFSSKE--A-FTISEF-------
A0A3E5BRW7      ---DLYQST-PVT-VTFFD-KVETPLS-------FTIEFSSKD--M-FTISEF-------
K9DXS6          ---DLYQST-PVT-VTFFD-KVETPLS-------FTIEFSSKD--M-FTISEF-------
A0A1M6KFV3      ---DLYKSA-PVA-VTFLD-KMEAPLS-------FTIEFSSKD--T-FAISEF-------
A0A1Q6G7L3      ---DLYKSA-PVA-VTFLD-KVEAPLS-------FTIEFSSKD--T-FAISEF-------
A0A413H235      ---DLYKSA-PVA-VTFLD-KVEAPLS-------FTIEFSSKD--T-FAISEF-------
A0A358R8U0      ---VAYGASLPLT-VSLPELTENESAR-------FTLKVRPGG--E-VELSEF-------
R6WSB6          ---VAYGASLPLT-VSLPELTENESAR-------FTLKVRPGG--E-VELSEF-------
A0A401LPX7      ---TVYGNQLPVH-VVIPNLSENESAT-------FELYLAKDG--A-VELSSF-------
A0A6G0GNY9      ---TVYGNRLPVQ-VVIPTLSENESAT-------FELHLAKDG--A-VELSSF-------
A0A6I1BFM0      ---TVYGNRLPVQ-VVIPTLSENESAT-------FELHLAKDG--A-VELSSF-------
A0A3A5Z900      ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
A0A7K0GW19      ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
A0A285TGL6      ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
A0A3A5RFX4      ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
A0A1Q6IUW9      ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
A0A413XDP6      ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
A0A6N8CVT6      ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
K6AP24          ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
A0A6I2NHV3      ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
A0A662ZYI7      ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
A0A078RYI7      ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
C7XEQ8          ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
D7INX6          ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
K5ZG55          ---TVYGNQLPVQ-VVIPNLSENESAT-------FELHLAKDG--A-VELSSF-------
A0A7Y5MWI8      ---VLYGRDCPYT-VDFNELQDNESVA-------FTINPGLDG--Q-VLLTDF-------
A0A1M5B2J8      ---TIYGDQLPVA-VTLTDFPDNQSAA-------FQLHLGKDG--H-YTISDL-------
A0A255RCT5      ---TIYGDQLPVA-VSFADFPDNQSAS-------FRLHLGTNG--R-YTLYEL-------
A0A1Y4GLF5      ---VAYGKNLPVT-VTLCDLPEDETGS-------FTVEIRPGR--S-FGLSDF-------
A0A1H3XSC0      ---VAYGPTLPVN-VSINGLSENESVG-------FTLQVQPDS--T-VRLSDF-------
A6LE40          ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
A0A4Y1VPX5      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A6N2XMM4      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A7U8L0B4      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
B3JI46          ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A3N2N9B8      ---VAYGTTLPIE-LSIVNAPADASAE-------MNVDISPEG--K-ASISEL-------
A0A3N2NMI0      ---VAYGTGLPIQ-LEIVNFPTDASAT-------LELNISADK--K-VTIREL-------
A0A359I8H7      ---TLYGSNLPVN-VKFHDLEEQQCAG-------FRIELGKDG--N-VVLRKF----HLE
A0A3N2KA63      ---TLYGSNLPVN-VKFHDLEEQQCAG-------FRIELGKDG--N-VVLSKF----HLE
A0A4Q0IMT7      ---TLYGSNLPVN-VKFHDLEEQQCAG-------FRIELGKDG--N-VVLSKF----HLE
A0A7J0B660      ---TLYGSNLPVN-VKFHDLEEQQCAG-------FRIELGKDG--N-VVLSKF----HLE
A0A3B9FAU3      ---ILYGRSLPAN-VRMMGLGDHESAA-------MQMELQPNG--V-VKLSNF-------
A0A3C1E5L7      ---ILYGRSLPAN-VRMMGLGDHESAA-------MQMELQPNG--V-VKLSNF-------
A0A4Q0UAV1      ---LLYNNSPVTA-VNMAPEDKKLKGY-------YSFTITMVSATR-FTLSDF-------
A0A354SN68      ---TLYGKNLPIK-VSFLEATSMDNLS-------FEIQLEKGG--K-AILSHFKGDFGDE
A0A6L5XFL0      ---ILYGRTLPVN-VLLPDAGEEQSVD-------FTLELPSSG--V-VKLSNF-------
A0A3N2N595      ---IAYGYTLPIC-AELIDFSAYGTLK-------FDLMVNGDG--N-VTISGM-------
A0A7J0ACS3      ---VAYGYDLPVK-LTLLDYPDEGSLS-------MNLSVSKDG--K-VSVKDL-------
A0A0A2DUD9      ---LLYGTNLPLN-LRFTDLSEQESAE-------CILSQLPSG--E-LQLHSF-------
A0A3P1ZBJ5      ---TLYGRTLPFQ-VRFLSLNEEQGAR-------LSINYQQDG--S-FELTGF-------
R5FHS9          ---VLYGQNMPYT-VSMPDVQDEDVVK-------FTVKMEGTR----FVLSKF-------
A0A413TW79      ---ALYGRTLPVT-VHFYSLNDMQSAS-------LDVEVKHGNLFSIVHVSGT-------
A0A7K0AAG2      ---ALYGRTLPVT-VHFYSLNDMQSAK-------LDVEVKHGNQFAIVHVSGT-------
A0A7K0ASF1      ---ALYGRTLPVT-VHFYSLNDMQSAN-------LDVEVKHGNLFSIVHVSGT-------
A0A3E5E9M7      ---ALYGRTLPVT-VHFYSLNDMQSAN-------LDVEVKHGNLFSIVHVSGT-------
A0A3E4SK73      ---ALYGRTLPVT-VHFYSLNDMQSAN-------LDVEVKHGNLFSIVHVSGT-------
A0A415GGC6      ---ALYGRTLPVT-VHFYSLNDMQSAS-------LDVEVKHGNLFSIVHVSGT-------
A0A413DBH9      ---ALYGRTLPVT-VHFYSLNDMQSAN-------LDVEVKHDDLFSIVHVSGT-------
A0A495WI87      ---VLYGRTLPIN-VSIDTPNDNESSA-------LTVKILADS--T-VELSDF-------
A0A354M4S6      ---VLYGRTLPIN-VSIDTPNDNESSA-------LTVKILADS--T-VELSDF-------
R7DH52          ---VLYGRTLPIN-VSIDTPNDNESSA-------LTVKILADS--T-VELSDF-------
A0A7J5IAE7      ---VAYGLTLPVN-VTMSDLSENESAG-------FTLEIHPDS--T-LLLSDF-------
A0A016CWA4      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVRPDS--T-LLLSGF-------
A0A4P8LP09      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVRPDS--T-LLLSGF-------
A0A0M1W0V2      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A139KA16      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A174VQ92      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A1Q6HCG0      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A1Y4JYM9      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A3A5QW67      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A3A5RQE6      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A3A6BP07      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A3E5E153      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A3Q9IP20      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A412WV15      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A413ICP6      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A414KYB9      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A5B3FWR2      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A7J5QHB9      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
E5WX00          ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
K0X3P3          ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A1C6H117      ---VAYGLTLPVD-VTISDFPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A6I1AQV4      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A5C6L2P1      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A3E4WKT5      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A3A5YY33      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A1E9CFZ7      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A373FYU5      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A3A5XBP2      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A3A6MEG9      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A3E4JP35      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A3E4KP40      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A3E4NX82      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A3E4XFU8      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A412RG70      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A412TD37      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A413GAA4      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A414M7I4      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A496BTA0      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A496D2V6      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A5C6KCA6      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A5M5AHM5      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A6I0Y5K7      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A6I1BFB8      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A6I2P5W5      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A6N8DC51      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A7J5HGP0      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A7J5HVL8      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A7J5JHD3      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A8B3EKM1      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
E5UZA2          ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A069SMG6      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
C3RFN5          ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
A0A3A5Z014      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
A0A7J5GD93      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
A0A7K0HGR5      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQSDG--T-LFLSDF-------
A0A078S3Q8      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
A0A069SJV7      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
A0A3E5DXI5      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
A0A3E5EM98      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
A0A6N2YYD4      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
I9T3G6          ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
A0A3E4SYU0      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
A6LGY1          ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
K5ZSH4          ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
A0A6A2RTB3      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A7J5PEN4      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEIQPDG--T-LYLSDF-------
A0A1M4YZ07      ---VAYGLTLPVD-VTINDLPENESAG-------FTLEVQPDG--T-LFLSDF-------
A0A7J5I238      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A0P0FQW1      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A7K0I229      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A5M5C0W6      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A642NJ89      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A6L3JTQ2      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A7J5FQU6      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A7J4YLH7      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A6N3AEV2      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A6G0G4T5      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A6L3KG29      ---VAYGLTLPVD-VTISDLPENESAG-------FTLEVQPDS--T-LLLSDF-------
A0A1Y4PQK7      ---LLYGMALPFQ-ANITGLQENESVG-------FTVNVYKDG--H-VQLSDF-------
A0A1Y4IH41      ---LLYGMTLPFQ-ANIAGIQENDFAG-------FTVNVYKDG--R-VQLSDF-------
A0A3A6AAP4      ---LLYGMTLPFQ-ANIAGIQENDFAG-------FTVNVYKDG--R-VQLSDF-------
A0A6I0ZRD2      ---LLYGMTLPFQ-ANIAGIQENDFAG-------FTVNVYKDG--R-VQLSDF-------
A0A1Y4DYA7      ---ILYGQNCPYE-VEFFDLQDNDVAS-------FTIFPVSGN--KGVELTDF-------
A0A1Y3X4I9      ---VLYGQACPYE-VEFFDLLDNEGAS-------LTILPVSGN--KGVELTDF-------
A0A1Y4FNK8      ---VLYGGTCPYS-VSFNDLQDNESVS-------FTVNPSSIG--Q-VKLTDF-------
A0A355FD59      ---TLYGSELPVR-VVFTDLTDKENAK-------LTLRVSEDS--T-VVLSDF-------
A0A359CEZ9      ---TLYGSELPVR-VVFADLTDKENAK-------LTLRVSEDS--T-VVLSDF-------
A0A353Q7B4      ---TLYGSELPVR-VVFTDLTDKENAK-------LTLRVSEDS--T-VVLSDF-------
F8X3A5          ---VLYGPDLPIT-VSFTDLADNESAE-------LIIKLLADG--T-FECSDF-------
A0A1M3KVR9      ---VLYGPDLPIT-VSFADLADNESVE-------LVIKLLADG--T-FECSDF-------
A0A4Y9IJS3      ---VLYGPDLPIT-VSFADLADNESAE-------LVIKLLADG--T-FECSDF-------
A0A416GA42      ---DLYGVS-PVT-VHFVQG--DDLAC--------SFRLRLLPGR-KVELSQLKYQAQEL
A0A1T3IYP5      ---ELYKKS-PVH-VKIEGK--TQESS-------YSFIITPFDSK-TVILKGWDQSGK--
A0A7Z6RZU4      ---VLYPDI-PIR-VKFDSL----------FNKNVSLSVIPLSET-YYQIEDFSEDPDW-
A0A4D7K1D4      ---ERYRNK-PFR-VDYQVK--SADLH------NRLFNVHISSKE-HYTLTYELGEVTQ-
A0A846MP44      ---ELYRLS-PFEVVEYEIS--DAAWY------ECKIYFEYLGDK-KYRLKVKRQDVWQ-
A0A1G9E2A9      ---EAYHDS-PFR-VEYKLK--SGAIQ------DRSIELEVLNER-EYRLKYELNGEEI-
A0A098LL25      ---ERYNNS-PFK-VIGEIK--HPDFL------DFKFDITFLDKD-KFLLSYKKNDEEI-
A0A6J4H627      ---ERFLSA-PFR-VETVRL--GPAAY------DKPIDITIQDNS-EFVLAYTEDGKEL-
A0A6C0GJI1      ---ERYKNS-PFI-VNFDAT--SNVPY------DRPFDVQLLNNS-QYELTYKQGSNDV-
A0A839GQ17      ---ELYNES-PFQ-VSYNGG--SFSLF------DKKIFVDFLSKA-KFTVKVGEDG-K--
A0A127B287      ---ELYKDS-PFK-VAFDSS--RFDLY------DQKIYVTFDSRT-RYTVQIGEDGKK--
A0A6P1P2P6      ---ELYNDS-PFR-VTFDST--NFDLY------DQKIYVNFESRT-TYTTQIGEEGEK--
A0A2T2YJE8      ---ELYKNS-PFK-ITYQLT--NEAYY------DRRYNVTLLDAT-RFNLSYLEGDQEI-
A0A7L7LEW0      ---ELYKNS-PFK-ITYQLT--NEAYY------DRKYNITLLDVN-RFNLSYLEGEEEI-
A0A3M9N829      ---ELYKDS-PFA-VNYDTS--AFDLF------DQQIFIAFSSPS-RYEVYVGEEGERL-
A0A0P0CSF9      ---ELYKDS-PFQ-VSYDNE--SFNLY------DQKIYVKFTSPS-RFDLYVGENGNQS-
A0A5M8QQB8      ---ELYKDS-PFE-VLYDSV--DFNLY------DQKIYVKFQSPS-RFDLYVGETGTPS-
A0A3M9MNC3      ---ELYKSS-PFE-VVYDST--NFSLF------DQKVYIHFNSPS-KFDIYIGKEGKHS-
A0A5B6TAX2      ---ELYKDS-PFE-VSYDST--NFDVY------DQKIYVKFESPS-KFDVYVGEEGSHT-
A0A7L5A132      ---EVYKTS-PFR-VEYRIK--DNSFY------NRKFNLNFLDAN-RFRLTYLLNGQEA-
A0A512AYT3      ---ELYKNS-PFK-VIYEIK--DDGFY------NKNFDVNFLDEN-RFTLSYQVGEEEI-
A0A5M6CYN7      ---ELYNNS-PFK-ITYDIK--DGRFY------NKKINVDFLDAN-RFRLSYLVGEEEI-
A0A369QP10      ---ELYRSS-PFH-ISYEMS--NEAYY------NIKFGVSILDAT-RYNLSYVQGDQEV-
A0A7G7G7M4      ---ELYRTA-PFG-VTYEIT--NEAFY------NVKFGVTLLDAN-RFNLTYLQGDEEI-
A0A126PDF2      ---ELYGIS-PFQ-IAYTIK--DKDLY------NQKISLAFTSPT-RYSISYSGPGTAL-
A0A2Z3GKA1      ---ELYGIS-PFR-IAYTIK--DKELY------NQKISLEFTSPT-RYSISYSGPGAAL-
A0A502GZP7      ---ELYGNS-PFH-IAYVVR--DKELY------NQKISLVFVSPT-RYSIDYSGTAATL-
A0A0M3RW20      ---ELYKAS-PFH-IEYAIK--DPGYY------GIQFNIQFLNKD-KFILSYALRGNEI-
A0A495VFX4      ---ELYKTS-PFH-VEYYIT--NLNLY------GVRFNVQFLSDE-KFILSFNLKNEEY-
A0A246FQC0      ---ELYASS-PFI-VKYKPI--NNAVF------DLKIGINLLSAT-TFQLILPDGLGGG-
A0A372E5P8      ---EIYGAS-PFE-VSYEAT--ANAAF------DQKIALRFLSPT-TFELILPEDLGGT-
A0A7Y7PLY0      ---EIYGTS-PFE-VSYESI--SDAAF------DQKIALRFLSPT-TFELTLPEELGGT-
A0A1H3EMW1      ---EIYGIS-PFE-VSYQAT--ADATF------DQKLALRFLSPT-TFELTLPEQLGGG-
A0A1H9ZSN3      ---EIYGSS-PFE-VSYEAL--ADAAF------DRKIALRFLSPT-TFELTLPEELGGT-
A0A7W9SXN1      ---ELYRSS-PFR-VEYTAS--PQAVY------NVKIGVRLLPAN-RVRVQYEFQNQEE-
A0A418R9X5      ---ELYSLS-PVR-IEYKAG--KGAMF------NQKIGLQLLEND-RFSLQLP-NGASA-
A0A428JSJ3      ---ELYNLS-PVR-VEYTAN--KGAAF------NQKIGLELLDND-QFKLHLP-GNGSE-
A0A428KI59      ---ELYNLS-PVR-VEYKAG--KGAMF------NQKIGFQLLEND-RFRLQLP-GGAAE-
W8F1I6          ---ELYNLS-PIR-VEYKAG--KGALF------NQKIGFQLLEND-RFRLQLP-NGGTE-
A0A1S9B3W0      ---ELYGVS-PFH-VTYTVR--EPSQF------NLKFSVKLLDAQ-RFKLSYPAGAGET-
A0A1W1VRL3      ---ELYTRS-PFQ-VTYKIK--NPAFY------NRKFNVNFSSPT-QFRLSYLEGEQEV-
A0A7G6YQJ9      ---ELYQIS-PFK-VSYTVQ--DGSQF------NTRFAVDFLDEQ-RFTLSYEVQGKEQ-
A0A1M6R305      ---ELYGVS-PFR-VDYE----GDILY------NTKFSVVFTSPQ-KFRISYLQGGQEQ-
A0A7G7W8X3      ---ELYGVS-PFR-VEYG----GDILF------NTKFGLSFTSPT-RFRLSYLQAGQEQ-
A0A4Z0PHK3      ---ELYGVS-PFN-VEYKIK--DPSFY------NTKFSLTFTGPQ-QFRLSYLYQGQER-
A0A2M9B9H9      ---ELYGIS-PFK-VSYDIK--DPNFY------NSKFNLNFTGGK-QFRLSYLYLGQER-
A0A4Z0QCY9      ---ELYGIS-PFK-VSYTIK--DPNYY------NTKFNLNFTGPQ-QFRLSYLYQGQEK-
A0A7Y0AH93      ---ELFNTS-PFR-VEYSIS--DDGYY------NHNFEIEYIDTQ-HYQLSITAGAEII-
A0A519SBU8      ---EMYNTS-PFH-VRYKVS--DPQFY------SRKFQVSFPAPN-QYVVSVKSGAETL-
A0A4Q3JNZ3      ---ELYNST-PFH-VQYKIT--DPELY------SHKFLLNFLDSN-RYTVSVKAHNQTL-
A0A519Q9V3      ---ELYNSA-PFH-VKYKIA--DQGLY------NHKFLINFLTPS-KYEVSVKVHSQTL-
A0A5N1J2M4      ---EVYTDS-PFN-LIFKVN--NPELY------DKPVEVEFLNKD-RFRLTYTLGNKTN-
A0A519S476      ---ELYNNA-PFH-VRYKIA--DAELY------GHKFQVSFPTPD-TYQISVKAHGQTL-
A0A4Q3JRW8      ---ELYNNS-PFY-VRYKIT--DNELY------NHKFLVNFLPSN-RYQISVKVRNQTL-
A0A519M923      ---ELYSNS-PFR-IEYKVT--DNELY------GHKFQVSFPTVS-QYQVSVKAHNQAL-
A0A4Z0ENW1      ---ELFGSC-PYQ-VKYTIS--DPVYY------NHKFDVEYIDTK-HYRLSITTANTTL-
A0A519UDB4      ---ELFGNS-PFK-VIYTIS--DVSYY------NRKFNIEYIDAK-TYRLSVNVGSNIL-
A0A3S0QKV1      ---ELYGNS-PFR-VEYTVR--EPIQF------NKKFSVRLLEGK-RFRLSYLMGQQEI-
A0A328BL48      ---ELYRTA-PFR-VEYAVR--EPLQF------GQKFSVEVLDQN-RFRLSYAQGQAEQ-
A0A5R8WLY4      ---ELYRTA-PFR-VEYTVR--EPLQF------GQKFNVEILDQN-RFRLSYAQGQGEQ-
A0A1I5WSL8      ---ELYGTS-PFK-VIYKIT--DPSLY------NRKFDLRFINKQ-RFILEFMGQGRPT-
A0A0U3JVM7      ---ELYGIA-PFR-VKYHIT--DPSLY------NHKFDLKFVGPQ-RFALEFTGQGRPL-
A0A1G1SSV2      ---ELYGTS-PFR-VKYNIT--DPSLY------NRKFELRFTGPS-RFKLDFVAQGRPL-
A0A1G1SXV7      ---ELYRTS-PFR-VKYSIT--DPSLY------NRKFELRFTAPG-RFRLEFVGQGRPL-
A0A6G8CBJ6      ---ELYKRS-PFK-VAYAIK--DPAFY------NRKLNVSFISPT-QFRLSYLEDKEEV-
A0A0W8EDI5      ---ELYNAT-PFR-IDYDPA--DQILY------NRKFDIVFSDAK-RFSLVSKAESGDV-
A0A3B7RBP8      ---ELYTDT-PFR-VQYSTK--DGFLF------NKKIYINFIDEQ-HFLLLYRKNDVEQ-
A0A3R9P8H7      ---EMYNTS-PFK-VVYTPT--DDAAY------DQKIAVQFMSPT-TFRLTLPESLGGG-
A0A238WIA7      ---ELYKTS-PFK-VEYESK--NGSLF------NTRFNLKFLSPN-RVQLTYLEGGQEV-
A0A212UCJ7      ---ELYRAS-PFK-VEYQTK--GGGQY------NTKFGLRFLTPQ-QIELTYQENGQEV-
A0A4Z0MQE1      ---ELYRAA-PFK-VEYEVRAGGAGQF------NSKFGLHFLSPQ-QIELTYQEGGQEK-
A0A4Z0PCF4      ---ELYRTS-PFK-VDYETKAGGAGQL------NTKFGLRFLSPQ-QVELTYQEAGQEK-
A0A6M6BED0      ---ELYRAS-PFK-VVYETKAGGAGQL------NTKFGLRFLSPQ-QVELTYQEAGQER-
A0A5D6VDG1      ---ELYGIS-PFQ-VNYTIT--DPSLY------NTRFNVLFTSST-KFQLSH--EGHEA-
A0A243WHR7      ---ELYGLS-PFK-VNYKIK--DGSLY------NTRFDLTFSNPQ-QFRLSYQYKGQEI-
A0A5B8A0P6      ---ELYGNS-PFK-VEYNIK--NGVFY------NTPINIQFVDNK-HFKISYNFQGQEV-
A0A076HRT9      ---ELYGTS-PFR-VQY--D--GEVLY------NTKFNLRFKDAQ-FFHLSYQKDGQEQ-
A0A4Z0PVM7      ---ELYGVS-PFK-VAYIIK--DPNFY------NSKFNLNFTGPQ-QFRLSYMYQGQEK-
A0A1M6DHW8      ---ELYGTS-PFE-VEYRIK--DASLY------NTKFNLVFTGSQ-RIRLSYLYAGQER-
A0A4Q5LC61      ---ELYGTS-PFK-VEYNIK--DPGLY------NTKFNLIFTGPQ-RIRLNYLYGGQEQ-
A0A060RD97      ---DIYGEETPIV-VKNVAE--SEQSN-----NPVSFTVTPKNSE-AFQLSYIDENETRV
A0A350IHV0      ---ELFTSS-PIA-LVQTGD--NHASA-------YSFELTKTGDS-TFVIKNLRVA----
A0A2A8CVM9      ----------KFP-LLYGED--GQARS---------------------------------
R5RVP0          ---EKFTDS-PIA-LVLAGD--NNASA-------FSFEIVNEKDS-TFVIKDLAVV----
A0A2L2WX98      ---SLYRNR-PFR-IEFSSE--CQRPE--------KFEVVKTGDR-KFALSNFERGKDKY
A0A2E3R1D0      -------NR-PLP-ILRD-------------------------------DDPSTP-----
A0A800J826      -------QR-PLT-ILRN-------------------------------AAQSGP-----
A0A2T2USC0      -------GE-QLS-VLTGPK--DPSDT-------SEQSASETVAGLLMSPEEERR-----
A0A2T2V0F3      -------GE-PLA-VLTG-------------------------------PEGERR-----
A0A2T2S682      -------GK-PLD-VLTT-------------------------------PSGEGR-----
A0A840DJZ8      ---TSPLGR-LTD-RVWA-------------------------------SVNQRFGEGGA
D5H561          ---VSPFGR-LMD-RAWA-------------------------------WAGQGTGGAEG
A0A2H3NWA9      -------EG-PPI-MYTA-------------------------------ETQERL-----
A0A2A8CVB6      -------GR-PIQ-MLSD-------------------------------VEGNRL-----
A0A2P6C1S6      -------GQ-PLQ-ILRG-------------------------------PEGEQR-----
A0A2T2UTM4      -------GE-PLQ-ILRG-------------------------------PEGKRR-----
R6A0L2          ---TLYGKELPFQ-VLFQKQ--YKGKRG------QHIDVVKKGSN-TVTLKGMTDRMGND
R7LG80          ---ALYKNERPIE-VLFHDS--LPSENPIPKNMIVSLKIKKLDQN-TVEIKGFRNKKGKK
A0A7W5UEN4      ---ALYTDR-PFE-IAFQQK--AE-NL-------VRFEAKIQADG-TVKLSDFLCYNRST
G5GD56          ---ALYTDR-PFE-IAFQQK--AE-NL-------VRFEAKIQADG-TVKLSDFVCYNRST
R5KD55          ---TLYGKTLPVK-VVFRDI--PKDET-------ASLHIRLKKDG-SIKMSEFVKNGKPQ
A0A174QNT3      ---HIFGEL-PFE-INFLDN--YP-GY-------TELKVSVVNDK-QCRISNIEIEEETR
A0A4S2FGS1      ---NLFGDL-PFE-VRFLDI--CP-GF-------TKFTVSVINEK-GVRLSQLEIDGNAQ
A0A7K3KG59      ---NLFGDL-PFE-VRFLDI--YP-GF-------TELTVSIINEK-GVRISQLEIDGNAP
R9I0H0          ---NLFGDL-PFE-VRFLDI--YP-GF-------TELTVSIINEK-GVRISQLEIDGNAP
K5BUT9          ---PLYAES-PVD-VHFIDP--YN-QP-------VSFNITPLNTT-KFRISDWKVMGEKG
A0A174FPA3      ---PLYAES-PVE-VHFIDP--YN-QP-------VSFNITPLNTT-KFRISDWKVAGEKG
R6S9Y6          ---PLYAES-PVE-VHFIDP--YN-QP-------VSFNITPLNTT-KFRISDWKVAGEKG
A0A7J4YSB2      ---PLYAES-PVE-VHFIDP--YN-QP-------VSFNITPLNTT-KFRISDWKVAGEKG
C9KX15          ---PLYAES-PVE-VHFIDP--YN-QP-------VSFNITPLNTT-KFRISDWKVAGEKG
A0A6H0KRK1      ---SLYAES-PVE-VNFIDP--YH-AY-------YHTKVTPLDVK-NYTILG--------
R6DAG6          ---SLYAES-PVE-VNFIDP--YH-DY-------YRTKVTPLDVK-NYTILG--------
A0A3L8AAP1      ---SLYAES-PVE-VNFIDP--YH-AY-------YRTKVTPLDVK-NYTISD--------
A0A4S2AYX2      ---SLYAES-PVE-VNFIDP--YH-AY-------YRTKVTPLDVK-NYTISD--------
A0A7J0A2L4      ---SLYAES-PVE-VNFIDP--YH-AY-------YRTKVTPLDVK-NYTISD--------
A0A7K3MN31      ---SLYAES-PVE-VNFIDP--YH-AY-------YRTKVTPLDVK-NYTISD--------
R6CQ93          ---ELYNLS-PVQ-VSFFNV--LPERY-------FSFVVTPKDET-SVELSEIEGIPGAQ
A0A3D1NQW3      ---DLYGQS-PIA-VEFIND--NDRQG-------FRFEVSLRPDS-IVKLNYFEIF---G
B0MT10          ---DLYGQS-PIA-VEFIND--NDRQG-------FRFEVSLRPDS-IVKLNYFEIF---G
R7JGW9          ---DLYGQS-PIA-VEFIND--NDRQG-------FRFEVSLRPDS-IVKLNYFEIF---G
A0A3D2BF46      ---NLYRRS-PID-VTFIDD--NERQA-------LAFELTPVDNE-KFSLTKFVNRTSAD
A0A358R538      ---DLYGQS-PLR-VRFIDE--TEDLS-------AELTVTPLPDG-RLRLSDFDDGFLPK
A0A1Y4AAB8      ---DLYGRS-PIE-ADFVDE--GENQS-------FSFRARPLAGGEQVELTDFDDGYISD
A0A1Y3WWY9      ---DLYGQS-PID-VDFING--DDNQS-------LSMTVTPRGEQ-QIEISQFQDGFVSK
A0A1Y4U5L4      ---DLYGQS-PID-VDFING--DDNQT-------LSMTITPRGEQ-QIEISQFQDGFVSK
A0A1Y3VCJ1      ---DLYGQS-PVE-VVFVND--NDNLT-------LSLEVTPVDDQ-NIRLSNFHDPFISK
A0A1Y3QTW7      ---DLYGRS-PIE-VDFIDD--DN-QR-------LSLEVTELEDG-RIKLADFDDKYLTK
R6XWY7          ---DLYGRS-PIE-VDFIDD--DN-QR-------LSLEVTELEDG-RIKLADFDDKYLTK
A0A4Y1X9Y9      ---DLYGRS-PIE-VDFIDD--DN-QR-------LSLEVTELEDG-RIKLADFDDKYLTK
A0A4Y1WM66      ---DLYGRS-PIE-VDFIDD--DN-QR-------LSLEVTELEDG-RIKLADFDDKYLTK
A0A6N4GYT3      ---DLYGRS-PIE-VDFIDD--DN-QR-------LSLEVTELEDG-RIKLADFDDKYLTK
A0A174AVF1      ---DLYGRS-PIE-VDFIDD--DN-QR-------LSLEVTELEDG-RIKLADFDDKYLTK
A0A1Q6EIY0      ---DLYGRS-PIE-VDFIND--NSKQK-------LSLEVTPLRNG-KIELTDFEDKFVTR
A0A5B5VN71      ---DLYGRS-PIE-VDFIND--NSKQK-------LSLEVTPLRNG-KIELTDFEDKFVTR
E4M8L3          ---DLYGRS-PIE-VDFIND--NSKQK-------LSLEVTPLRNG-KIELTDFEDKFVTR
I3YQ50          ---DLYGRS-PIE-VDFIND--NSKQK-------LSLEVTPLRNG-KIELTDFEDKFVTR
R5UEY8          ---DLYGRS-PIE-VDFIND--NSKQK-------LSLEVTPLRNG-KIELTDFEDKFVTR
A0A1H4D866      ---DLYAQS-PVE-VTFVND--SDNQS-------LSMEITPLEGD-KVRLTNFEDRFVTK
A0A5B3G4Y7      ---DLYGQA-PID-VKFIND--NDNQS-------LAMEITPIDDD-KIRLSGFEDQFVTK
A0A374A9J5      ---DLYGQA-PID-VKFIND--NDNQS-------LAMEITPIDDD-KIRLSEFKDQFVTK
A0A5B3GQN5      ---DLYGQA-PID-VKFIND--NDNQS-------LAMEITPIDDD-KIRLSEFKDQFVTK
A0A1Q6E9S3      ---DLYGQA-PID-VKFIND--NDNQS-------LAMEITPIDDD-KIRLSEFKDQFVTK
D4IJ36          ---DLYGQA-PID-VKFIND--NDNQS-------LAMEITPIDDD-KIRLSEFKDQFVTK
A0A414Q925      ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
A0A415PUS9      ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
A0A108TCU0      ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
A0A413BA42      ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
S3Y344          ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
A0A7J5LEW3      ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
A0A412TGL3      ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
A0A413VJ33      ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
A0A414L0W6      ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
A0A412DP39      ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
A0A413ZSE8      ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
B0NP84          ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
R6AK43          ---ELYTST-PFA-VTFLDA--TPSQQ-------ISLTVTMSDNG-KVTLADMTLQ--NE
A0A412N2D9      ---ELYTST-PFT-VNFLDA--DPAQK-------ISLTVTMTDNG-KVTLTDMVLQ--NE
A0A1Y4JYS9      ---ELYTST-PFT-VNFLDA--DPAQK-------ISLTVTMTDNG-KVTLTDMVLQ--NE
R6LHA4          ---ELYTST-PFT-VNFLDA--DPAQK-------ISLTVTMTDNG-KVTLTDMVLQ--NE
A0A3E5HPT8      ---ELYTDS-PVR-VAFLEA--GLDEV-------CSLSVIPKNKQ-QVELADFSLD----
C6IJ48          ---ELYTDS-PVR-VAFLEA--GLDEV-------CSLSVIPKNKQ-QVELADFSLD----
Q8A3U2          ---ELYTDS-PVR-VAFLEA--GLDEV-------CSLSVIPKNKQ-QVELADFSLD----
A0A3R6S1H6      ---ELYKES-PVV-LRFPDA--EETSS-------LQMVVTPLDDK-TVMLAGWKGD----
A0A3R6SD81      ---ELYKES-PVV-LRFPDA--EETSS-------LQMVVTPLDDK-TVMLAGWKGD----
A0A354WXN6      ---DLYTQS-PIN-LTFPEA--EGEQV-------FSLKATPLDDK-KVLLHDFKIA-NTE
A0A7G1HW11      ---SLYKDS-PLA-VSFITK--DNNSQ-------FSFDIVPISDQ-EVLLSDFTSN----
R5IP14          ---SLYKDS-PLA-VSFITK--DNNSQ-------FSFDIVPISDQ-EVLLSDFTSN----
A0A316SZX7      ---DLYRNT-PIE-VSFVDD--DDKSY-------SGFTAKK-KGK-EIYLSDLRTS--AQ
A0A1Y4AIY1      ---ELYRQS-PVI-LSFPDA--SETQS-------FSLTAIPLSKE-KVRLFDFVTV-NEA
A0A0J6CIR2      ---ELYTQS-PIA-VRFPEA--EASQS-------FSLVATPLSAG-EILLSGFSTN----
A0A3D8HG59      ---ELYTQS-PVH-LEFPDA--EPNQQ-------FRLVATAIDEG-KVALSDFEAD----
A0A3R6S408      ---ELYTQS-PVH-LEFPDA--EPNQQ-------FRLVATAIDES-KVALSDFEAD----
F3ZRU7          ---DLYGNN-PFE-VVFLEA--STEQP-------IQLK-GKLKEN-QVQFTDVKTW---T
A0A1C5Q1F3      ---DLYTTS-PVT-LTFPEA--LETSS-------FSFKVTPLNDK-EVLLSDFPEM----
R7A239          ---DLYTTS-PVT-LTFPEA--LETSS-------FSFKVTPLNDK-EVLLSDFPEM----
A0A3R6HIK7      ---ELYTHS-PVV-LSFPET--EESQS-------FALKVTPLSKE-KVRLSDFIMA-DSN
K5ZVW7          ---ELYTHS-PVV-LSFPET--EESQS-------FALKVTPLSKE-KVRLSDFITA-DSN
A0A1Y4D5Z0      ---ELYRES-PVV-LSFPEA--GEGQS-------FSLTVTPMSDK-EVVLSKFITR-NEE
A0A413VXJ7      ---ELYTHS-PII-LSFPEA--EERQS-------ILVTVTPIDSA-RVRLSDLKMS--VG
I9RSN9          ---ELYTHS-PII-LSFPEA--EERQS-------ILVTVTPIDSA-RVRLSDLKMS--VG
U6RJK5          ---ELYTHS-PII-LSFPEA--EERQS-------ILVTVTPIDSA-RVRLSDLKMS--VG
A0A1Q6GA32      ---ELYTHS-PII-LSFPEA--EERQS-------ILVTVTPIDSA-RVRLSDLKMS--VG
I9RPU6          ---ELYTHA-PVT-VSFPEA--EERQV-------ITVVVTPVDSV-TVRLSGFSLA--VG
I8YFS5          ---ELYTHS-PIT-VLFPES--EERQV-------IEMTVTPVDSA-TVRLSDFSLS--IA
A0A7J4XCM0      ---ELYTHS-PIT-VLFPES--EERQV-------IEMTVTPVDSA-TVRLSDFSLS--IA
I8Y597          ---ELYTHS-PIT-VLFPES--EERQV-------IEMTVTPVDSA-TVRLSDFSLS--IA
A0A1Q6GBF5      ---ELYTHT-PVT-VSFPEA--EERQV-------IKVAVVPVDSV-TVRLSGFSLA--VG
I8YFZ3          ---ELYTHA-PVT-VSFPEA--EERQV-------IRVVVTPVDSI-MVRLSGFSLA--VG
A0A7J4XFW0      ---ELYTHA-PVT-VSFPEA--EERQV-------IKVVVTPVDSA-TVRLSNFSLA--VG
A0A1Q6GDH2      ---ELYTHA-PVT-VSFPEA--EERQI-------ITVVVTPVDSV-TVRLSGFSLA--VG
U6RSB0          ---ELYTHA-PVT-VSFPEA--EERQV-------ITVVVTPVDSV-TVRLSGFSLA--VG
I9GXM2          ---ELYTHA-PVT-VSFPEA--EERQI-------IKVVVTPVDSV-TVRLSDFSLA--VG
I9SIK1          ---ELYTHA-PVT-VSFPEA--EERQV-------IKVVVTPVDSA-TVRLSGFSLA--VG
A0A7J4XIJ5      ---ELYTHA-PVT-VSFPEA--EERQV-------IKVVVTPVDSA-TVRLSGFSLA--VG
I9TP59          ---ELYTHA-PVT-VSFPEA--EERQV-------IKVVVTPVDSA-TVRLSGFSLA--VG
R5S343          ---DLYGIS-PIR-VRFLDR--GEDEA-------ATCAVTFMTCE-RVLLSGFKEE----
A0A1M6K7I9      ---ELYTQS-PIK-VAFPDA--EDNQY-------IHVCVTPLSEN-KVRLSELLMI--VN
A0A5M6A8C8      ---ELYTQS-PIK-VAFLDA--EDNQY-------IRVCVTPLSEK-KVRLSELLMI--VN
A0A7J4XCJ1      ---ELYTHS-PIT-VSFPES--EERQV-------IEMKVTPVDSV-TVKLSDLTLT--IG
A0A7J4XNQ7      ---ELYTHS-PIV-VVFPES--EERQV-------IKTAITPIDSV-TVRLSDFVLS--VN
A0A3R5ZMK1      ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLKAVPVSGK-EVVLSGFTLG----
A0A7K1HMX0      ---ELYTQS-PVL-LSFPDA--EEAQA-------FSLRAKPISAE-EVVLSDFVID----
A0A1Y3ZIA4      ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLQAVPVSGK-EVMLSGFTLG----
K5Y1A4          ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLQAVPVSGK-EVMLSGFTLG----
A0A7K1HDC0      ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLKAVPVSGK-EVVLSGFTLD----
A0A3R6K8X4      ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLKAVPVSGK-EVILSGFTLG----
A0A6N8D6C8      ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLKAVPVSGK-EVILSGFTLG----
A0A3R6BKI7      ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLKAVPVSGK-EVVLSGFTLG----
A0A412M2W1      ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLKAVPVSGK-EVVLSGFTLG----
K5ZX55          ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLKAVPVSGK-EVVLSGFTLG----
A0A415BDM7      ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLKAVPVSGK-EVVLSGFTLG----
A0A1Q6I3T6      ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLKAVPVSGK-EVVLSGFTLG----
A0A414XX40      ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLKAVPVSGK-EVILSGFTLG----
A7AEU7          ---ELYTQS-PVQ-LSFPDA--EEAQA-------FSLKAVPVSGK-EVILSGFTLG----
A0A5F0U645      ---ELYSHS-PVV-VRFPEA--NENLE-------FGLTVVPVSDK-EVSLSGFFSEELEE
K5ZBN2          ---ELYSHS-PVV-VRFPEA--NENLE-------FGLTVVPVSDK-EVSLSGFFSEELEE
A0A0J6CKW3      ---ELYSHS-PVV-VRFPEA--NENLE-------FGLTVVPVSDK-EVSLSGFFSEELEE
A0A0F5IQM7      ---ELYSHS-PVV-VRFPEA--NESLE-------FGLTVVPVSDK-EVSLSGFFSEELEE
A0A496CDT3      ---ELYSHS-PVV-VRFPEA--NENLE-------FGLTVVPVSDK-EVSLSGFFSEELEE
A0A6G1ZKM3      ---ELYSHS-PVV-VRFPEA--NENLE-------FGLTVVPVSDK-EVSLSGFFSEELEE
S0GLB0          ---ELYSHS-PVV-VRFPEA--NENLE-------FGLTVVPVSDK-EVSLSGFFSEELEE
A0A3R6NLC1      ---ELYSHS-PVV-VRFPEI--NENLE-------IGLTVVPVSDK-EVSLSGFTSEELEE
A0A416WYC9      ---ELYSHS-PVV-VRFPEI--NENLE-------IGLTVVPVSDK-EVSLSGFTSEELEE
A0A7W7AX81      ---ELYSHS-PVV-VRFPEI--NENLE-------IGLTVVPVSDK-EVSLSGFTSEELEE
A0A0F5IT40      ---ELYTQS-PIA-VRFPEA--EASQS-------FSLVATPLSAG-EILLSGFSTN----
A0A496CX20      ---ELYTQS-PIA-VRFPEA--EASQS-------FSLVATPLSAE-EILLSGFSTN----
A0A5F0UBI0      ---ELYTQS-PIA-VRFPEA--EASQS-------FSLVATPLSAG-EILLSGFSTN----
A0A6G1ZHG0      ---ELYTQS-PIA-VRFPEA--EASQS-------FSLVATPLSAG-EILLSGFSTN----
S0GSI7          ---ELYTQS-PIA-VRFPEA--EASQS-------FSLVATPLSAG-EILLSGFSTN----
K5YB65          ---ELYTQS-PIA-VRFPEA--EASQS-------FSLVATPLSAG-EILLSGFSTN----
A0A0F5IWP9      ---ELYTQS-PIA-VQFPEA--EATQA-------FSLNVTPLTET-EVMLSDFSTD----
A0A0F5IZT8      ---ELYTQS-PIA-VQFPEA--EATQA-------FSLNVTPLTET-EVMLSDFSTD----
A0A417LKQ2      ---ELYTQS-PVA-VQFPET--EAVQA-------FSLTVTPLSEK-EVMLSDFSTD----
A0A416TME1      ---ELYTQS-PVA-VQFPEA--EATQA-------FSLVVTPLSEK-EVLLSDFSMA----
A0A7W7F3X3      ---ELYTQS-PVA-VQFPEA--EATQA-------FSLVVTPLSEK-EVLLSDFSMA----
A0A416XPE8      ---ELYTQS-PVA-VQFPEA--EATQA-------FSLVVTPLSEK-EVLLSDFSMA----
A0A3B0C2S4      T--EIWNPPFAIT-KLIAEDSIGQPRVYDISLDAFEARITNM-DG-ATTVVGLAEKDTVP
A0A5M8NYX7      N--ELYNQT-PLW-VILKNQIGWGSFILDKKGDTFSIEAQGA------------------
A0A1M6GR99      Y--NAYNES-PFK-VFIFK-E--HPQLVGPVFDVILN------SD-GSYALKVEKQDAMV
A0A7C5M4P4      D--EKFRNP-PFT-VD-CQLK--NANIYNKNIDVTIL------DK-ERYLLAYSLDEK--
A0A1W2GF52      D--ERYGNS-PFE-VQ-YDLT--NSALLDKRFDIEIL------NE-TDFYISSEYLGG--
A0A2G5L7B8      D--ERYGNS-PFI-VD-VQVS--DPSILNRRIDVEIL------SD-DHFVMDFELHGT--
A0A2D8JJW3      I--FKYKED-KKD-TVSF-LF--NNEIIDVPIHIKEG------CG-TLIENISETIQI--
A0A6B5PK86      E--EKYKLS-SVN-VQPYHLN--DSTLVGTPVTIT-Y------VN-QLVNLNYVHEGK--
A0A2G2F510      E--EKYLSS-SYY-IQPYELY--DSTLINKEVRVD-Y------DG-ENISLSYLKNGE--
A0A316JZ08      E--ELYLAS-SFN-IQPYELV--DSTLIGQEIGIT-T------RN-DQVILSYSKGGK--
A0A2W1NDY9      E--EKFKQS-PYH-LIFYELK--DSSLINVPIYLK-D------GQ-DGLYLVFNANQK--
A0A5C8AQR5      E--EMYRTS-SFN-VQPYSLN--DSALCNVPIYVEYM------GN-NRIRLNYELHGQ--
A0A1G0CI31      E--EKYLQS-SFN-VQPFQLK--DSSLCDIPIWIE-L------KG-NKVQLSYQVGGK--
A0A556N0M0      E--EKYHQS-TFT-VLPYALR--DSSLCDVPIGVETT------DN-RRVKLTYVLNGQ--
F2IKD6          E--EKYHQN-TFT-ILPYSLS--DSSLCDIPIWIETL------EN-RKIRLSYSLLGR--
A0A1I7BM74      E--ERYTQS-QFQ-VQLFKLN--EPDLYNLPIYFYKD------NS-NQYKIKYNYKGK--
A0A2G2FJ17      E--KRYKQS-TFY-IKQSHIK--DSSVFHIPIYIKPK------AQ-GLVELSMQRHGE--
A0A1H4ADG3      K--PLYKKSLPFT-TSITGFS--TDNLDPSQLS-YEFTLNGK--------SGFTVSSDKH
A0A5B8VUR8      E--PLYKESLPFK-ISIEGFT--TDNLDPKQLR-YEFHIIST--------SGFEISSADH
A0A1V5IPN7      ---ESYPIS----------------------------------GS-AYPVGNLRRIQ---
A0A7G7G5F9      K--EVYVNYLPIK-VAVRQFN--PLVYDNQRIA-ISL---ED-KN-TFTLKDASG-VKAY
A0A2N3U785      E--EIYGSSLPIK-VVVSDLK--QPAF-GKTLR-VQI---KD-KN-NFVLND-EEKETLH
A0A0D3L8Q3      P--ELYGNKLPFR-VVTNKLD--SLAY-GKVIK-VHL---KG-NN-SYDI-EYNEKISSH
A0A519U664      K--EIYGQSVPIK-VLRSNVD--STAA-GKSFV-VFL---KA-DN-SFQLQDYTGTTNTY
A0A519MA34      K--EIYGQSVPIK-VLRNNVD--STAA-GKSFT-VFL---KA-DN-SFQLQDYTGAVTTH
A0A519UCX0      K--EIYGQSVPIK-VLRNNMD--STAA-GKSFT-VFL---KA-DN-SFQLQDYTGAVTTH
A0A5B6TJH8      I--EIYGKELPIK-LVVESLH--NSGY-NKELI-IHT---KD-NN-SFVLEEQDGKRSIH
A0A7Y0AA98      K--EIYGNSLPIK-ILPGKID--STAA-GNSFI-IKL---KP-NN-SFELTD-GGRTKIY
A0A0E3ZG78      I--EIYGSEVPIK-VLVNDLA--PPAY-RKSFV-IHI---KS-DS-TYNLDDNEGKMYTY
A0A1I6BRK6      R--EIYGEALPFR-IVRNGLD--STMT-GKSII-IHL---KK-NN-FFDLEDYKGITTSH
A0A243WAB1      R--EIYGRELPAK-LLIDKLD--STAI-GKSIT-LHL---HP-DN-SFQLEDYDGTVTSH
A0A6G8C8X6      R--EIYGRALPIK-VLLNGLD--STAA-GQSFA-VYL---KG-GN-SFTLDDYSGKVTTH
A0A4R5DL69      A--EIYDKS-P---------------------VILHLIDPKS-DQ--IKRTEVTYKITVK
A0A1M4YED3      R--SAYNTS-P-----VKVIA--QNPADLKRTEEIDLSVNAT-TN-VVTVDGKSYPM---
A0A7T9DAA2      R--ELYDYP-PFT-VVLDSSV--KQVTGLPVHVKVDEAG-KK-FT--VNVKGKNVPLYDP
A0A7Y5V8S3      Q--ERYDYP-PFK-ITLDTAS--LQITGVPIHVAVDLAA-GT-YR--VRAEGRNVRLYNV
A0A126PFG0      R--DLYGRS-P-----VQFTL--VPTHSVPRQHVLDIVLKDQ-TS--FYMAATNGNLTAH
A0A7V5VRT5      W--EIYSVG-K-----VGRSL--I----FPNPFQIE----TS-DS--LQVMGRDFNMIFP
A0A3M1N7Z3      Y--EVYSIG-K-----VGRSL--V----FPHPFQISFSSPRA-ES--LFWQGGRVRVIFD
A0A7V1R2A1      Y--EVYSVG-K-----VGRSL--V----FPHPFRISFTSPRA-ES--LFWHGGRVSVIFG
A6EBM4          T--DLYPQQ-PLQ-IDILKID--SLQSGRQLILFDPI------DH-EKFTLTWTIGKEDI
A0A7X8C760      R--NLYKTT-PII-I-ETDYV--APEAYELLYK-ISL------HP-DGTFTINPQNERNI
A0A501VZX6      T--SAYITS-PVQ-IEVKHPE------ALKETAKVYF--------------HYNRASKQV
A0A399SH26      V--AAYTSS-PVI-VTHYNPD--AILATEDEPQKIYF--------------TYNPDLEEV
A0A501W1A9      V--SAYTSS-PIK-VILKSFD------KVQEQPAVYF--------------TYDEAKKQV
A0A0E3ZGV6      V--PAYTSS-PIT-ITLKDPE------KATENPMIFF--------------TYDESSKEV
A0A1I2N4S1      I--PAYNTS-PIT-ISLKSPE------TAVEYPAVYF--------------TYDQATQKV
A0A2T5YE44      I--PAYTTS-PIT-ISLKSPE------TAAEYPAVYF--------------TFDQATQKV
A0A4Q8RX32      E--NLYTSS-PFE-V-IIDKN--HLQMTNVVFN-VEV---LS-AS-EFVL-SAKNEECML
A0A1M6TTV4      D--ERYGNS-PFQ-V-LYNEL--SSELLDRRIY-IEF---VG-DN-HFYL-SLDHDQTEG
K0X1U5          K-KEYYRNS-PFT-VDIPESM--VDTLSSGFVVKVQTGGSDD-KI-KVLL----------
R5EXK3          K-KEYYRNS-PLT-VEIPESM--VDTLSSGFVVKVQTGDSDD-KI-KVLL----------
A0A401UAP7      Y--ELYKNS-PFK-VTPIEVN--NSY--------YNLNHTIDKKS-EAQFEITLSDGEKL
A0A523GAC0      D--EKYRSP-PFK-V-EYTFL--DNWVYDQQFT-VAI---SN-ED-EFIL-GYPDHTQIP
L8JW09          D--EKFKTS-PFI-V-DYNLK--NPQLLDRRIF-VNI---VD-EK-TYTI-NFSGDEQEK
A0A364XUP5      H--ELFGNT-PYH-I-EYKNV--DDGLYNIPLH-------LT-ET-DGNSFSIKVGESQR
A0A1M5RLA9      D--ELFQNA-PFL-V-RYKAQ--NESSFNVPIH-------LD-DS-GSDEFTLQVGDEGQ
A0A385SFR9      D--ELFQSA-PFV-V-RYKAQ--NESSFNAPIH-------LD-DT-GNDEFTLQVGDEGQ
A0A5M4A9J4      LEKELYNNA-PFR-I-EWLSR--HQQLVGATFE-FDA---QP-HS-GRFILNVTGEKPRT
A0A5M4B1C7      HTSELYHKS-PFV-V-KWNKG--HPQLIGATFE-FTV---DD-KG-HTSELKVKGEKPAI
A0A0D3LFR6      D--EKYRSA-PFK-V-DYLLK--DERFFNQKIY-VNI---HD-LQ-EYTL-SYFQGENEV
M7N6D4          D--EKYRSS-PFE-V-SYLVK--DESFFNRRFF-VRI---HN-SE-EYTL-SYQLGDQEI
A0A5C7MX19      E--ELYKNC-PFE-L-KMDVK--DLDILRVPIY-INI---ID-EE-KFSI-NHIYKDGEF
A0A1M5BA90      R--SAYTSS-PVT-IELEYPN--NIQ---D-TDRIDF--------------VYNKGNNTV
A0A512B879      Y--SAFTSS-PVT-VELADPD--MIV---EVVERIDF--------------TYNKIKKTI
A0A559PPI3      V--SAYNSS-PIQ-IKLKNPD--EIVIEKDVPAEHYF--------------TVDFSKKNV
A0A1T5CS78      I--SAYTSS-PIK-VIVKEPN--RISISNEEPEKHFF--------------NYNFNEENV
A0A0Q9Z8F1      I--SAYTSS-PIK-VIVEDPN--KISLSEDEPEKHFF--------------KYNANDEKV
A0A2N0U0M7      I--SAYTSS-PIR-VIVQDPN--RISISADEPEKHFF--------------KYNANDEKV
A0A1Q3ZMZ7      S--QIYQSS-SLG-YKSLLIK--DSSIIGQPVY-LIL------QD-ENLI-RYQSKGKTY
A0A7Y3KMD1      H--QIYHTT-PLT-VTPDSNA--RKYLKGVRVY-LNI---SE-AG-GGQL-AYKFNDSSF
A0A3C1ITV0      YVTDWYDKT-PIC-V-EYKNL--PDHVGEQPLNSVTFVAEKEGQS-QLTVKDFKINGIKS
R7HN19          YVTDWYDKT-PIC-V-EYKNL--PDHVGEQPLNSVTFVAKKEGQS-QLTVKDFKINGIKS
A0A2W2AFF7      T--PLYEDV-PFH-FVFIPLY--EDSVSKDM---YTFSVKIN-GD-NIALKCSGKKCNNV
A0A845PZ37      Y--ELYKSS-PVQ-VKVLGKK--TEESYTFTVTPLNA-------S-YVTIKSAAKSDKTN
A0A077ENE7      Y--ELYKKS-PVQ-VKVEGIS--SEGSYNFTVIPLDG-------N-SVIIKNWNPENKDK
A0A854FRG7      Y--ELYKKS-PIY-AKVLGKR--AEDSYSFVITPIDS-------R-SVIIKNWSKNGNEK
T0NN57          Y--ELYKKS-PIY-AKVLGKR--AEDSYSFVITPIDS-------R-SVIIKNWSKNGNEK
R7PCR1          I--SLFSIR-PFN-V----VF--QAPFSKALAFDVKI---LD-EN-SFELKNLQFEDFDS
A0A2N5YXE2      T--ELYGNT-PFE-V-NYRIN--NTVILDQKVN-IEF----V-DY-KCHL-YYKIGNQDY
A0A2U1FKU2      E--SLYANS-PLS-IKITNRD--STEGYSFR---IQI---KD-EK-TFRLTHFKRHAGRG
A0A0A2F954      E--SLYGNS-PVS-IQITDRD--STENYSFR---IRI---ND-AH-SFQLTHFEQKERNG
A0A0A2FW91      E--SLYGNS-PVS-IQITDRD--STENYSFR---IRI---ND-AH-SFQLTHFEQKERNG
A0A2D2N2N1      E--SLYGNS-PVS-IQITDRD--STENYSFR---IQI---ND-AH-SFQLTHFEQKERNG
Q7MWZ2          E--SLYGNS-PVS-IQITDRD--STENYSFR---IQI---ND-AH-SFQLTHFEQKERNG
A0A212FSE5      E--SLYGNS-PVS-IQITDRD--STENYSFR---IQI---ND-AH-SFQLTHFEQKERNG
T2NDT6          E--SLYGNS-PVS-IQITDRD--STENYSFR---IQI---ND-AH-SFQLTHFEQKERNG
A0A1R4AFZ0      E--SLYGNS-PVS-IQITDRD--STENYSFR---IQI---ND-AH-SFQLTHFEQKERNG
A0A1R4DVZ7      E--SLYGNS-PVS-IQITDRD--STENYSFR---IQI---ND-AH-SFQLTHFEQKERNG
A0A1V9FHD0      T--SAYLSS-PIT-IVAQDPD--QVKETGDTDVLFSVNYFPG-PN-GKASK-----EIKE
A0A4V4H170      T--SAYTSS-PIT-ITARKPD--DLKETGEVDVQFTVNYFSD-NN-GGEFRDVIK-KVRE
A0A1V9F098      T--SAYNSS-PVT-IIARKPD--ELKSTGDSVVHFQVNYYDD-NN-AGEFRNVDEPKVKE
A0A4R2VU64      T--SAYTSS-PIT-IMARKPD--DLKETGDSDVYFMVNYYAN-NN-AGEFKELSNLKVKE
A0A0K8QSK7      P--EVYTAA-PFV-V-EWDRS--HPQMIGTRIR-LTF---AG-DG-KIRY-QAEGENVRV
A0A7C0WKI7      S---------------------------------------PE-KD-SLKLFYVEKAKGPV
A0A1T5K9D4      I--ELYRNA-PIR-I-FFSRE--DNPIGYFTIK-ATP---RD-SK-TIELDLSSLGQKNV
A0A5M4B212      S--ELYRNL-PFH-V-EWDRN--HPQLLDANFD-LHI---LP-DN-RIEM-TVRGKEAIR
A0A3D1KEX9      V--TLFKHN-PIK-V---EFL--SPYFEDISFE-VEL---LP-SK-QLKVSDMQIDDSDV
A0A358Y7S2      Q--NLYRET-GFS-LMVYSLN--DSSLCGTEMH-VSV------EN-DLILIDYEKSGAKN
A0A2J6HHN3      S--ELYKSA-PFK-V-YYELI--DSTFYAESLD-ITI----H-DD-HLNVSYMNLDGSME
A0A1Y3WMT8      K-VEYYGNS-PIT-VDVPESM--LDTLVSGFVVKVQTNKGSD-KI-KVLL----------
A0A1Y4GQU1      K-KEYYGNS-PIT-VDVPESM--LDTLVSGFVVKVQTDKSSD-KI-KVVL----------
A0A6A0R272      Y--ELYRKS-PIN-L-NLLSA--SDEITPLEID-LEF---KD-EN-HFII-SYEKNGIRD
A0A1V5W8T5      S--ELYNKT-PFF-V-EYQDV--QSAIFNKNIY-LDY---NK-KT-DKITIEYSLDGEKS
A0A2T8HKA9      I--ELYKDS-PIR-VTFTKLD--PEAHASMTII------PKD-SN-HVDFLLMENDNIIH
A0A1X7J248      D--ERYRFT-PFT-V--SYDK--SCAAYGEKFF-VDI---ID-KT-NFKISTNQDGEEWV
E4TQD2          E--ERYRFS-PFT-V--SYEK--SCANYDQKFY-VDI---ID-KE-NFKLTTNPDEDQWI
A0A2I0QZ80      E--QRYRQG-NLE-ISPLLLK--DSSLLNTPIN-ITT------EG-NKIFLNFTHQNKAH
A0A3E1F1A3      E--TLYKQN-SVS-IDPVLLK--DSSLFGVPIY-LSV------DE-EKVLMRFNHKGVDY
A0A2U2XBJ3      E--TLYKQG-VVR-IMPLIIK--DSSLFGTPIF-LSS------ME-DKIIMNFKFNGGNY
A0A4Q4KU94      E--TLYKQG-TIR-IKPLIIK--DSSLFGTPIF-LSA------FD-DKVIMNFKYNGGNY
A0A3B8INU3      D--EKYKES-PFE-A-TITVR--NPAVFDKKVM-VTI---LD-ND-RYEIRFPWVGEDVQ
A0A7V6V2N8      F--ELYRSA-PFL-F-TYEII--DSLIINKLIN-IEI---KN-DN-TIDI-FYKINNNTY
A0A414ZBF2      R--ELYNST-PFT-VVFQDAE--PGQEISLT---ATA---ID-GN-RALLSDFVLDENDF
A0A7X9D3Q8      R--ELYSST-PII-VDFTDID--PLQSISMT---ATL---LE-NR-QVELQEFQWGKEES
A0A1Q3Q573      ITEDLYQSA-PFE-I-LPEQI--APEFYGNPVY-IRL---VN-KN-SMVV-SYSFNGDEF
A0A662BAY3      R--EIYKES-PFE-V-IWDYE--HPQLIYADFL-LEI---LP-DG-KLLI-KVEDEHAAI
A0A4U3L369      I--ETFEKT-PYS-VHLVAMR--DSI---APFT-LHW---KE-VN-PTSYALFDSKDKQV
A0A4S8HY23      NVTSAYTSS-PIT-ITARKPD--ELKETGEVDVPFSVNYFSN-NN-AGEFNGLIKQKVKE
A0A1V9F383      NETSAYVSS-PVS-IVAKDPD--ELIETGDTDIVMSVNYYTD-KE-RRAATNVYKDKVKE
G8TRZ6          NETSAYISS-PVS-IVARNPD--ELTETGDTDIAIAVNYYSP-KE-MQVAHNGYKDKVKE
A0A357YNR3      N--SLYGNESPVL-VRMSDKD--LNNLIDKVSIDVVV---YP-TG-NYNF-SVEYNKNNF
A0A7X6YKE8      N--SLYGNESPVL-VRMSDKD--LNNLIDKVSIDVVV---YP-TG-NYDF-SVEYNKNNF
A0A5E8AX52      E--ERYRNS-PFV-V-SYKLH--NTGFFDRPID-IEI---IS-ES-EFEL-SFEPAEQSG
A0A1V6CN82      A--ENYTDA-AFR-V-EWDRN--HPQLIGFDFR-ISV---HP-DR-SITL-SGFGEGVGV
A0A1M4XZ45      A--ERYEEV-PFQ-V-IWDED--HPQIINADFY-LTI---QP-DG-KLRV-EMDQEDVAV
A0A399D319      S--ERYKEV-PFQ-V-VWDEE--HPQVIDADFF-LTI---EP-NG-KLKI-DMEEEVISA
A0A7Y1YS85      S--ELYKDS-PIV-IDTFALA--GDR--------VKLSFFIK-MD-YTQSFSFSQAADEE
F4KK08          K--DLYKQS-PVS-IRFVNAD--PDEKISLRIK-SDKEAHNQ-VI-LYDIKSSLIGKVQE
A0A7V5VE02      R--GEYARD-------RKGVL--AGVISGIKGL-LGI---ED-ES-DEYT----------
A0A496LCF9      V--PLYGRS-PIS-IEIINIY--EEGYYMYYSY-----KKRD-SH-SFTITIYDNTDNEI
A0A5P2G2A9      R--ELYKDK-PFG-I-TLSNN--ADPIKGYKFE-ISS---WD-EK-GIALIRKIKDEDDS
A0A3C0ZQC7      I---------------------------------LIIWDRAE-SG-PEDI----------
A0A3N2N6F7      V--SLYGDSMVLS-VSLPDIS--VNRGLRMRMT-I-----LE-DG-KVEVSDMYDHLGNE
A0A419VXB7      F--ILYGNE-PCH-V-EFEPD--AFNLKGVPVH-ISP---IN-DR-EFKIEVKSKANLLG
A0A1Q6E6I7      S--YLTAESSPLK-L----TA--DTIRYTFNIH-IKSIEDAD-GS-FKALLEYRLPGQKT
A0A3B9CNN6      S--YLTAESSPLK-L----TA--DTIRYTFNIH-IKSIEDAD-GS-FKALLEYRLPGQKT
R5X290          S--YLTAESSPLK-L----TA--DTIRYTFNIH-IKSIEDAD-GS-FKALLEYRLPGQKT
C3J7R8          E--MLYKDT-PLE-VRFVGNS--SDVYCKLEVSSVDA---SH-VS-LLCEESSIEAARGT
A0A1G8BVM8      K--DLYTSS-PIE-V-EYMDD--VAKQGMFTIT-VTL---LK-NN-KAKL-TYNISETRD
A0A1I1FXP9      S--EMYKSS-PFR-V-EYEVK--NPAFYDIPVD-VLF---ID-EK-QFSL-KYKLGNVNY
A0A4P7VVU7      I--TLYGDSCPVS-VDFLSIP--SKQSASME---LDI---RD-DG-KIDISKMMLNGVEC
A0A2V1ILM4      I--TLYGDSCPVS-VNFLSIP--SKQSASME---LDI---RD-DG-KIDISKMMLNGVEC
A0A3N2L0E8      I--TLYGDSCPVS-VDFLSIP--SKQSASMG---LDI---RD-DG-KIDISKMMLNGVEC
A0A3N2LFC5      I--TLYGDSCPVS-VDFLSIP--SKQSASME---LDI---RD-DG-KIDISKMMLNGVEC
A0A7K3KWJ8      I--TLYGDSCPVS-VDFLSIP--SKQSASME---LDI---RD-DG-KIDISKMMLNGVEC
A0A3N4H5N3      K--EISPFSLPVE-IEVHEIN--NDFVGGGELLQIHL---KE-EN-KFEL-ILEDEKKAE
A0A2P8EAX2      R--EISPYNVSIN-IVVHEFN--EEFLLEGEVFTIKV---LN-EK-KFEI-EFAKNKKTE
A0A4V2F6N9      K--ELSPYNVPVN-LIVHEFN--EEFLSGVEVFAITI---LG-DK-KFEI-NFKDNKKAE
A0A838T9G8      E--ELYKSS-PFR-I-VAEVK--DGSLYNQSIN-FKF---IS-DK-QFQI-SYLWNSREE
A0A3B9FXJ0      T--DMYYNG-PFW-V-DIDVQ--DSTVLGDVIE-LRP---IG-DQ-KIRC-AYEWKGETW
A0A848SUJ0      FNTELYQTS-PFQ-V-NGKLL--DPRFEGVPVY-IEI---LD-KY-NYKI-KYSFDDLLV
A0A847ALW2      T--EIYDKV-PFI-V-LWDEN--HPQVIDADFF-VEL---LP-SG-KISLKMFEKGEVKV
B2RKZ8          E--SLYGKS-PVS-IRITDRD--STESYSFKID-I-----KD-SR-SFQLSDFKQQKLNR
A0A0K2J6Z0      E--SLYGKS-PVS-IRITDRD--STESYSFKID-I-----KD-SR-SFQLSDFKQQKLNR
A0A212GC82      E--SLYGKS-PVS-IRITDRD--STESYSFKID-I-----KD-SR-SFQLSDFKQQKLNR
A0A0E2M2Y7      E--SLYGKS-PVS-IRITDRD--STESYSFKID-I-----KD-SR-SFQLSDFKQQKLNR
A0A829KSZ7      E--SLYGKS-PVS-IRITDRD--STESYSFKID-I-----KD-SR-SFQLSDFKQQKLNR
R5GSU5          S--TLYKKR-PFE-A-TFLRP--AEIDEDITFK-VDL---ID-NQ-KFRIFDVRYKDEDC
A0A7X8I6A2      T--ELYRST-PFI-V-EYKID--SNNIYQENIF-VHF---YS-ID-SCQV-RYESDGIEY
A0A0A2G557      K--KLYKET-PIR-L--TLLN--TSDTLSGSFS-LSF---IE-EN-KVSLSNFEGDFEQL
A0A1T4PT95      K--KLYKDS-PIH-LTLLEFP--ED--HSGSFI-LSF---EG-SD-KVRLSHFKGDFSKT
A0A6I6JYY3      S--ERYREV-PFT-V-EWDEA--HPQLTNSEFL-LQI---DA-NG-KLHL-KAQGENAEV
A0A651GU15      R--QLYRVP-QPK-LNLVAIT--DSSILDKQIF-IRN---LA-DG-RYEL---HLNNNAI
A1ZKR2          A--EYYKNP-PFK-VIDHQVK--SDAFLDKNIN-IEI---ID-DQ-RFQL-SYVLGTQTV
A0A1Q3GX01      A--EYYTNA-PFK-VVDYKIK--APVYYDKKFN-IRI---KN-QN-EFEL-SFQVGTNLK
A0A349DQI4      A--EYYTNA-PFK-VVDYKIK--TPGYYDKKFN-IKL---KS-QK-EFEL-SFQTGKVLN
A0A4P5TMD1      E--ERYKTS-PFE-I-VPTVN--EPALYDIPIY-FIF---KS-AR-EFQI-EYRILKVKY
A0A3Q9FR88      S--ELFGDAVPFT-FEYPNNV--QPTLKDLPFF-LEF---SN-GG-KDFIITYKIGEQQI
A0A553GEX3      S--ELFGDAVPFT-FEYPNNI--QPALKDLPFL-LEF---SN-GG-KNFIITYKIGEQEN
A0A150ADJ9      S--ELFGKNLPFS-ITFPSGK--LPFLQDKPIL-LNF---SG-DG-KSYQLTYNQGKS--
A0A7X9P1P7      S--ELFGESIPFT-ISFPSNK--LPSLQNTPIL-LNF---SE-DS-KSYKLTYNKGKS--
A0A7X8SM94      S--ELFGNSVPFE-LSYPSGK--QPGLTNQRFF-IQF---TD-QG-KNYTIKYKIGEDEF
A0A1S1Z228      S--ELFGDGVPFT-LTYPSGK--QPAFKDIPLF-LQF---LN-GG-DQYQVTYKTGDQEN
A0A1B1FWQ4      S--ELFEDGVPFT-LTYPSGK--QPALKNTPFY-LQF---SN-EG-KEYVITYKVGQTEK
A0A7X9Y5D2      S--ELFEDGVPFT-LTYPSGK--QPALKNTPFY-LQF---SN-GG-KEYVITYKVGQTEK
A0A7X8ISG0      V--EMFPDR-PFE-I-KINSL--HPQLHNKPID-IAF---LK-EK-KGEI-SYELNDKTF
A0A2N3IIZ0      N--EMHGFS-PIE-V-QAVVL--NENLYNQKFY-IES---ED-GH-SYNI-EVKNDKKTL
A0A7X8Q7Q7      Y--EMYKTY-PFE-I-QYELL--DSSINTISIE-LKV----K-ND-HFVIN--KVQGEEV
A0A2N2WFW8      F--ELYDGA-PFH-I-QYQIV--DSLSYGTPYS-LTV----G-DS-TFVISTKTAGGTES
A0A1F3IU95      F--ELYDDV-PFD-I-KYEIV--DSTFYGVPLL-IEV----H-DT-GFVIT--EINGIQT
A0A3D0VUF6      F--ELYDDV-PFD-I-KYEIV--DSTFYGVPLL-IEV----H-DT-GFVIT--EINGIQT
A0A7K3WUF2      D--QRYPTS-SFV-LELIAIK--DSSIMDTPIF-VHF---NK-DN-TFQL---KVGERNL
A0A497D5Z2      S--EMYRNP-PFR-V-QWEEG--HPQVINADFY-VSF---LP-GG-KLEL-SVDGENVPV
A0A662B170      S--EMYRNP-PFR-V-QWEEG--HPQVINADFY-VSF---LP-GG-KLEL-SVDGENVPV
A0A7X7FWB7      V--EIFPER-PFE-I-QVINI--SPILYNKPID-IIF---ET-ED-RGII-SYEIKDETY
A0A7X8DM61      V--EIFPER-PFE-V-KIDYL--HPRLYNKPID-ISF---IS-EE-KGEI-SYALNDKTF
A0A3M1CDV2      H--ELYKNS-PYL-A-DINIK--NENIYGKKIY-VDF--NDN-LQ-TGKI-KILLSEDNL
A0A1F3SJM1      E--EKYLSS-SFH-VQPYELR--DSSLVYEGTE-VAV--AYN-NG-KVVL-SYLKNGKKK
A0A2G2EB96      E--EKYLSS-AFN-IQPYQLS--DSSLINQEIA-V-T--SSG-NS-KVKL-TYVKNGKQV
A0A2G6PRA9      E--EKYLSS-SFN-IQPYELS--DSSIINQEVA-V-V--SKG-RN-KVEL-SYVKGGEKQ
A0A7Y7A9N2      E--EKYLSS-SFN-IQPYELS--DSSIINQEVA-V-V--SKG-RN-KVEL-SYMKGGEKQ
A0A6C1QGZ7      H--ELYRNS-PFT-V-DIIVK--DPSIYGIPVY-LDF---VS-QE-NIII-SFTHRGQSK
A0A7W1EH85      N--ELYHLS-PYY-V-KINSK--LPMNSAQKIY-VEL-------N-ENLT-GGILKTGSR
A0A2E3XZI5      R--LLYKKN-TYK-LENFYIK--DSSIISKKIY-LKF----E-KN-YFSL-VDEENEKIY
A0A6I7QXV0      VHSELYRSS-PFT-ITIDEIK--DPAIYEREIY-INI---ID-RN-TFTL-EYEINRNRI
A0A7Y3V126      Y--ELYKNS-PFT-V-EYEIA--DSTLYNKPFH-FTV---IN-EN-LLSL-TYTKNGTLL
A0A7Y5C3U1      Y--ELYKNS-PFT-V-EYEIA--DSTLYNKPFH-FTV---IN-EN-LLSL-TYTKNGTLV
A0A2M7NLQ9      NYFERFQDS-PFE-VTEYEVY--DASFYNRHLD-IQI---ID-EE-EFVL-TYQTATGED
I4AFR0          NYFERFQDS-PFE-VTDYEVY--DNSFYNHPLN-IQI---ID-EE-EFVL-TYETPTGDN
A0A2N2Y3E5      T--EQYRNS-PFT-V-VFRNE--GFKHFDVPIA-LDF---EN-IT-DGWL-YFQNNSSAE
A0A2D9D7T6      K--DLYRSN-LVS-VEPVKLL--DSTLCGVHFD-IK----EK-KG-KLEI-SYTHNGQSK
A0A1F3PPL5      N--EMYKSS-PFE-V-KVKIN--NGAIYDKKIY-IDF---EN-PT-TYHL-KINSDDLEF
A0A357QK06      N--EMYKSS-PFE-V-KVKIN--NGAIYDKKIY-IDF---EN-PT-TYHL-KINSDDLEF
A0A7X9JJJ8      F--ELYRSS-PFN-I-EYQIS--NPYFYRLPFY-VSF-------I-DRSV-ILKYGADKK
A0A522EYA6      N--EHYGTT-VYT-A-ETEVK--SDIIYGTKIY-VYF---DS-ET-SGEI-TYTVGDQIK
A0A662AEA4      T--ELYRTS-PFI-V-KTKIK--NPSIYNTPIF-VNF---NN-KN-SFSI-QYEINGNEY
A0A0S2HYK8      D--EIYQSS-PFE-I-QYKIK--DSKAFGIPVF-ISF---KD-KK-NVVF-EYEYNGETY
A0A2N5ZWN6      T--ETYNNS-SYS-V-NYEIQ--NPSIYGEPIH-IQF---ID-EN-NAKI-EFEIGDNII
A0A2E0FJ09      H--EKYNGS-LFL-VEDFQLL--NSSLVNVPIY-VLL---KP-DK-TIHL-KYTVDEETF
A0A1F3FZ62      F--DVYRNT-PFI-I-EQKVF--NPSIYGINFD-IEF---KG-NN-KYIL-RYLLNEKLN
A0A1F3K211      F--DVYRNT-PFI-I-EQKVF--NPSIYGINFD-IEF---KG-NN-KYIL-RYLLNEKLN
A0A7Y1UDU0      F--ESYKST-PFT-I-IPHIT--DSSIIGTRIN-IRF---NE-NK-RFDL-DFTDHSQTL
A0A1V6I2U9      T--ELYGST-PFE-I-KYNII--NTEIYDQNID-LEF----K-DY-KCHI-AYTLGNQKY
A0A2H0B957      S--ELYKAT-PFT-V-DFHIT--KGNLYNIPIY-VSF---SL-NG-DAAI-KYTYNNQIV
A0A1F3CFW6      N--ELYKAN-PFS-I-DYKNT--KRNLYNVPIY-VSF---DK-NG-DSNI-KYKTNNTNF
A0A2M7E2T8      N--ELYKAN-PFS-I-DYKNT--KRNLYNVPIY-VSF---DK-NG-DSNI-KYKTNNTNY
A0A2M7NC69      N--ELYKAN-PFS-I-DYKNT--KRNLYNVPIY-VSF---DK-NG-DSNI-KYKTNNTNY
A0A1F3KLL5      T--ETYRTS-SYI-I-EVRNV--EPEMYNNQIY-ISF---LN-KN-SFTL-EYYINGVKS
A0A359D1M1      T--ETYRTS-SYI-I-EVRNV--EPEMYNNQIY-ISF---LN-KN-SFTL-EYYINGVKS
A0A0F2NS19      Y--ELYKNS-PFK-V-FFEVK--DSSVLGKKFY-LEK---TN-NE-KFNL----FQSEKL
A0A2A5H8X6      Y--ELYKNS-PFK-V-FFEVK--DSSVLGKKFY-IEK---TN-NE-KFNL----FQSEKL
A0A2H0GAU8      N--ELYVGS-PMK-V-NYAIK--DSSIVGIPFF-IEI---TK-NN-KFNL----FENETL
A0A2M8FTK1      N--ELYVGS-PMK-V-NYAIK--DSSIVGIPFF-IEI---TK-NN-KFNL----FENETL
A0A2A5B3B0      N--ELYRST-PIK-V-SYVIK--DSTILGQSFF-VEF---ID-DY-KFRL----TQNDKV
A0A5C6RXM7      H--ELYKSA-PID-V-EFNIK--DSSIINHTFN-VVI---ND-IN-QFEL----RDGEEI
A0A7W1FWM4      Q--ELYTSS-PYT-V-EVKIN--NPQIVGNKIY-IDF---NN-EV-QGII-NYNFQGKAY
A0A7T9QP55      E--EYYRQS-FYN-VDHLKVI--DAEVWGRPIS-VMP---LD-DG-NLQL-TYTIGVTPY
A0A7V9MK11      F--EQYTSS-PYT-I-EIIEH--NPAIEDLPIF-IDF---YE-NG-KTEI-SYQYGQNEI
A0A1F3C1M2      N--ELYKNA-PFT-I-EFNIK--NNIVYDIPIY-IEF---ID-KL-NFNL-SFTINEKTI
A0A1F3DS87      N--ELYKNE-PFS-I-EFNIK--NNIIYDVPIY-IEF---ID-KI-NYNL-SYEINDKKF
A0A7Y5QSG1      N--EMYTGT-FFR-IEDVEVL--DPRVRDVPVY-IEL----------------DTEGKAT
A0A7Y2EX06      N--EHYKRA-FYQ-INIIELK--DSLCIGRQFF-VEM--------------------TSD
A0A7Y7NV14      Y--ELYKNF-PYN-I-EVNVK--SSSIYSIPIF-IKT--------------------IKN
A0A6A0R6K9      N--EIYSNN-PFD-V-NILWK--DSTMGSRKVM-IDFVSKEK-GT-LSWH-EGEKIVRQN
A0A2E7CT70      S--DLYKTS-PFE-IKDLKIR--DSIIIGLPIY-IQK----K-GD-YFIL-TDFDNQKSY
A0A2D5V560      R--FLYNQS-PXS-FENFSIK--DMSIISKPIY-LLF----D-GN-YFSL-TDEKAEIIY
A0A2D7K5A8      R--FLYNQS-PFI-FENFSVK--DESILSKAIY-LLY----D-GT-YFSL-TDENEEIEY
A0A2E1XQ82      R--FLYNQS-PFI-FENFSVK--DESIFSKPIY-LSF----D-GT-YFSL-KDKNQEIEY
A0A1F3K695      N--ELYRMS-PFT-V-EANIL--DSRIYEIPIY-IDF---IS-SK-ETKA--LYKIGEEN
A0A353KZR1      N--ELYRMS-PFT-V-EANIL--DSRIYEIPIY-IDF---IS-SK-ETKA--LYKIGEEN
A0A2N2WYB5      T--ELYKRS-PFK-V-EWKTL--NPSIFNTPIY-IDF---TD-DK-NGIITTYVKKEGYD
A0A1F3K4G0      T--ELYRRS-PFQ-I-EWKMI--TGKLYDIPVY-IEF---DG-SE-KALI--YYGDGGVN
A0A356H8Y3      T--ELYRRS-PFQ-I-EWKMI--TGKLYDIPVY-IEF---DG-SE-KALI--YYGDGGVN
A0A351HSA6      T--ELYRRS-PFQ-I-EWKMI--TGKLYDIPVY-IEF---DG-SE-KALI--YYGDGGVN
A0A2A4PYG9      S--EIYTAS-PYT-V-EVRNV--GPGLLGKPIY-ISF---PS-TK-KIYT-SYYVGE-EQ
A0A350JJ90      H--ERYLSS-DFE-V-IYEIH--DPIILDRRIY-IEF---ET-PT-SGTI-NYLVGT-KS
A0A2A4YXP3      N--ELYRSS-PIK-V-EHQVK--DSSILGQHFY-VKF---ID-TH-K-----FELVVNKL
A0A1F3R158      F--ELYKNS-PIN-I-EYYIK--DSSVIGISHF-VEI---TN-NN-K-----FKLYENEK
A0A2M8ADX2      F--ELYKNS-PLD-V-NYDIK--DSSIIGLPFY-IEL---TQ-ND-K-----FKLFENET
A0A1J5B2H0      F--ELYKSS-PFE-I-KYSIK--NPAIYGIPIY-INF---ND-DK-QIKI-SYCISDNSK
A0A1V5N756      T--EMYRSN-HYN-V-HYVVK--KPVIYNVPIN-ISF---LS-NS-NIHI-DFEAEKKSN
A0A4P5U6G4      E--EKYKSS-PFE-I-LPLVK--TNSIYDLPIN-FEF---IN-NK-SFKI-SYRIGQ-QK
A0A2E2TFD1      Y--ELYMSS-PYI-V-DYDII--SAEAFAHKYY-IYF---PN-TT-QIHL-SIDEPIGDA
A0A2E4ELE6      F--EHYKSC-PFE-V-KFEIK--SPEAFGKDYY-VYF---ES-EK-ELIL-TIENGKETV
A0A2A3UE91      N--ELYDSS-PYL-I-KINAK--KGTVYGSQIK-VEL---NK-QL-TGGV-L----KIGT
A0A7V9SRJ9      N--ELYHSS-PYL-I-KINPK--SGIVYDQKIY-VEL---NP-KL-TGGI-I----KIGG
A0A2E6SYP1      T--ENYRSS-KYK-I-SYQIK--DKSVLNKLIQ-IEF-------V-KGCA-LLSFNDDPS
A0A2E5RLE8      T--ENYHSN-PFS-I-SYQLK--KREAVKSPIM-VNF-------S-NGSA-IISKVDVDS
A0A2E7TQF6      T--ENYHSN-PFS-I-SYQLK--KREAVKSPIM-VNF-------S-NGSA-IISKVDVDS
A0A2E6GVY9      T--ENYQSN-PFS-I-SYQLK--KRKAVNYPLM-INF-------K-NGSA-VISKMDVDS
A0A2A5FYT6      T--ENYANH-PYS-V-GFQVK--DSSIFGRKIY-IQF---DD-EF-KAIA-SYTIND-SV
A0A6N9NIX1      K--ELYVES-PFV-V-EFDLI--DSSLIGRPIF-VDF---SN-KT-NGSI-SYTNTNLEV
A0A1F3Q014      N--ELYTSS-PYS-V-DYKII--NPKISGVKIY-IDF---VD-ST-HGTI-SYSFDNETE
A0A2D5KD44      N--EIYKNA-PFN-V-EVLYK--EPSLSSTKID-ISF---AN-SS-SGKL-SWGEGK--E
A0A7Y2F301      S--EHYKSS-GYE-V-KTLAI--NDSTQILNSP-FFI---DF-SN-SGSF-NITFKN--Q
A0A0E3V905      R--EIYTDS-PIE-LIVESG---KPELYKKPLE-VSMLSNKAVK----------------
A0A553ETH6      D--EKYQNS-PFR-VKFIVK---DGNVYDKRIY-VRLINKTKYQ----------------
A0A2D4ZVH1      ------------------------------------------------------------
A0A6P1P355      I--PAYTSS-PIK-IKLRNP---EEARETEKVY-FAFDKGKQQV----------------
A0A3D0MYJ7      Y--NLINED-GLR-KRLEGM---ASITAPKNLN-II------DI----------------
A0A4Q5WS95      R--SAYTSS-PVV-ITAFNL---DQVRTTPNIP-FTYDAAARQV----------------
A0A7V9RTA1      T--SAYASS-PVT-IEVNQP---EKLKYFDKIY-FTYNYKNKTV----------------
A0A5C8KAD6      T--NAYTSS-PIR-IKLKNP---EDIKQTVQVY-FTYNNKTKKV----------------
A0A5N1J695      I--PAYASS-PVI-IKVKNP---ERISEVPQVY-FTFNEGTHKI----------------
L8JI02          E--EKYGDF-PFI-VELDST---ISQMIDVPVY-IEPLPGGSYRI-EAVGRDVDVYNFLT
A0A1Q3PII2      T--ELYEKT-PYK-ITLLKPRTAKPTTYHIERR-TGNTFTVRTP----------------
A0A351BXT2      F--KIDEDK-KKF-YYILNH---GENEDVTALI---------------------------
A0A2K8Z965      R--ELYEDS-PIE-LIIEQP---ISALYKSPLD-ITLPGDNTVT----------------
A0A418M8U8      R--EIYKAS-PVD-VFVEFG---KPELYEEPML-LTFIDSSSVE----------------
I2GTA4          R--EIYKAS-PVE-VFIEFG---KPELYEAPML-LTFIDSSSVE----------------
A0A2K8ZAJ2      K--HIYQES-PIR-LIVEKP---TSQLYMEELK-FLFVDSKMVK----------------
A0A368JPA3      R--EIYEEA-PIR-IVLTDP---TPNLYRADLE-IGIISPTTVR----------------
A0A5N1JI29      R--EIYEEA-PIR-IVLTDP---TPNLYRADLE-IGIISPTTVR----------------
A0A7K0EGC9      R--EIYSDA-PVR-VVLNAP---TANLYRADLQ-IGIISPTTVR----------------
A0A3P1BT12      R--EIYDDA-PLR-IILKEP---TANLYRADLE-IGIISPTTIR----------------
A0A3P1CI15      R--EIYEEA-PIR-LVLSDP---TPNLYRADLE-ISIISPTTVR----------------
A0A4R8CUK1      R--EIYDNT-PVR-LVLDSP---TPNLYRADLH-IGILSPTMVQ----------------
A0A7Y6XX71      --------------------------DLTNSPY------FNLED----------------
A0A2H3NSN0      ----------------LRTA---ADTT---DTP------FQLFA----------------
A0A800J4N3      ----------------IL------NRAGGADGP------LTILE----------------
A0A2P6C324      ----------------IEDV---ADTTQGV-QF------TLLAP----------------
A0A7V2F6E1      ----------------LLET---ANAAGTRDRF------PILAP----------------
A0A1M6XHU0      ----------------IVAT---AETAGAKERF------PILAP----------------
G2SF81          ----------------IVAT---AETAGAKDRF------PILAP----------------
A0A5S9EYW1      ----------------IVAT---AETAGAKDRF------PILAP----------------
D0MHQ9          ----------------IVAT---AETAGAKDRF------PILAP----------------
A0A662AH13      F--NVIDKP-DSF-YNIFDP---KFEIIEENNN------P--------------------
A0A5C7QA01      P--EAYLDQ-PLH-LKINQN---NYQLLDANTA------EVLLQ----------------
A0A3D3LS70      F--KNSDSK-TDF-YYLINR---NKKVNSEHIL------QDELT----------------
A0A1G1TM36      L--HTLRGQ-HVL-NIVLQD---TASFAVRAAD------GTLTR----------------
A0A1G7ZF38      L--KSRPAK-PES-YLIIRE---TDSTFRLQTS------DHYYK----------------
C6VS52          I--QKQPPR-PET-YHIVRQ---AGDFYIIEIS------GSRFR----------------
                                                                            

A0A7V5RJC2      EEKLLDGQVFGSRDTLEVNGFYFSFSDD---VSALPR-----------------------
A0A7C1LGX3      -------------------NFTLFYKQSENALKTSPF-----------------------
A0A1T5MMH4      FLEKESPETFSLVWGEGTQKISGRYGAP---VH-ISG-----------------------
A0A2W4R1L8      FVDLGSTEAVRLRINQDGDQVSGKYGEP---ID-LNG-----------------------
A0A7L9BFB6      LIEPTSNNTYRLRIPVYASTYEGEFGKP---LT-SNH-----------------------
A0A5C8A5B4      NVK--------TQEVLPELIEKYEVDQV------VPM-----------------------
A0A2E5CV79      -------------------------------MS-LGI-----------------------
A0A2A4G4B1      -------------------EMPLHFNKE------IGY-----------------------
A0A0P7X1V8      -------------------WRAFPEDSS---IV---------------------------
A0A4Y9ITE2      FPAK---------------------------FD-TPY-----------------------
A0A3N2M1H3      RKFTIDGKIELAGEATL--PKG---KES---VK-TPI-----------------------
A0A4S2G8T2      RKFTIDGKIELAGEATL--PKG---KES---VK-TPI-----------------------
A0A212K7W5      T---LNGEELDFPD-----EEINL-SES---VN-TPL-----------------------
F5IU11          I---LNGEELDFTD-----KEINL-SEP---VN-TPL-----------------------
A0A7C1QWC7      LDNKITSSG--IQVYSD--TVCKF-NQT---VT-TPY-----------------------
A0A7Z8P8P1      ----VVGGK--KLSING--NH-AY-GDT---LQ-TEA-----------------------
K0XJ09          ----KIGTK--KSDNEG--QEFLF-GDT---II-SAA-----------------------
R5EUZ0          ----KIGTK--KSDNEG--QEFLF-GDT---II-SAA-----------------------
W0EQS0          ----SVGGV--KSEDRE--QEIAF-GDT---LV-SEA-----------------------
A0A1Y3WE15      ----SIGGG--KKSESE--QEIAF-GDT---LV-TNA-----------------------
A0A1Y4GUK3      ----NVGGK--KTNEGN--QQIAF-GDT---LV-SDA-----------------------
A0A352Z1R7      V---KDDDDKLVGEG----SSGRL------------------------------------
A0A7X7BZF5      T---RGDFE--FNDNKD--FFSF--SDT---VN-TPI-----------------------
A0A0A2F501      M---LNDNE--LQTQR---ITCSL-GDT---IS-API-----------------------
R5B7P0          I---HKNEK--VGGKP---VVGHY-GDT---LQ-TPV-----------------------
R5B0L5          V---LNNIP--VDLPNS--GVAIP-GDT---IR-TQS-----------------------
A0A6I1TEC0      KGTSSNGTP--VETNKT--VTGKL-GKL---VQ-TPL-----------------------
A0A3R5XWG1      KGTSSNGTP--VETNKT--VTGKL-GKL---VQ-TPL-----------------------
A0A5P0Y910      KGTSSNGTP--VETNKT--VTGKL-GKL---VQ-TPL-----------------------
A0A414YFM3      KGTSSNGTP--VETNKT--VTGKL-GKL---VQ-TPL-----------------------
A0A6A7UIA7      KGTSSNGTP--VETNKT--VTGKL-GKL---VQ-TPL-----------------------
A0A6A7VPS3      KGTSSNGTP--VETNKT--VTGKL-GKL---VQ-TPL-----------------------
A0A374THP7      KGSNRDNLP--VDDSDE--ISGRL-GQI---IH-TPL-----------------------
A0A6G1VND1      KGITRDNLP--VDDSDE--ITGRL-GQI---IH-TPL-----------------------
A0A0A2EVS5      I---LDGEP--MGEGQI--FLGEL-VDS---IP-TPM-----------------------
A0A1T4NAJ7      I---LDGEP--MGEGQI--FLGEL-VDS---IP-TPM-----------------------
A0A255T941      K---MYTEDGKVEYDKE--VKGNI-GKV---VM-TPI-----------------------
A0A4P7VSV0      K---SGDLK--SEER----VQGAM-NDT---IM-TAV-----------------------
A0A7J0AX49      K---SGDLK--SEER----VQGAM-NDT---IM-TAV-----------------------
A0A3N2KCL3      K---SGDLK--SEER----VQGAM-NDT---IM-TAV-----------------------
A0A2V1IJY1      K---SGDLK--SEER----VQGAM-NDT---LM-TVV-----------------------
A0A4P7VXK7      K---SGDLK--SEER----VQGAM-NDT---LM-TVV-----------------------
A0A1Y4CHN5      V---RNGEE--SDAE----ATGKL-NDT---IE-TPV-----------------------
A0A7Y5JED7      T---LEGED--VDGT----VSGAF-NDS---IQ-TPV-----------------------
A0A1M6I2S6      M---INGEE--LETE----FSGKM-GDS---IR-MEV-----------------------
A0A1Y3V692      M---IDGEE--LETE----FSGKM-GDS---IR-MEV-----------------------
F3PXM2          K---VEGEE--TGET----FSGKT-GDT---LR-TSV-----------------------
A0A174JCE8      I---VAGKE--TGER----FEGNI-GDS---IQ-TSA-----------------------
A0A3E4JMC4      I---VAGKE--TGER----FEGNI-GDS---IQ-TSA-----------------------
A0A412SND6      I---VAGKE--TGER----FEGNI-GDS---IQ-TSA-----------------------
A0A414IEQ9      I---VAGKE--TGER----FEGNI-GDS---IQ-TSA-----------------------
A0A7K0HNT3      I---VAGKE--TGER----FEGNI-GDS---IQ-TSA-----------------------
A0A0M1W8D8      I---VAGKE--TGER----FEGNI-GDS---IQ-TSA-----------------------
A0A3R6GKX5      I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A7V4S1          I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
B0NU19          I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
D4V601          I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A0A4Q0U3M9      I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A0A7J5G2G2      I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A0A7J5HH13      I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A0A397WLT5      I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A0A6N8DDD8      I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A0A6A2J529      I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A0A7S9QIA5      I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A0A015XH67      I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A0A078RZN2      I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A6L0K5          I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A7ACT5          I---VAGEE--TGER----FEGII-GDS---IQ-TSA-----------------------
A6KY94          I---VAGEE--TGER----LEGII-GDS---IQ-TSA-----------------------
A0A173UQR8      I---VAGEE--TEER----LEGII-GDS---IQ-TSA-----------------------
A0A3R6HK75      I---VAGEE--TEER----LEGII-GDS---IQ-TSA-----------------------
A0A412B7D1      I---VAGEE--TEER----LEGII-GDS---IQ-TSA-----------------------
A0A412VNY9      I---VAGEE--TEER----LEGII-GDS---IQ-TSA-----------------------
A0A414LTU9      I---VAGEE--TGER----LEGII-GDS---IQ-TSA-----------------------
A0A8B2YHC3      I---VAGEE--TEER----LEGII-GDS---IQ-TSA-----------------------
I9Q4U4          I---VAGEE--TEER----LEGII-GDS---IQ-TSA-----------------------
A0A373ISF0      K---VAGVE--SENT----FAGRM-GDS---IQ-TVA-----------------------
U6RF62          K---VAGVE--SENS----FAGRM-GDS---IQ-TAA-----------------------
A0A662ZZD5      E---VNGKA--FGED----FSGKM-GDS---IR-TEI-----------------------
A0A415NEB6      E---VNGKA--FGEE----FSGKM-GDS---IR-TEI-----------------------
A7AJ60          E---VNGKA--FGED----FSGKM-GDS---IR-TEI-----------------------
A0A6A2JF01      E---VNGKA--FGED----FSGKM-GDS---IR-TEI-----------------------
A0A7J5MKN5      E---VNGKA--FGED----FSGKM-GDS---IR-TEI-----------------------
A0A015UXN7      E---VNGKA--FGED----FSGKM-GDS---IR-TEI-----------------------
A0A642KJV3      E---VNGKA--FGED----FSGKM-GDS---IR-TEI-----------------------
A0A6I2NTL0      E---VNGKA--FGED----FSGKM-GDS---IR-TEI-----------------------
A0A6I2Q447      E---VNGKA--FGED----FSGKM-GDS---IR-TEI-----------------------
A0A016E4F9      M---IDGEE--LGID----FSGKM-GDS---IR-MEI-----------------------
A0A6N3HG44      M---IDGEE--LGTD----FSGKM-GDS---IR-MEI-----------------------
A0A7K0HSP7      M---IDGEE--LGTD----FSGKM-GDS---IR-MEI-----------------------
A0A7K1HEJ5      M---IDGEE--LGTD----FSGKM-GDS---IR-MEI-----------------------
A0A6H9P0U9      E---ISGED--IGET----LSAQM-GDS---IQ-TSA-----------------------
A0A108TH71      E---ISGED--IGET----LSAQM-GDS---IQ-TSA-----------------------
I8VXH0          E---ISGED--IGET----LSAQM-GDS---IQ-TSA-----------------------
A0A412S0N6      E---ISGED--IGET----LSAQM-GDS---IQ-TSA-----------------------
A0A412IIJ0      E---ISGED--IGET----LSAQM-GDS---IQ-TSA-----------------------
A0A0P0FM97      E---ISGED--IGET----LSAQM-GDS---IQ-TSA-----------------------
R6KTP3          E---ISGED--IGET----LSAQM-GDS---IQ-TSA-----------------------
A0A139LU87      E---ISGED--IGET----LSAQM-GDS---IQ-TSA-----------------------
A0A1C6B3Y5      E---ISGED--IGET----LSAQM-GDS---IQ-TSA-----------------------
A0A6L3KCD1      E---ISGED--IGET----LSAQM-GDS---IQ-TSA-----------------------
E2NMQ4          E---ISGED--IGET----LSAQM-GDS---IQ-TSA-----------------------
A0A412YDB9      K---VSDES--TGET----FSAQM-GDS---IR-TSA-----------------------
R7DY01          K---VSDES--TGET----FSAQM-GDS---IR-TSA-----------------------
A0A414LGK8      K---VSDES--TGET----FSAQM-GDS---IR-TSA-----------------------
A0A415IPQ4      E---ISGES--IGET----FSAQI-GDS---IR-TSA-----------------------
A0A3E5BRW7      E---ISEES--TRET----FSARP-GDS---IH-TSV-----------------------
K9DXS6          E---ISEES--TGET----FSARP-GDS---IH-TSV-----------------------
A0A1M6KFV3      E---VSGVD--TRET----FSAQT-GDS---IH-TPA-----------------------
A0A1Q6G7L3      E---VSGVD--TREN----FSAQT-GDS---IH-TPA-----------------------
A0A413H235      E---VSGVD--TREN----FSAQT-GDS---IH-TPA-----------------------
A0A358R8U0      V---RNGEE--IPSEKV--IKGNL-TDT---LT-TPL-----------------------
R6WSB6          V---RNGEE--IPSEKV--IKGNL-TDT---LT-TPL-----------------------
A0A401LPX7      T---RNGTE--IENDDI--VKGSL-NDS---IQ-SPL-----------------------
A0A6G0GNY9      T---RNGTE--TGDDNA--VKGKL-NDS---IQ-SPL-----------------------
A0A6I1BFM0      T---RNGTE--TGDDNA--VKGKL-NDS---IQ-SPL-----------------------
A0A3A5Z900      T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
A0A7K0GW19      T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
A0A285TGL6      T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
A0A3A5RFX4      T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
A0A1Q6IUW9      T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
A0A413XDP6      T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
A0A6N8CVT6      T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
K6AP24          T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
A0A6I2NHV3      T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
A0A662ZYI7      T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
A0A078RYI7      T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
C7XEQ8          T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
D7INX6          T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
K5ZG55          T---RNGTE--IENDGF--VKGNL-NDS---IQ-SPL-----------------------
A0A7Y5MWI8      S---RNGED--VAG-K---ITAVL-NDT---VD-API-----------------------
A0A1M5B2J8      T---RNGTP--VEG-E---VNGQL-GDT---IQ-SPF-----------------------
A0A255RCT5      T---RNGEH--VGG-E---VKGKL-GDT---VQ-SPF-----------------------
A0A1Y4GLF5      T---RNGDD--MKSDK---ITGTL-ADT---IA-TPL-----------------------
A0A1H3XSC0      T---RNGNE--FDD-E---ISGRL-SDT---IT-TPL-----------------------
A6LE40          T---RNGTE--LDGKD---IKGSL-LDS---IP-TPL-----------------------
A0A4Y1VPX5      I---RNGTD--LEEKD---VKGSL-LDS---IT-TPL-----------------------
A0A6N2XMM4      I---RNGTD--LEEKD---VKGSL-LDS---IT-TPL-----------------------
A0A7U8L0B4      I---RNGTD--LEEKD---VKGSL-LDS---IT-TPL-----------------------
B3JI46          I---RNGTD--LEEKD---VKGSL-LDS---IT-TPL-----------------------
A0A3N2N9B8      R---YAGKE--FKGT----FTGSI-GDT---IS-TPA-----------------------
A0A3N2NMI0      K---QGELK--WEES----FTGSL-GDS---IA-TPV-----------------------
A0A359I8H7      T---PDGDE--EIE-KE--VKAKIGAGP---IE-TPV-----------------------
A0A3N2KA63      T---PDGDE--EIE-KE--VKAKIGAGP---IE-TPV-----------------------
A0A4Q0IMT7      T---PDGDE--EIE-KE--VKAKIGAGP---IE-TPV-----------------------
A0A7J0B660      T---PDGDE--EIE-KE--VKAKIGAGP---IE-TPV-----------------------
A0A3B9FAU3      M---RNGKP--VGS-PEVTVTGRT-STI---IG-TPV-----------------------
A0A3C1E5L7      M---RNGKP--VGS-PEVTVTGRT-STI---IG-TPV-----------------------
A0A4Q0UAV1      -----AGGA--GDT-KNLILSGEV-GRT---YK-TPV-----------------------
A0A354SN68      V---VNDEE--AEM-KT--ILSQE-GDT---LL-TPI-----------------------
A0A6L5XFL0      V---VNGVE--KQV-QP--VTMRF-GTI---TK-TPV-----------------------
A0A3N2N595      K---IGEKD--IIK-AD--FSGKL-NDT---IK-TDA-----------------------
A0A7J0ACS3      K---ESNHD--ALK-QT--FTGWL-NDT---VA-TPV-----------------------
A0A0A2DUD9      V---LNGEK--TEVQDP--VTLVL-GKA---TE-TPL-----------------------
A0A3P1ZBJ5      E---SANTK--KKD-KELRIKGRF-KQV---VK-TPV-----------------------
R5FHS9          I---RNKEE--LDG-ED--VTAKL-NQT---VH-TPI-----------------------
A0A413TW79      D---KAGNQ--VESDEE--VQGKL-GQT---VR-TVM-----------------------
A0A7K0AAG2      D---KAGNE--VESDEE--VKGKL-GQT---VR-TAM-----------------------
A0A7K0ASF1      D---KAGNQ--VESDEE--VQGKL-GQT---VR-TAM-----------------------
A0A3E5E9M7      D---KAGNQ--VESDEE--VQGKL-GQT---VR-TAM-----------------------
A0A3E4SK73      D---KAGNV--VESDEE--VQGKL-GQT---VR-TAM-----------------------
A0A415GGC6      D---KAGNV--VESAVE--VQGKL-GQT---VR-TAM-----------------------
A0A413DBH9      D---KDGNQ--VESDEE--VQGKL-GQT---VR-TAM-----------------------
A0A495WI87      I---RNGEE--LPG-KL--VKGQL-TDT---IM-TPV-----------------------
A0A354M4S6      I---RNGEE--LPG-KL--LKGQL-RDT---IM-TPV-----------------------
R7DH52          I---RNGEE--LPG-KL--LKGQL-RDT---IM-TPV-----------------------
A0A7J5IAE7      T---RNGTD--LDG-KD--IKGRL-LDS---IP-TPL-----------------------
A0A016CWA4      T---RNGTD--LEG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A4P8LP09      T---RNGTD--LEG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A0M1W0V2      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A139KA16      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A174VQ92      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A1Q6HCG0      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A1Y4JYM9      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A3A5QW67      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A3A5RQE6      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A3A6BP07      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A3E5E153      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A3Q9IP20      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A412WV15      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A413ICP6      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A414KYB9      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A5B3FWR2      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A7J5QHB9      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
E5WX00          T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
K0X3P3          T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A1C6H117      T---RNGTE--LDG-KD--IKGRL-LDS---IT-TPL-----------------------
A0A6I1AQV4      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A5C6L2P1      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A3E4WKT5      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A3A5YY33      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A1E9CFZ7      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A373FYU5      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A3A5XBP2      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A3A6MEG9      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A3E4JP35      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A3E4KP40      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A3E4NX82      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A3E4XFU8      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A412RG70      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A412TD37      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A413GAA4      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A414M7I4      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A496BTA0      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A496D2V6      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A5C6KCA6      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A5M5AHM5      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A6I0Y5K7      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A6I1BFB8      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A6I2P5W5      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A6N8DC51      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A7J5HGP0      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A7J5HVL8      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A7J5JHD3      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A8B3EKM1      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
E5UZA2          I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A069SMG6      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
C3RFN5          I---RNGTD--LDE-KD--IKGSL-FDS---IP-TPL-----------------------
A0A3A5Z014      I---RNGTD--LDE-KD--IKGSL-LDS---IP-TPL-----------------------
A0A7J5GD93      I---RNGTD--LDE-KD--IKGNL-LDS---IP-TPL-----------------------
A0A7K0HGR5      I---RNGTD--LDE-KD--IKGNL-LDS---IP-TPL-----------------------
A0A078S3Q8      I---RNGTD--LDE-KD--IKGNL-LDS---IP-TPL-----------------------
A0A069SJV7      I---RNGTD--LDE-KD--IKGNL-LDS---IP-TPL-----------------------
A0A3E5DXI5      I---RNGTD--LDE-KD--IKGNL-LDS---IP-TPL-----------------------
A0A3E5EM98      I---RNGTD--LDE-KD--IKGNL-LDS---IP-TPL-----------------------
A0A6N2YYD4      I---RNGTD--LDE-KD--IKGNL-LDS---IP-TPL-----------------------
I9T3G6          I---RNGTD--LDE-KD--IKGNL-LDS---IP-TPL-----------------------
A0A3E4SYU0      I---RNGTD--LDE-KD--IKGSL-LDS---IP-TPL-----------------------
A6LGY1          I---RNGTD--LDE-KD--IKGSL-FDS---IP-TPL-----------------------
K5ZSH4          I---RNGTD--LDE-KD--IKGSL-FDS---IP-TPL-----------------------
A0A6A2RTB3      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A7J5PEN4      I---RNGTD--LEE-KD--VKGSL-LDS---IT-TPL-----------------------
A0A1M4YZ07      I---RNGTD--LDG-KD--IKGNL-LDS---IP-TPL-----------------------
A0A7J5I238      T---RNGTE--LDG-KD--IKGNL-LDS---IT-TPL-----------------------
A0A0P0FQW1      T---RNGTE--LDG-KD--IKGNL-LDS---IT-TPL-----------------------
A0A7K0I229      T---RNGTE--LDG-KD--IKGNL-LDS---IT-TPL-----------------------
A0A5M5C0W6      T---RNGTE--LDG-KD--IKGNL-LDS---IT-TPL-----------------------
A0A642NJ89      T---RNGTE--LDG-KD--IKGNL-LDS---IT-TPL-----------------------
A0A6L3JTQ2      T---RNGTE--LDG-KD--IKGNL-LDS---IT-TPL-----------------------
A0A7J5FQU6      T---RNGTE--LDG-KD--IKGNL-LDS---IT-TPL-----------------------
A0A7J4YLH7      T---RNGTE--LDG-KD--IKGNL-LDS---IT-TPL-----------------------
A0A6N3AEV2      T---RNGTE--LDG-KD--IKGNL-LDS---IT-TPL-----------------------
A0A6G0G4T5      T---RNGTE--LDG-KD--IKGNL-LDS---IT-TPL-----------------------
A0A6L3KG29      T---RNGTE--LDG-KD--IKGNL-LDS---IT-TPL-----------------------
A0A1Y4PQK7      V---LKGES--LKEVKP--VTGKF-PCT---LN-TPL-----------------------
A0A1Y4IH41      V---LKGEL--LKEVKP--VTGKF-PGT---LN-TPL-----------------------
A0A3A6AAP4      V---LKGEL--LKEVKP--VTGKF-PGT---LN-TPL-----------------------
A0A6I0ZRD2      V---LKGEL--LKEVKP--VTGKF-PGT---LN-TPL-----------------------
A0A1Y4DYA7      I---HGGEE---SD-KR--IVVEF-NDT---IS-TPV-----------------------
A0A1Y3X4I9      V---RGEEE---SG-QA--VKALF-NDT---VS-TPV-----------------------
A0A1Y4FNK8      V---HNGED---VD-GE--VTATL-NDT---AD-TPI-----------------------
A0A355FD59      V---WGDGS--KSS-KA--IDTRL-GTI---VD-TPL-----------------------
A0A359CEZ9      V---WGDGS--KSS-KA--IDTRL-GTI---VD-TPL-----------------------
A0A353Q7B4      V---WGDGS--KSS-KT--IDTRL-GTI---VD-TPL-----------------------
F8X3A5          A---CDNKD--IAN-NV--IKGKL-NDT---ID-TPL-----------------------
A0A1M3KVR9      T---SDNKD--IAN-NV--IKGKF-NDT---ID-TPL-----------------------
A0A4Y9IJS3      T---SDNKD--IAN-NV--IKGKF-NDT---ID-TPL-----------------------
A0A416GA42      TE-----------------TKTFVLNDT---VQ-TAV-----------------------
A0A1T3IYP5      -------------------DVKVALNQL---VE-TPV-----------------------
A0A7Z6RZU4      -------------------SVKGSFGTP---LN-TPV-----------------------
A0A4D7K1D4      -------------------RFEANFGKP---LV-VNG-----------------------
A0A846MP44      -------------------QYSGVLGKP---LT-VDG-----------------------
A0A1G9E2A9      -------------------QGNFLFDKS---YE-NQH-----------------------
A0A098LL25      -------------------KSEHYFGEK---IS-TDN-----------------------
A0A6J4H627      -------------------SHTGTFGHP---IK-ARD-----------------------
A0A6C0GJI1      -------------------SNTYTFGQA---VN-LDN-----------------------
A0A839GQ17      -------------------ASTYQVGSP---VS-IDG-----------------------
A0A127B287      -------------------SDVHTVGSP---IS-LSG-----------------------
A0A6P1P2P6      -------------------SKAHTVGTP---IT-LSG-----------------------
A0A2T2YJE8      -------------------TEEHTIGKP---VE-KPG-----------------------
A0A7L7LEW0      -------------------TEEHTIGQP---VI-KPG-----------------------
A0A3M9N829      -------------------V--ATVGQP---VN-ISG-----------------------
A0A0P0CSF9      -------------------S--YTVGNP---IT-VSG-----------------------
A0A5M8QQB8      -------------------S--HAVGEP---VS-VVG-----------------------
A0A3M9MNC3      -------------------S--HAVGVP---FA-LSG-----------------------
A0A5B6TAX2      -------------------S--HIVGVP---FK-FSG-----------------------
A0A7L5A132      -------------------GGEYRFGQP---IS-TPQ-----------------------
A0A512AYT3      -------------------SGEYRFGEK---ID-KKE-----------------------
A0A5M6CYN7      -------------------SGDYRFGEK---ID-KKE-----------------------
A0A369QP10      -------------------TEEHTIGEP---VQ-KPG-----------------------
A0A7G7G7M4      -------------------TEEHSIGKP---VQ-KPG-----------------------
A0A126PDF2      -------------------DGEYDLEKQ---VS-LPG-----------------------
A0A2Z3GKA1      -------------------DGEYNLGQQ---VS-LPG-----------------------
A0A502GZP7      -------------------SGEYAVGQQ---VT-LPG-----------------------
A0A0M3RW20      -------------------KEEKVVGSA---II-QPG-----------------------
A0A495VFX4      -------------------TREYKVGDA---II-LPG-----------------------
A0A246FQC0      -------------------EQEYRFDEP---FT-AAG-----------------------
A0A372E5P8      -------------------EQQHTFGQP---FT-AAG-----------------------
A0A7Y7PLY0      -------------------EQQQTLGQP---FT-AAG-----------------------
A0A1H3EMW1      -------------------EQQHSFGQP---FT-VAG-----------------------
A0A1H9ZSN3      -------------------EQQHTFGQP---FT-VAG-----------------------
A0A7W9SXN1      -------------------SREYAFGEA---IN-ALG-----------------------
A0A418R9X5      -------------------TQALKFGQP---ID-IAG-----------------------
A0A428JSJ3      -------------------TSALTFGQP---FQ-AAG-----------------------
A0A428KI59      -------------------TGELSYGQP---IE-AAG-----------------------
W8F1I6          -------------------TGELSYGQP---IE-AAG-----------------------
A0A1S9B3W0      -------------------EGEYRFGQP---IT-TPG-----------------------
A0A1W1VRL3      -------------------SGVYSVGQP---LN-LAG-----------------------
A0A7G6YQJ9      -------------------GQEYQVGQP---IE-TPG-----------------------
A0A1M6R305      -------------------TSEHTVNQP---FR-IGG-----------------------
A0A7G7W8X3      -------------------TGEYSIGEP---FR-IGG-----------------------
A0A4Z0PHK3      -------------------TADHALGQP---VL-VPG-----------------------
A0A2M9B9H9      -------------------SATYTLGQP---VV-VPG-----------------------
A0A4Z0QCY9      -------------------TGDYTLGQP---II-VPG-----------------------
A0A7Y0AH93      -------------------RGTYGIGQL---VR-LPG-----------------------
A0A519SBU8      -------------------TSTRALGQW---AK-LPG-----------------------
A0A4Q3JNZ3      -------------------AGTYTVGQW---AT-FPG-----------------------
A0A519Q9V3      -------------------TGTYTVGQW---AA-FPG-----------------------
A0A5N1J2M4      -------------------TGEYGFGEI---IS-NND-----------------------
A0A519S476      -------------------TGTYPVGTW---AK-LPG-----------------------
A0A4Q3JRW8      -------------------TGTYAVGQW---AS-FPG-----------------------
A0A519M923      -------------------TGTYPVGQW---VT-FPG-----------------------
A0A4Z0ENW1      -------------------GGNYEFGQL---VK-LPG-----------------------
A0A519UDB4      -------------------TGNYAFGQF---VK-LPG-----------------------
A0A3S0QKV1      -------------------DGEYQLEQP---VT-TPG-----------------------
A0A328BL48      -------------------GGEYSFGET---LT-TPG-----------------------
A0A5R8WLY4      -------------------GGEYRFGEP---LT-TPG-----------------------
A0A1I5WSL8      -------------------SGEYALGQT---ID-LSG-----------------------
A0A0U3JVM7      -------------------GGEYSLGQE---IK-LPG-----------------------
A0A1G1SSV2      -------------------GGEYALGQQ---IT-FPG-----------------------
A0A1G1SXV7      -------------------GGEYALGQQ---IK-FPG-----------------------
A0A6G8CBJ6      -------------------SGDYAVGQP---IN-LPG-----------------------
A0A0W8EDI5      -------------------RVDGVFNQP---LK-IGN-----------------------
A0A3B7RBP8      -------------------KVNGKINQT---LN-IEG-----------------------
A0A3R9P8H7      -------------------VQEHTIGTP---FT-AGG-----------------------
A0A238WIA7      -------------------VKETGFDAP---VE-TTG-----------------------
A0A212UCJ7      -------------------IQKAILGNQ---IE-TLG-----------------------
A0A4Z0MQE1      -------------------SQKAAVGDP---IE-TAG-----------------------
A0A4Z0PCF4      -------------------TDKANINEV---IE-TAG-----------------------
A0A6M6BED0      -------------------TEKAAIGEI---VE-TAG-----------------------
A0A5D6VDG1      -------------------TSEYAIDVP---IE-LPG-----------------------
A0A243WHR7      -------------------SAEYRFGQP---IV-TPA-----------------------
A0A5B8A0P6      -------------------NREHSVGQT---IS-TPD-----------------------
A0A076HRT9      -------------------GGDYALNQP---IR-LGG-----------------------
A0A4Z0PVM7      -------------------TGDYTIGQP---VV-VPG-----------------------
A0A1M6DHW8      -------------------SGEYSLGQP---IV-LPG-----------------------
A0A4Q5LC61      -------------------SGEYSLGQP---IV-IPG-----------------------
A0A060RD97      -------------------SIEKKFGDT---VL-IRN-----------------------
A0A350IHV0      GEKM-------KYKG----KIKGSFREE---LQ-TPV-----------------------
A0A2A8CVM9      ------------------------------------------------------------
R5RVP0          GETI-------KHTE----KITGRLRDT---IS-TPV-----------------------
A0A2L2WX98      KG-----------------KVSIAVGET---KK-TPL-----------------------
A0A2E3R1D0      ------------------------------------------------------------
A0A800J826      ------------------------------------------------------------
A0A2T2USC0      ------------------------------------------------------------
A0A2T2V0F3      ------------------------------------------------------------
A0A2T2S682      ------------------------------------------------------------
A0A840DJZ8      EPED-------RAPS---------------------------------------------
D5H561          GASG-------DDPS---------------------------------------------
A0A2H3NWA9      ------------------------------------------------------------
A0A2A8CVB6      ------------------------------------------------------------
A0A2P6C1S6      ------------------------------------------------------------
A0A2T2UTM4      ------------------------------------------------------------
R6A0L2          VPD-----------------VDVQLGQM---TQ-TPY-----------------------
R7LG80          TDE----------------KIKANFGQT---VK-TPA-----------------------
A0A7W5UEN4      GKKK-------IFKE----HLSVRPGVM---VK-TPI-----------------------
G5GD56          GKKK-------IFKE----HLSVRPGVM---VK-TPI-----------------------
R5KD55          NSY----------------DLTCHVGQT---VN-TPL-----------------------
A0A174QNT3      DYD-----------------KIVAFNDT---LF-TPV-----------------------
A0A4S2FGS1      SYE-----------------QAVAFNDT---LS-TPA-----------------------
A0A7K3KG59      SYE-----------------QVVAFNDT---LS-TPA-----------------------
R9I0H0          SYE-----------------QVVAFNDT---LS-TPA-----------------------
K5BUT9          EIQ----------------EQELAYNDT---IR-TEA-----------------------
A0A174FPA3      RMQ----------------EQDLTYNDT---IR-TEA-----------------------
R6S9Y6          RMQ----------------EQDLTYNDT---IR-TEA-----------------------
A0A7J4YSB2      RMQ----------------EQDLTYNDT---IR-TEA-----------------------
C9KX15          RMQ----------------EQDLTYNDT---IR-TEA-----------------------
A0A6H0KRK1      --------------------EKYAYGDT---IQ-TEA-----------------------
R6DAG6          --------------------EKYAYGDT---IQ-TEA-----------------------
A0A3L8AAP1      --------------------KKYAYGDT---VQ-TEA-----------------------
A0A4S2AYX2      --------------------KKYAYGDT---VQ-TEA-----------------------
A0A7J0A2L4      --------------------KKYAYGDT---VQ-TEA-----------------------
A0A7K3MN31      --------------------KKYAYGDT---VQ-TEA-----------------------
R6CQ93          E------------------TYKVQLNDT---LS-IGG-----------------------
A0A3D1NQW3      PDKQ-------KFKQ----EISAVFGDT---IS-TPV-----------------------
B0MT10          PDKQ-------KFKQ----EISAVFGDT---IS-TPV-----------------------
R7JGW9          PDKQ-------KFKQ----EISAVFGDT---IS-TPV-----------------------
A0A3D2BF46      SDKD-------KDSEIYEVEMTGRFNDT---IT-TPC-----------------------
A0A358R538      SERR-------T-------QIVVESGDT---AA-TPV-----------------------
A0A1Y4AAB8      EERG-------R-------VVTAAYGDT---VS-TPL-----------------------
A0A1Y3WWY9      QESR-------S-------VVTAQYGDT---IP-TPI-----------------------
A0A1Y4U5L4      QESR-------S-------VVTAQYGDT---IP-TPI-----------------------
A0A1Y3VCJ1      QESE-------D-------RVSARFGDT---VA-SPI-----------------------
A0A1Y3QTW7      QEKR-------R-------VIRGQYGDT---IP-TPL-----------------------
R6XWY7          QEKR-------R-------VIRGQYGDT---IP-TPL-----------------------
A0A4Y1X9Y9      QEKR-------R-------VIRAQYGDT---IP-TPL-----------------------
A0A4Y1WM66      QEKR-------R-------VIRAQYGDT---IP-TPL-----------------------
A0A6N4GYT3      QEKR-------R-------VIRAQYGDT---IP-TPL-----------------------
A0A174AVF1      QEKR-------R-------VIRAQYGDT---IP-TPL-----------------------
A0A1Q6EIY0      QETK-------R-------VILAEYGDT---VA-TPV-----------------------
A0A5B5VN71      QETK-------R-------VILAEYGDT---VA-TPV-----------------------
E4M8L3          QETK-------R-------VILAEYGDT---VA-TPV-----------------------
I3YQ50          QETK-------R-------VILAEYGDT---VA-TPV-----------------------
R5UEY8          QETK-------R-------VILAEYGDT---VA-TPV-----------------------
A0A1H4D866      QETR-------S-------SITAAYGDT---IP-TPV-----------------------
A0A5B3G4Y7      HESR-------S-------VITAAYGDT---IP-TPV-----------------------
A0A374A9J5      HESR-------S-------VITAAYGDT---IP-TPV-----------------------
A0A5B3GQN5      HESR-------S-------VITAAYGDT---IP-TPV-----------------------
A0A1Q6E9S3      HESR-------S-------VITAAYGDT---IP-TPV-----------------------
D4IJ36          HESR-------S-------VITAAYGDT---IP-TPV-----------------------
A0A414Q925      EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
A0A415PUS9      EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
A0A108TCU0      EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
A0A413BA42      EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
S3Y344          EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
A0A7J5LEW3      EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
A0A412TGL3      EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
A0A413VJ33      EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
A0A414L0W6      EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
A0A412DP39      EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
A0A413ZSE8      EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
B0NP84          EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
R6AK43          EEEE-------EFDE----ILTVQPGDT---VN-TPV-----------------------
A0A412N2D9      LEEE-------EFDE----SLTVQPGDT---VS-TPV-----------------------
A0A1Y4JYS9      LEEE-------EFDE----SLTVQPGDT---VN-TPV-----------------------
R6LHA4          LEEE-------EFDE----SLTVQPGDT---VS-TPV-----------------------
A0A3E5HPT8      -----------ELEQ----RKTVNLNDT---VD-TPL-----------------------
C6IJ48          -----------ELEQ----RKTVNLNDT---VD-TPL-----------------------
Q8A3U2          -----------ELEQ----RKTVNLNDT---VD-TPL-----------------------
A0A3R6S1H6      -----------DEEW----KQKVALKDT---VE-TPV-----------------------
A0A3R6SD81      -----------DEEW----KQKVALKDT---VE-TPV-----------------------
A0A354WXN6      GKLV-------EAGK----PMEVLLGDS---VD-TPV-----------------------
A0A7G1HW11      ------------EDW----SKKVQLGDT---VS-TPV-----------------------
R5IP14          ------------EDW----SKKVQLGDT---VS-TPV-----------------------
A0A316SZX7      VSDI-------DRDL----TIKASLYDT---IS-TPI-----------------------
A0A1Y4AIY1      GEPV-------EIKN----PQEVVLNDT---VT-TPV-----------------------
A0A0J6CIR2      --E----------AK----SLKVALNDT---VS-TPV-----------------------
A0A3D8HG59      --SV-------DVSD----AVTVALNDT---VQ-TPV-----------------------
A0A3R6S408      --SV-------DVSD----AMTVALNDT---VQ-TPV-----------------------
F3ZRU7          GGEE-------VELP----HFSVQLNDT---VD-SPL-----------------------
A0A1C5Q1F3      -EGV-------KPVE----QMKVHLNDT---VA-TPV-----------------------
R7A239          -EGV-------KPVE----QMKVHLNDT---VA-TPV-----------------------
A0A3R6HIK7      GQRV-------EIKK----AQDVALNDT---VQ-TPV-----------------------
K5ZVW7          GQRV-------EIKK----AQDVALNDT---VQ-TPV-----------------------
A0A1Y4D5Z0      GKLV-------EIEK----AQRVALNDT---VT-TPV-----------------------
A0A413VXJ7      DGEV-------TSNE----VLEVNLHDT---IQ-TPV-----------------------
I9RSN9          DGEV-------TSNE----VLEVNLHDT---IQ-TPV-----------------------
U6RJK5          DGEV-------TSNE----VLEVNLHDT---IQ-TPV-----------------------
A0A1Q6GA32      DGEV-------TSNE----VLEVNLHDT---IQ-TPV-----------------------
I9RPU6          GGGV-------HSEE----ALDVHLNDT---VS-TPI-----------------------
I8YFS5          GEEI-------RSAE----VVDARLNDT---IS-TPV-----------------------
A0A7J4XCM0      GEEI-------RSAE----VVDARLNDT---IL-TPV-----------------------
I8Y597          GEEI-------RSAE----VVDARLNDT---IS-TPV-----------------------
A0A1Q6GBF5      GGII-------HSEE----ILDVHLNDT---VS-TPI-----------------------
I8YFZ3          GGEV-------HSEE----VLDVRLNDT---VS-TPI-----------------------
A0A7J4XFW0      EGEI-------HSEE----VLDVNLNDT---VS-TPI-----------------------
A0A1Q6GDH2      GGGV-------HSEE----VLDVHLNDT---VS-TPI-----------------------
U6RSB0          GGGI-------HSEE----VLDVHLNDT---VS-TPI-----------------------
I9GXM2          GGEI-------SSEE----VLDVHLNDT---VS-TPI-----------------------
I9SIK1          GGGV-------RSEE----VLDVHLNDT---VS-TPI-----------------------
A0A7J4XIJ5      GGVV-------RSEE----VLDVHLNDT---VS-TPI-----------------------
I9TP59          EGEI-------HSEE----VLDVHLNDT---VS-TPI-----------------------
R5S343          -------------NR----EIEAVLNDT---VD-TPS-----------------------
A0A1M6K7I9      NEEI-------QSVD----EPEVALGDT---IK-TAI-----------------------
A0A5M6A8C8      NEEI-------QSVD----EPEVALGDT---IK-TAL-----------------------
A0A7J4XCJ1      DEEL-------RSTE----TIDVHLNDT---VS-TPV-----------------------
A0A7J4XNQ7      GEES-------HFAE----TVDVHLNDT---VS-TPI-----------------------
A0A3R5ZMK1      GQEV-------ADGK----PVKVALNDT---VT-TPV-----------------------
A0A7K1HMX0      DE---------SAGE----PMTVALNDT---VT-TPV-----------------------
A0A1Y3ZIA4      DQEV-------SDGK----PMKVALNDT---VT-TPI-----------------------
K5Y1A4          DQEV-------SDGK----PMKVALNDT---VT-TPI-----------------------
A0A7K1HDC0      GQEV-------ADGK----PVKVALNDT---VT-TPV-----------------------
A0A3R6K8X4      GQEV-------ADGK----PVKVALNDT---VT-TPV-----------------------
A0A6N8D6C8      GQEV-------ADGK----PVKVALNDT---VT-TPV-----------------------
A0A3R6BKI7      GQEV-------ADGK----PVKVALNDT---VT-TPV-----------------------
A0A412M2W1      GQEV-------ADGK----PVKVALNDT---VT-TPV-----------------------
K5ZX55          GQEV-------ADGK----PVKVALNDT---VT-TPV-----------------------
A0A415BDM7      GREV-------ADGK----PVKVALNDT---VT-TPV-----------------------
A0A1Q6I3T6      GQEV-------ADGK----PVKVALNDT---VT-TPV-----------------------
A0A414XX40      GQEV-------ADGK----PVKVALNDT---VT-TPV-----------------------
A7AEU7          GQEV-------ADGK----PVKVALNDT---VT-TPV-----------------------
A0A5F0U645      EGQV-------QEDQ----TLTVALNDT---VS-TPI-----------------------
K5ZBN2          EGQV-------QEDQ----TLTVALNDT---VS-TPI-----------------------
A0A0J6CKW3      EGQV-------QEDQ----TLTVALNDT---VS-TPI-----------------------
A0A0F5IQM7      EGQV-------LEDQ----TLTVALNDT---VS-TPI-----------------------
A0A496CDT3      EGQV-------LEDQ----TLTVALNDT---VS-TPI-----------------------
A0A6G1ZKM3      EGQV-------QEDQ----TLTVALNDT---VS-TPI-----------------------
S0GLB0          EGQV-------QEDQ----TLTVALNDT---VS-TPI-----------------------
A0A3R6NLC1      EGQS-------LEDQ----TLTVALNDT---VS-TPI-----------------------
A0A416WYC9      EGQT-------LEDQ----TQTVALNDT---VS-TPI-----------------------
A0A7W7AX81      EGQT-------LEDQ----TLTVALNDT---VS-TPI-----------------------
A0A0F5IT40      ------------EAK----SLKVALNDT---VS-TPV-----------------------
A0A496CX20      ------------EAK----SLKVALNDT---VS-TPV-----------------------
A0A5F0UBI0      ------------EAK----SLKVALNDT---VS-TPV-----------------------
A0A6G1ZHG0      ------------EAK----SLKVALNDT---VS-TPV-----------------------
S0GSI7          ------------EAK----SLKVALNDT---VS-TPV-----------------------
K5YB65          ------------EAK----SLKVALNDT---VS-TPV-----------------------
A0A0F5IWP9      ------------ETK----MLKVVLNDT---VI-TSI-----------------------
A0A0F5IZT8      ------------ETK----MLKVVLNDT---VI-TSI-----------------------
A0A417LKQ2      ------------EGK----MQKIALNDT---VT-TPV-----------------------
A0A416TME1      ------------EGK----MQKVVLNDT---VA-TPA-----------------------
A0A7W7F3X3      ------------EGK----MQKVVLNDT---VA-TPA-----------------------
A0A416XPE8      ------------EGK----MQKVVLNDT---VA-TPA-----------------------
A0A3B0C2S4      -------------------------------IQ---------------------------
A0A5M8NYX7      -----------------DFQKTFKIDEE---IN-SPW-----------------------
A0A1M6GR99      YNYNTGHKI--GERKDLEFSINGNVGQV---VE-TDD-----------------------
A0A7C5M4P4      -----------------TVEEEHRFDIP---VE-NED-----------------------
A0A1W2GF52      -----------------RIGEKQQFGNP---IV-TKD-----------------------
A0A2G5L7B8      -----------------SHRTRYPFGKK---IN-TAF-----------------------
A0A2D8JJW3      -----------------KNEKNALNNLS---LH-SDNTVFDLSGVVIPDGDFKDGCDLPK
A0A6B5PK86      -----------------AYTVKGKLGEH---LI-SQH-----------------------
A0A2G2F510      -----------------TKVVKGYVNEH---LK-NED-----------------------
A0A316JZ08      -----------------NVKLKGPLNKH---VT-NDD-----------------------
A0A2W1NDY9      -----------------KNEIPVAHDQL---VD-NEY-----------------------
A0A5C8AQR5      -----------------KISINGSLNDV---IQ-NNH-----------------------
A0A1G0CI31      -----------------SYSMLKPINSR---FS-NQH-----------------------
A0A556N0M0      -----------------TYSKTSEINKT---IH-TRH-----------------------
F2IKD6          -----------------NYSKVSAINQT---IK-TSH-----------------------
A0A1I7BM74      -----------------EYIEEVFLNQA---HK-NEF-----------------------
A0A2G2FJ17      -----------------RLKWDIESNKL---LA-TPY-----------------------
A0A1H4ADG3      VWKG-------------------KWSVP---VV-LPI-----------------------
A0A5B8VUR8      IWKG-------------------SWDEP---IQ-LPI-----------------------
A0A1V5IPN7      -------------------------------IS---------------------------
A0A7G7G5F9      -----------------------KIGQE---II-KPY-----------------------
A0A2N3U785      -----------------------EFGQK---IV-LPY-----------------------
A0A0D3L8Q3      -----------------------KFGQR---VN-VGF-----------------------
A0A519U664      -----------------------KLGQQ---IK-KPY-----------------------
A0A519MA34      -----------------------KFGQQ---IE-KPY-----------------------
A0A519UCX0      -----------------------RFGQE---IK-MPY-----------------------
A0A5B6TJH8      -----------------------SFGKR---IQ-KPY-----------------------
A0A7Y0AA98      -----------------------KFGEE---IS-KSY-----------------------
A0A0E3ZG78      -----------------------KFGQQ---IQ-KPY-----------------------
A0A1I6BRK6      -----------------------RFGQK---IH-KAF-----------------------
A0A243WAB1      -----------------------SFGQQ---IA-KPY-----------------------
A0A6G8C8X6      -----------------------SFGQQ---IT-KPY-----------------------
A0A4R5DL69      ANDQFT---------LTDKVHTWNQSFGDTFLLPTGE-----------------------
A0A1M4YED3      -----------------------------NKFVTTPF-----------------------
A0A7T9DAA2      KTGTGVDDF--RALMDWEKQFSFGDTVKEDNLAF--------------------------
A0A7Y5V8S3      NAQEVVSEF--LDRVDIDQTAKVGEPFVGDKLSF--------------------------
A0A126PFG0      PFGRPV------------------SDSIGTWQLTPVP-----------------------
A0A7V5VRT5      VRLEVEGAS--QSFCLRKEDSVICSGKVGQWVAC-GN-----------------------
A0A3M1N7Z3      AERKVE---------IWRAETLIVSGKIGQWMALPGA-----------------------
A0A7V1R2A1      PEKKVE---------IWRAETLIASGKRDQWMALPGA-----------------------
A6EBM4          RKNF-------------------RFNSR---IK-VGN-----------------------
A0A7X8C760      PGSP-------------------INGRLGVPLQHNLF-----------------------
A0A501VZX6      IINN----------------DEYSTGKW---VQ-TPY-----------------------
A0A399SH26      TVDG----------------KSYPLNKS---IR-MPY-----------------------
A0A501W1A9      IIDN----------------KPYNLNTW---AK-TPY-----------------------
A0A0E3ZGV6      IIDS----------------KKYSIGTW---EK-TPY-----------------------
A0A1I2N4S1      QIDG----------------KEYPLSTW---VV-TPY-----------------------
A0A2T5YE44      KIDG----------------KEYPLSTW---VV-TPY-----------------------
A0A4Q8RX32      YDFQKERND--REVANFEMSQKFNFGKT---IE-SEY-----------------------
A0A1M6TTV4      RPKY-------------------KFGEM---IS-HRL-----------------------
K0X1U5          -----------------------KKGFFTTLAE-MEA-----------------------
R5EXK3          -----------------------KKGFFTTLVE-MEA-----------------------
A0A401UAP7      TGNF---------------------GKV---VQ-MEG-----------------------
A0A523GAC0      DQSC-------------------RFSQ-----T-IQN-----------------------
L8JW09          AMKY-------------------NFGEH---AN-LPD-----------------------
A0A364XUP5      KITG-------------------KFNEP---IN-LDA-----------------------
A0A1M5RLA9      KTTG-------------------RYNSK---VS-LNG-----------------------
A0A385SFR9      KAAG-------------------RYNSK---VS-LNG-----------------------
A0A5M4A9J4      WDFRHRQAI--HQYSDYSVTLPVRLNEV------IER-----------------------
A0A5M4B1C7      YNYENKTVL--QKPEEIDKTIPFSINKT------TTD-----------------------
A0A0D3LFR6      SNRY-------------------RFGQA---VE-TGS-----------------------
M7N6D4          SGRH-------------------RFGQT---VE-TDP-----------------------
A0A5C7MX19      ERIY-------------------RFGQD---IYSPSF-----------------------
A0A1M5BA90      AIEG----------------KMYSLNKW---IS-TPF-----------------------
A0A512B879      DIAG----------------KSYPLDQW---VT-TSF-----------------------
A0A559PPI3      KVDG----------------RIYPLNEW---VD-SPF-----------------------
A0A1T5CS78      VFSG----------------KEYSLNKW---FE-ISN-----------------------
A0A0Q9Z8F1      IFSG----------------KEYSLNEW---FE-FSA-----------------------
A0A2N0U0M7      VFSG----------------KEYSLNEW---FE-FSA-----------------------
A0A1Q3ZMZ7      TFPF-------------------VFGKL---IS-TPH-----------------------
A0A7Y3KMD1      LFPF-------------------NNGQW---TD-VHY-----------------------
A0A3C1ITV0      DAPA----------------QTVKLGQP---FK-TPV-----------------------
R7HN19          DAPA----------------QTVKLGQP---FK-TPV-----------------------
A0A2W2AFF7      DWKG-------------------KFGQT---VS-LPI-----------------------
A0A845PZ37      VIKV-------------------PLNHV---VK-TPF-----------------------
A0A077ENE7      EIKI-------------------ALNKL---TS-TPV-----------------------
A0A854FRG7      EIKV-------------------SINQS---VK-TPF-----------------------
T0NN57          EIKV-------------------SINQS---VK-TPF-----------------------
R7PCR1          EFNY-----------------KGTFGRP---FS-TPV-----------------------
A0A2N5YXE2      EYLI-------------------SPEEW---QS-VFG-----------------------
A0A2U1FKU2      LSGM---------------EVDGTFGQP---VA-TPV-----------------------
A0A0A2F954      IGDI---------------KIDGSFGRP---IA-TPV-----------------------
A0A0A2FW91      IGDI---------------KIDGSFGRP---IA-TPV-----------------------
A0A2D2N2N1      IGDI---------------KIDGSFGRP---IA-TPV-----------------------
Q7MWZ2          IGDI---------------KIDGSFGRP---IA-TPV-----------------------
A0A212FSE5      IGDI---------------KIDGSFGRP---IA-TPV-----------------------
T2NDT6          IGDI---------------KIDGSFGRP---IA-TPV-----------------------
A0A1R4AFZ0      IGDI---------------KIDGSFGRP---IA-TPV-----------------------
A0A1R4DVZ7      IGDI---------------KIDGSFGRP---IA-TPV-----------------------
A0A1V9FHD0      VVID---------------KKAYPMNTW---CN-TPY-----------------------
A0A4V4H170      IVIG---------------EKIYPIKKW---VS-TPW-----------------------
A0A1V9F098      VVIG---------------KKVFPINQW---VS-TKY-----------------------
A0A4R2VU64      VVIK---------------KKTYPVNQW---VT-TPY-----------------------
A0A0K8QSK7      HDFVTGENI--RTIPNVNIDETRLLGER---FS-GND-----------------------
A0A7C0WKI7      NYRV---------------------------LG---------------------------
A0A1T5K9D4      VVSY---------------------GDK---VK-IGD-----------------------
A0A5M4B212      YDFQNEKEL--KPAREIEQTRTFPVNSY---VA-SDD-----------------------
A0A3D1KEX9      DFKQ-----------------VVSYGQS---FN-SPA-----------------------
A0A358Y7S2      KLKL-------------------KPNSR---FK-NPQ-----------------------
A0A2J6HHN3      DKSF-------------------QPYES---VV-LPK-----------------------
A0A1Y3WMT8      -----------------------KQGFFTTLAE-TEA-----------------------
A0A1Y4GQU1      -----------------------KRGFFETLAE-TEA-----------------------
A0A6A0R272      TSIN------------------LTYNQP------FKI-----------------------
A0A1V5W8T5      IKHE------------------IKRNEW---TQ-IQG-----------------------
A0A2T8HKA9      SQRI-------------------KLREE---TT-TPI-----------------------
A0A1X7J248      SQKF---------------------GQE---FI-VDG-----------------------
E4TQD2          NQKF---------------------GEY---FT-FNG-----------------------
A0A2I0QZ80      HIAI-------------------QPNEI---LK-NNL-----------------------
A0A3E1F1A3      NYKF-------------------IPNSL---VQ-TPF-----------------------
A0A2U2XBJ3      NYKF-------------------APNSL---LK-TPF-----------------------
A0A4Q4KU94      NYKF-------------------SPNSL---LK-TPF-----------------------
A0A3B8INU3      PEEH-------------------RFGET---LS-VPH-----------------------
A0A7V6V2N8      ATQG-------------------TFYDT---II-LDH-----------------------
A0A414ZBF2      DEVV-----------------TVQMGDT---TD-TPV-----------------------
A0A7X9D3Q8      NLVK-----------------VLQPGDT---LR-TPV-----------------------
A0A1Q3Q573      EKEI-------------------KPEQK---LK-TPY-----------------------
A0A662BAY3      FDFLNSEIV--TYVTNLSFSKEAAYNEV---IK-TDY-----------------------
A0A4U3L369      VTGT--------------------YGDT---VH-YNK-----------------------
A0A4S8HY23      VIID---------------NNAYPINTW---CA-TPY-----------------------
A0A1V9F383      VVIE---------------NRKYPLRVW---CN-TRW-----------------------
G8TRZ6          VVIE---------------NKKYPLREW---CQ-TRW-----------------------
A0A357YNR3      HYNL-------------------SPGDS---TLKFPF-----------------------
A0A7X6YKE8      HYNL-------------------SPGDS---TLKFPF-----------------------
A0A5E8AX52      ASRH-------------------KFGET---IS-TPD-----------------------
A0A1V6CN82      YNYSENRGA--GYFPEVKIEQKVQSGEE---VVIPGQ-----------------------
A0A1M4XZ45      YNYLDEKIV--ERLPQFSFSRDISAGTK---LK-AEQ-----------------------
A0A399D319      YSYTEEEVV--KRIPGYSFSRTIDPGTK---IT-SDE-----------------------
A0A7Y1YS85      GKQY-------------------RFGEP---FV-NEY-----------------------
F4KK08          PIAA-------------------TLGDT---IA-TPI-----------------------
A0A7V5VE02      ------------------------------------------------------------
A0A496LCF9      ETIE------------------GTFNEP---IG-CKY-----------------------
A0A5P2G2A9      TFFV-------------------KWGDS---IP-LSK-----------------------
A0A3C0ZQC7      ------------------------------------------------------------
A0A3N2N6F7      LDVM-----------------TVTLGDT---VS-TSF-----------------------
A0A419VXB7      INTE------------VDFEGTGVFGEK---FE-NRY-----------------------
A0A1Q6E6I7      TEKT-------------------ITGAFGETIR-DTV-----------------------
A0A3B9CNN6      TEKT-------------------ITGAFGETIR-DTV-----------------------
R5X290          TEKT-------------------ITGAFGETIR-DTV-----------------------
C3J7R8          TSQV-------------------QIGVP---QD-TPM-----------------------
A0A1G8BVM8      DGEI----------ISNDVVDDISLDSV---VA-FSH-----------------------
A0A1I1FXP9      SRNF-------------------NFDKT---YE-NQD-----------------------
A0A4P7VVU7      DPSE----------------MTVNIGDT---VA-TSF-----------------------
A0A2V1ILM4      DPSE----------------MTVNIGDT---VA-TSF-----------------------
A0A3N2L0E8      DPSE----------------MTVNIGDT---VA-TSF-----------------------
A0A3N2LFC5      DPSE----------------MTVNIGDT---VA-TSF-----------------------
A0A7K3KWJ8      APSE----------------MTVNIGDT---VA-TSF-----------------------
A0A3N4H5N3      F----------------------EFNEK---IR-TNF-----------------------
A0A2P8EAX2      F----------------------NFGDK---IK-TEF-----------------------
A0A4V2F6N9      F----------------------NFGDK---IK-TEF-----------------------
A0A838T9G8      VKKG-------------------EFGKK---YS-LPA-----------------------
A0A3B9FXJ0      SQEL-------------------EYNKP---YS-TPA-----------------------
A0A848SUJ0      EDVR-------------------TFGET---LE-SQF-----------------------
A0A847ALW2      YSYTDDKVF--QILPELIFDKEIEPGAQ---LI-SDH-----------------------
B2RKZ8          ISEI---------------KVEGSFGRP---IA-TPV-----------------------
A0A0K2J6Z0      ISEI---------------KVEGSFGRP---IA-TPV-----------------------
A0A212GC82      ISEI---------------KVEGSFGRP---IA-TPV-----------------------
A0A0E2M2Y7      ISEI---------------KVEGSFGRP---IA-TPV-----------------------
A0A829KSZ7      ISEI---------------KVEGSFGRP---IA-TPV-----------------------
R5GSU5          RIDK---------------------------VV-AYG-----------------------
A0A7X8I6A2      EYKG-------------------LTGKW---FS-LGG-----------------------
A0A0A2G557      SSAP---------------KMIVSLGET---IE-TPI-----------------------
A0A1T4PT95      SPLS---------------DRVVLFGET---IE-TPI-----------------------
A0A6I6JYY3      YSYSEDEVL--KKISNFSFSKDMDPGVR---LT-ANE-----------------------
A0A651GU15      SDPF-------------------LPNDY---VR-TRF-----------------------
A1ZKR2          KKTY-------------------RFDQP---IV-TSY-----------------------
A0A1Q3GX01      KQIY-------------------KFDQT---IN-HSG-----------------------
A0A349DQI4      KQVY-------------------KFNQT---VK-YPG-----------------------
A0A4P5TMD1      SFNG-------------------KFNQK---TI-TPH-----------------------
A0A3Q9FR88      EIAG-------------------KSGQR---FS-LGG-----------------------
A0A553GEX3      EIEG-------------------KSGQR---FS-LGG-----------------------
A0A150ADJ9      VVEG-------------------ISGKP---LF-FEG-----------------------
A0A7X9P1P7      VVEG-------------------FTGKP---LF-FEG-----------------------
A0A7X8SM94      TVYG-------------------ASGKQ---II-LGG-----------------------
A0A1S1Z228      TISG-------------------KSGEQ---II-LGG-----------------------
A0A1B1FWQ4      EIKG-------------------SSGES---II-LGG-----------------------
A0A7X9Y5D2      EIKG-------------------RSGEI---II-LGG-----------------------
A0A7X8ISG0      KYSF-----------------NFKPNTI---YT-TPD-----------------------
A0A2N3IIZ0      AEYK------------------GKFGEW------LKN-----------------------
A0A7X8Q7Q7      NILF-------------------KFHEP---VS-LPL-----------------------
A0A2N2WFW8      ETEF-------------------RFHET---VS-LPQ-----------------------
A0A1F3IU95      DKSF-------------------RFHEP---VS-LPQ-----------------------
A0A3D0VUF6      DKSF-------------------RFHEP---VS-LPQ-----------------------
A0A7K3WUF2      GEQE-------------------RVGKS---VS-NKY-----------------------
A0A497D5Z2      YDYLNDKVI--KRLPDLAWFGEGDAGTP---VG-TDN-----------------------
A0A662B170      YDYLNDKVI--KRLPDLSWFGEVDAGTP---VV-TDN-----------------------
A0A7X7FWB7      AYSF-------------------NINHN---VS-YTT-----------------------
A0A7X8DM61      KYTF-------------------NIYPNSLDII-YNT-----------------------
A0A3M1CDV2      IQIP------------------FHINTW---TK-HEW-----------------------
A0A1F3SJM1      TIRG-------------------NLNEH---FV-NDD-----------------------
A0A2G2EB96      ILSG-------------------KLNER---IK-NED-----------------------
A0A2G6PRA9      RVEG-------------------MLNEH---IQ-NSD-----------------------
A0A7Y7A9N2      RVEG-------------------MLNEH---IQ-NSD-----------------------
A0A6C1QGZ7      KYEI-------------------HVNGP---NS-LPE-----------------------
A0A7W1EH85      IEKF-------------------SFNSW---IK-SKD-----------------------
A0A2E3XZI5      AEYI-------------------EANKF---FS-SKY-----------------------
A0A6I7QXV0      RETL-------------------SFDRF---FE-NNY-----------------------
A0A7Y3V126      EKEF--------------------SPEK---IE-LEG-----------------------
A0A7Y5C3U1      EKEF--------------------GPEK---IE-LEG-----------------------
A0A2M7NLQ9      FSKI------------------YKFNTR---IK-NQY-----------------------
I4AFR0          FSKI------------------YKFNTR---IK-NQY-----------------------
A0A2N2Y3E5      KVKI-------------------KTGEW---LN-FYG-----------------------
A0A2D9D7T6      KISG-------------------ELNKP---IK-TKS-----------------------
A0A1F3PPL5      ENL--------------------SVGKW---EN-ING-----------------------
A0A357QK06      ENL--------------------SVGKW---EN-ING-----------------------
A0A7X9JJJ8      EKTI-------------------PINKW---VD-LDG-----------------------
A0A522EYA6      THKF-------------------KQGTA---VS-APE-----------------------
A0A662AEA4      KYEL-------------------KTNTW---NL-ICG-----------------------
A0A0S2HYK8      SYPG-------------------EAGKW---TD-LGI-----------------------
A0A2N5ZWN6      TKDI-------------------EINEW---NE-LGY-----------------------
A0A2E0FJ09      EFNE-------------------SLNES---FS-TEH-----------------------
A0A1F3FZ62      IREF-------------------YFNET---VK-LPE-----------------------
A0A1F3K211      IREF-------------------YFNET---VK-LPE-----------------------
A0A7Y1UDU0      IALK------------------GETGEP---LK-TPF-----------------------
A0A1V6I2U9      EYTI-------------------QPEEL---QT-IYG-----------------------
A0A2H0B957      QKSL-------------------KSNAW---TD-IGG-----------------------
A0A1F3CFW6      EKTI-------------------KKNKW---TD-ING-----------------------
A0A2M7E2T8      EKTI-------------------IKNQW---TD-ING-----------------------
A0A2M7NC69      EKTI-------------------IKNQW---TD-ING-----------------------
A0A1F3KLL5      HYSL-------------------KPDRW---NK-INK-----------------------
A0A359D1M1      HYSL-------------------KPDRW---NK-INK-----------------------
A0A0F2NS19      IGEF-------------------SSNVP---IE-LKE-----------------------
A0A2A5H8X6      IGEF-------------------SSNVP---IE-LKE-----------------------
A0A2H0GAU8      LGEF-------------------EVDTP---IK-LKQ-----------------------
A0A2M8FTK1      LGEF-------------------EVDTP---IK-LKQ-----------------------
A0A2A5B3B0      IGDF-------------------NVNET---IN-HPK-----------------------
A0A5C6RXM7      LGVF-------------------KSGEL---IV-IDK-----------------------
A0A7W1FWM4      IKNY-------------------TADKW---IN-FPQ-----------------------
A0A7T9QP55      TVPV-------------------TVGKE---FS-TPH-----------------------
A0A7V9MK11      KLTA-------------------PDNKT---FE-LPH-----------------------
A0A1F3C1M2      EKKF-------------------TIGEW---ID-LDL-----------------------
A0A1F3DS87      ERKY-------------------TIGEW---ID-LSL-----------------------
A0A7Y5QSG1      LSYT-------------------VAGQP---LT-LTF-----------------------
A0A7Y2EX06      TKFR-------------------I---L---KN-GIT-----------------------
A0A7Y7NV14      NKYE-------------------ISYTL---AN-HTK-----------------------
A0A6A0R6K9      VHFN-------------------QKVEL---PF-AHL-----------------------
A0A2E7CT70      AKFI-------------------KPGDF---FS-SNY-----------------------
A0A2D5V560      AKYI-------------------LPNKF---FS-SEF-----------------------
A0A2D7K5A8      ANYI-------------------LPNKF---FS-SKF-----------------------
A0A2E1XQ82      ANYI-------------------LPNKF---FS-SKF-----------------------
A0A1F3K695      HEFA------------------IYSNVW---SN-IGL-----------------------
A0A353KZR1      HEFA------------------IYSNVW---SN-IGL-----------------------
A0A2N2WYB5      QK--------------------IELNQW---TA-IQG-----------------------
A0A1F3K4G0      ASYP------------------IEIGKW---SA-IRA-----------------------
A0A356H8Y3      ASYP------------------IEIGKW---SA-IRA-----------------------
A0A351HSA6      ASYP------------------IEIGKW---SA-IRA-----------------------
A0A2A4PYG9      FNKP------------------IXIGXW---XA-LEH-----------------------
A0A350JJ90      FSEK------------------FAEEDT---IQ-TPH-----------------------
A0A2A4YXP3      VLGE------------------YQTNTT---IH-LPK-----------------------
A0A1F3R158      LIGE------------------FSDREK---IQ-TNL-----------------------
A0A2M8ADX2      FLGE------------------FINNQD---IK-LSK-----------------------
A0A1J5B2H0      IEKT------------------FGLTEK---IV-FQD-----------------------
A0A1V5N756      -QYE------------------FSILDT---LK-TEY-----------------------
A0A4P5U6G4      FIYN------------------GSYGKK---IR-TPH-----------------------
A0A2E2TFD1      NYQV------------------FKIDGD---IE-LPF-----------------------
A0A2E4ELE6      EKRL------------------STNKWE----D-LGF-----------------------
A0A2A3UE91      QKLN------------------FALNSW---LK-TAD-----------------------
A0A7V9SRJ9      RSEK------------------FEINTW---LK-TKE-----------------------
A0A2E6SYP1      SNTI------------------VPVNTW---TD-FEG-----------------------
A0A2E5RLE8      GTVL------------------IPVNKW---VS-IDG-----------------------
A0A2E7TQF6      GTVL------------------IPVNKW---VS-IDG-----------------------
A0A2E6GVY9      GSFI------------------IPVNKW---IS-ING-----------------------
A0A2A5FYT6      YSRE------------------APINEI---II-LPH-----------------------
A0A6N9NIX1      NNYD------------------VTFNEW---VG-VPE-----------------------
A0A1F3Q014      QQHN------------------FISNKW---MK-FPE-----------------------
A0A2D5KD44      SSVD------------------FYAGKS---CH-LPF-----------------------
A0A7Y2F301      EYGP------------------YRTAEQ---ID-LGY-----------------------
A0A0E3V905      -----------------INEQVYPVNHA---IE-TPY-----------------------
A0A553ETH6      -------IS--FDGEDVSGAAEYKTGEL---VS-TPQ-----------------------
A0A2D4ZVH1      -------------------------NEV---EF-DQY-----------------------
A0A6P1P355      ----------------TVGHKAYPMNTW---VN-TPY-----------------------
A0A3D0MYJ7      ----------------SVKSTSFPEASL---IS-IIY-----------------------
A0A4Q5WS95      ----------------RIGAAAYPLDQL---VA-TPY-----------------------
A0A7V9RTA1      ----------------VINKNAYPLDTM---VA-TPY-----------------------
A0A5C8KAD6      ----------------KFDGMKYPLNEW---VD-TPY-----------------------
A0A5N1J695      ----------------KFQEKEYPLDEW---VR-TPY-----------------------
L8JI02          NRTEDTFDE--INLREVVEAGKPFRTHS---LA-FTI-----------------------
A0A1Q3PII2      -----------------SNIYKGTFGIP---MA-LPH-----------------------
A0A351BXT2      ------------------------SVSS---LA-DIL-----------------------
A0A2K8Z965      -----------------INEHVYPLNKS---IE-TPY-----------------------
A0A418M8U8      -----------------INEQVYPLNQR---IK-TPQ-----------------------
I2GTA4          -----------------INEQVYPLNQR---IK-TPQ-----------------------
A0A2K8ZAJ2      -----------------LNGHMYPVNQS---IK-TPY-----------------------
A0A368JPA3      -----------------LNDWVYPANQI---IN-TPF-----------------------
A0A5N1JI29      -----------------LNDWVYPANQI---IN-TPF-----------------------
A0A7K0EGC9      -----------------LNDWVYPANQV---IN-TPF-----------------------
A0A3P1BT12      -----------------LNDWVYPANQI---IN-TPF-----------------------
A0A3P1CI15      -----------------LNDWVYPANQV---IN-TPF-----------------------
A0A4R8CUK1      -----------------LNDGVYPANQS---VT-TPF-----------------------
A0A7Y6XX71      -----------------EEGGIQGFIKD---AK-STL-----------------------
A0A2H3NSN0      -----------------AVDDEQPTDSE---AM-IRL-----------------------
A0A800J4N3      -----------------TEDEQEPTLEL---VA-ARV-----------------------
A0A2P6C324      -----------------VSEEEPYTQYA---AI-LRL-----------------------
A0A7V2F6E1      -----------------DRDGHEPSIRE---IA-LRL-----------------------
A0A1M6XHU0      -----------------TEDGREPSIRE---IA-FRL-----------------------
G2SF81          -----------------TEDGREPSIRE---IA-FRL-----------------------
A0A5S9EYW1      -----------------TEDGREPTIRE---IA-LRL-----------------------
D0MHQ9          -----------------AEDGREPSIRE---IA-FRL-----------------------
A0A662AH13      ---------------------KPLKSVP---AI-AKM-----------------------
A0A5C7QA01      -----------------AQLNKKVKIHN---RM-GLW-----------------------
A0A3D3LS70      -----------------ELLGGIVSISQ---K----------------------------
A0A1G1TM36      -----------------HAFGRPISDSL---GT-WQL-----------------------
A0A1G7ZF38      -----------------GSFGKKLSLPH---G--AAI-----------------------
C6VS52          -----------------GRFSSPLALPQ---GV-AVI-----------------------
                                                                            

A0A7V5RJC2      ------------------------------------------------------------
A0A7C1LGX3      --------------------RILMIDTLQNLN-------------------------LIG
A0A1T5MMH4      --------------------IELTLRKNENFL------------------------DEND
A0A2W4R1L8      --------------------LTVTIHRNPAFT------------------------SESG
A0A7L9BFB6      --------------------FSLTIKKKDAPA------------------------FEPE
A0A5C8A5B4      --------------------DSMFVGDRLSFRIKFPEDRMYDKNTK--------------
A0A2E5CV79      --------------------YSPEIEKEEHYT----------------------------
A0A2A4G4B1      --------------------ENVRFRIIPLLD--INALKGQS------------------
A0A0P7X1V8      ------------------------------------------------------------
A0A4Y9ITE2      --------------------GDFVFQKKDAFY-----------------------EEGKP
A0A3N2M1H3      --------------------GIVKVTPNPEY---DGLPITESIE----------------
A0A4S2G8T2      --------------------GIVKVTPNPEY---DGLPITESIE----------------
A0A212K7W5      --------------------GSIRINPTAFYS--KVY---YNQQ----------------
F5IU11          --------------------GNITIHPTAFYS--KGY---YDQK----------------
A0A7C1QWC7      --------------------FKFSVTRDLNTT---GSNKGGGLP----------------
A0A7Z8P8P1      --------------------GRMIVNLKPENL--STY---IGKP----------------
K0XJ09          --------------------GRFIVEDIPDKI--SAY---YNVP----------------
R5EUZ0          --------------------GRFIVEDIPDKI--SAY---YNVP----------------
W0EQS0          --------------------GRIVVEAVPEYL--PAY---YNIP----------------
A0A1Y3WE15      --------------------GRMVVTAVPEFL--PNY---YTLL----------------
A0A1Y4GUK3      --------------------GRIVVESVPEFL--PAY---YNVP----------------
A0A352Z1R7      ------------------------MQAKGFSLLLNDLKGEKGDN----------------
A0A7X7BZF5      --------------------GRVIVDKTPFYN-------ETNLR----------------
A0A0A2F501      --------------------GKLVIVRSESYL--ADKSKTRPSQ----------------
R5B7P0          --------------------GRIIVQKTKDYS--GEA---MKKP----------------
R5B0L5          --------------------GNLVVSLTGRGN--P-----SGMT----------------
A0A6I1TEC0      --------------------GKVKLEAAPSYA--AFIKGSDAPA----------------
A0A3R5XWG1      --------------------GKVKLEAAPSYA--AFIKGGDAPA----------------
A0A5P0Y910      --------------------GKVKLEAAPSYA--AFIKGGDAPA----------------
A0A414YFM3      --------------------GKVKLEAAPSYA--AFIKGGDAPA----------------
A0A6A7UIA7      --------------------GKVKLEAAPSYA--AFIKGGDAPA----------------
A0A6A7VPS3      --------------------GKVKLEAAPSYA--AFIKGSDAPA----------------
A0A374THP7      --------------------GKIKVDKAPSYS--QFVKNGDAPV----------------
A0A6G1VND1      --------------------GKIKVDKAPSYT--QFVKNGDAPV----------------
A0A0A2EVS5      --------------------GIVRVGLNSAYS--DEKSIQTPMT----------------
A0A1T4NAJ7      --------------------GIVRVGLNSAYS--DEMSIQTPMT----------------
A0A255T941      --------------------GQMTVHGTKTAR--EDF---IGEK----------------
A0A4P7VSV0      --------------------GPMVVVAAEGYK--PG----EAVE----------------
A0A7J0AX49      --------------------GPMVVVAAEGYK--PG----EAVE----------------
A0A3N2KCL3      --------------------GPMVVVAAEGYK--PG----EAVE----------------
A0A2V1IJY1      --------------------GPMVVVAAEGYK--PG----EAVE----------------
A0A4P7VXK7      --------------------GPMVVVAAEGYK--PG----EAVE----------------
A0A1Y4CHN5      --------------------GRIVVSTTPYYS--GTF----DSD----------------
A0A7Y5JED7      --------------------GSMYISTTQYFN--EEY---AGAS----------------
A0A1M6I2S6      --------------------GTFVINPTKYWN--DSF---VGTS----------------
A0A1Y3V692      --------------------GTFVINPTKYWN--DSF---VGTS----------------
F3PXM2          --------------------GTLLIDATPYAT--DDF---MGTS----------------
A0A174JCE8      --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A3E4JMC4      --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A412SND6      --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A414IEQ9      --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A7K0HNT3      --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A0M1W8D8      --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A3R6GKX5      --------------------GTLAISLTSQYE--NFF---TGST----------------
A7V4S1          --------------------GTLAISLTSQYE--NFF---TGST----------------
B0NU19          --------------------GTLAISLTSQYE--NFF---TGST----------------
D4V601          --------------------GTLAISLTSQYE--NFF---TGST----------------
A0A4Q0U3M9      --------------------GTLAISLTSQYE--NFF---TGST----------------
A0A7J5G2G2      --------------------GTLAISLTSQYE--NFF---TGST----------------
A0A7J5HH13      --------------------GTLAISLTSQYE--IFF---TGST----------------
A0A397WLT5      --------------------GTLAISLTSQYE--NFF---TGST----------------
A0A6N8DDD8      --------------------GTLAISLTSQYE--NFF---TGST----------------
A0A6A2J529      --------------------GTLAISLTSQYE--NFF---TGST----------------
A0A7S9QIA5      --------------------GTLAISLTSQYE--NFF---TGST----------------
A0A015XH67      --------------------GTLAISLTSQYE--NFF---TGST----------------
A0A078RZN2      --------------------GTLAISLTSQYE--NFF---TGST----------------
A6L0K5          --------------------GTLAISLTSQYE--NFF---TGST----------------
A7ACT5          --------------------GTLAISLTSQYE--NFF---TGST----------------
A6KY94          --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A173UQR8      --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A3R6HK75      --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A412B7D1      --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A412VNY9      --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A414LTU9      --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A8B2YHC3      --------------------GTLAISLTSQYE--NSF---TGST----------------
I9Q4U4          --------------------GTLAISLTSQYE--NSF---TGST----------------
A0A373ISF0      --------------------GTLFISPTKFYS--DAC---IGTS----------------
U6RF62          --------------------GTLFISPTKFYS--DAC---IGTS----------------
A0A662ZZD5      --------------------GTLVINFTKYWN--DSF---VGTS----------------
A0A415NEB6      --------------------GTLVINFTKYWN--DSF---VGTS----------------
A7AJ60          --------------------GTLVINFTKYWN--DSF---VGTS----------------
A0A6A2JF01      --------------------GTLVINFTKYWN--DSF---VGTS----------------
A0A7J5MKN5      --------------------GTLVINFTKYWN--DSF---VGTS----------------
A0A015UXN7      --------------------GTLVINFTKYWN--DSF---VGTS----------------
A0A642KJV3      --------------------GTLVINFTKYWN--DSF---VGTS----------------
A0A6I2NTL0      --------------------GTLVINFTKYWN--DSF---VGTS----------------
A0A6I2Q447      --------------------GTLVINFTKYWN--DSF---VGTS----------------
A0A016E4F9      --------------------GTFVINLTKYWN--DSF---VGTS----------------
A0A6N3HG44      --------------------GTFVINPTKYWN--DSF---VGTS----------------
A0A7K0HSP7      --------------------GTFVINPTKYWN--DSF---VGTS----------------
A0A7K1HEJ5      --------------------GTFVINPTKYWN--DSF---VGTS----------------
A0A6H9P0U9      --------------------GIMIVSPTQEFT--DAF---IGTS----------------
A0A108TH71      --------------------GIMIVSPTQEFT--DVF---IGTS----------------
I8VXH0          --------------------GIMIVSPTQEFT--DVF---IGTS----------------
A0A412S0N6      --------------------GIMIVSPTQEFT--DVF---IGTS----------------
A0A412IIJ0      --------------------GIMIVSPTQEFT--DAF---IGTS----------------
A0A0P0FM97      --------------------GIMIVSPTQEFT--DAF---IGTS----------------
R6KTP3          --------------------GIMIVSPTQEFT--DAF---IGTS----------------
A0A139LU87      --------------------GIMIVSPTQEFT--DAF---IGTS----------------
A0A1C6B3Y5      --------------------GIMIVSPTQEFT--DAF---IGTS----------------
A0A6L3KCD1      --------------------GIMIVSPTQEFT--DAF---IGTS----------------
E2NMQ4          --------------------GIMIVSPTQEFT--DAF---IGTS----------------
A0A412YDB9      --------------------GTMILHPAQKNA--NAF---IDTP----------------
R7DY01          --------------------GTMILHPAQKNA--NAF---IDTP----------------
A0A414LGK8      --------------------GTMILHPAQKNA--DAF---INTP----------------
A0A415IPQ4      --------------------GIIIISPTEKFT--DAF---TGTS----------------
A0A3E5BRW7      --------------------GTMIISLTQEFT--DAL---TDTP----------------
K9DXS6          --------------------GTMIISLTQEFT--DAL---TDTP----------------
A0A1M6KFV3      --------------------GTMIISPTQAPS--DAF---MGVP----------------
A0A1Q6G7L3      --------------------GTMIISSTQASS--DAF---MGVP----------------
A0A413H235      --------------------GTMIISSTQASS--DAF---MGVP----------------
A0A358R8U0      --------------------GRVEITPTPYYD--ID----RGCQ----------------
R6WSB6          --------------------GRVEITPTPYYD--ID----RGCQ----------------
A0A401LPX7      --------------------GPIVVIPSAAYS--GK----TEST----------------
A0A6G0GNY9      --------------------GPIVITPSATYS--DK----TEEV----------------
A0A6I1BFM0      --------------------GPIVITPSATYS--DK----TEEV----------------
A0A3A5Z900      --------------------GPIVVIPSAAYS--GK----IEST----------------
A0A7K0GW19      --------------------GPIVVIPSAAYS--DK----TVST----------------
A0A285TGL6      --------------------GPIVVIPSAAYS--DK----TVST----------------
A0A3A5RFX4      --------------------GPIVVIPSAAYS--DK----TVST----------------
A0A1Q6IUW9      --------------------GPIVVIPSAAYS--DK----TVST----------------
A0A413XDP6      --------------------GPIVVIPSAAYS--DK----TVST----------------
A0A6N8CVT6      --------------------GPIVVIPSAAYS--DK----TVST----------------
K6AP24          --------------------GPIVVIPSAAYS--DK----TVST----------------
A0A6I2NHV3      --------------------GPIVVIPSAAYS--DK----TVST----------------
A0A662ZYI7      --------------------GPIVVIPSAAYS--DK----TVST----------------
A0A078RYI7      --------------------GPIVVIPSAAYS--DK----TVST----------------
C7XEQ8          --------------------GPIVVIPSAAYS--DK----TVST----------------
D7INX6          --------------------GPIVVIPSAAYS--DK----TVST----------------
K5ZG55          --------------------GPIVVIPSAAYS--DK----TVST----------------
A0A7Y5MWI8      --------------------GKLVVKVANDSA--TH----DS-P----------------
A0A1M5B2J8      --------------------GKMAVTATAHYR--KG----QETE----------------
A0A255RCT5      --------------------GKMSVTATAHYR--KG----QEAD----------------
A0A1Y4GLF5      --------------------GRMVVNATANYV--DA-----PCT----------------
A0A1H3XSC0      --------------------GILKIETTPYYK--SK----EPYT----------------
A6LE40          --------------------GKIIIHTTPNYV--KG----EAYI----------------
A0A4Y1VPX5      --------------------GKIIIHTTPNYV--KG----EAYT----------------
A0A6N2XMM4      --------------------GKIIIHTTPNYV--KG----EAYT----------------
A0A7U8L0B4      --------------------GKIIIHTTPNYV--KG----EAYT----------------
B3JI46          --------------------GKIIIHTTPNYV--KG----EAYT----------------
A0A3N2N9B8      --------------------GLVVINPSAYYL--P----KQPIA----------------
A0A3N2NMI0      --------------------GIVIVNPSPAYT--P----GTAIE----------------
A0A359I8H7      --------------------GKVSIIANGNYTAPKGKKNKPVTK----------------
A0A3N2KA63      --------------------GKVSITANGNYTAPKGKKNKPVTE----------------
A0A4Q0IMT7      --------------------GKVSITANGNYTAPKGKKNKPVTE----------------
A0A7J0B660      --------------------GKVSITANGNYTAPKGKKNKPVTE----------------
A0A3B9FAU3      --------------------GNVLVTPTQYYG--SFVT-HTKDP----------------
A0A3C1E5L7      --------------------GNVLVTPTQYYG--SFVT-HTKDP----------------
A0A4Q0UAV1      --------------------GPFRINTTEYFT--KEYINEPVTF----------------
A0A354SN68      --------------------GKIFLQKSNSFD--K---AFITST----------------
A0A6L5XFL0      --------------------GNVIVNPTSYYV--G----KYNSP----------------
A0A3N2N595      --------------------GPIVILPTDYYK--P----GDLID----------------
A0A7J0ACS3      --------------------GKMIVSPSGNYQ--N----GTEVS----------------
A0A0A2DUD9      --------------------GKVLVNKNQGDD--L----DLVNG----------------
A0A3P1ZBJ5      --------------------GDILVTPTKNFE--L-----LKKS----------------
R5FHS9          --------------------GRVTIKPSHYYN--S-WPGGLYAN----------------
A0A413TW79      --------------------GYVCVDQAPGYS--AFVNGYESRK----------------
A0A7K0AAG2      --------------------GYVCVDQAPGYS--AFINGYESRI----------------
A0A7K0ASF1      --------------------GYVCVDQASGYS--AFVNGHESRK----------------
A0A3E5E9M7      --------------------GYVCVDQAPGYS--AFVNGHESRK----------------
A0A3E4SK73      --------------------GYVCVDQAPGYS--AFVNGHESRK----------------
A0A415GGC6      --------------------GYVCVDQAPGYS--AFVNGYESRK----------------
A0A413DBH9      --------------------GYVCVDQAPGYS--AFINGHESRK----------------
A0A495WI87      --------------------GKVTVCPTPYYT--S----QFSQP----------------
A0A354M4S6      --------------------GKVTVCPTPYYT--S----QFSQP----------------
R7DH52          --------------------GKVTICPTPYYT--S----QFSQP----------------
A0A7J5IAE7      --------------------GKVIIHTTPNYV--K----GEAYT----------------
A0A016CWA4      --------------------GKIVVHTTPNYV--E----GEAYT----------------
A0A4P8LP09      --------------------GKIVVHTTPNYV--E----GEAYT----------------
A0A0M1W0V2      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A139KA16      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A174VQ92      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A1Q6HCG0      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A1Y4JYM9      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A3A5QW67      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A3A5RQE6      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A3A6BP07      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A3E5E153      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A3Q9IP20      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A412WV15      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A413ICP6      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A414KYB9      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A5B3FWR2      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A7J5QHB9      --------------------GKIIIHATPNYV--K----GETYT----------------
E5WX00          --------------------GKIIIHATPNYV--K----GETYT----------------
K0X3P3          --------------------GKIIIHATPNYV--K----GETYT----------------
A0A1C6H117      --------------------GKIIIHATPNYV--K----GETYT----------------
A0A6I1AQV4      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A5C6L2P1      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A3E4WKT5      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A3A5YY33      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A1E9CFZ7      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A373FYU5      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A3A5XBP2      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A3A6MEG9      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A3E4JP35      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A3E4KP40      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A3E4NX82      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A3E4XFU8      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A412RG70      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A412TD37      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A413GAA4      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A414M7I4      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A496BTA0      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A496D2V6      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A5C6KCA6      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A5M5AHM5      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A6I0Y5K7      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A6I1BFB8      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A6I2P5W5      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A6N8DC51      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A7J5HGP0      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A7J5HVL8      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A7J5JHD3      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A8B3EKM1      --------------------GKIIIHTTPNYV--K----GEAYT----------------
E5UZA2          --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A069SMG6      --------------------GKIIIHTTPNYV--K----GEAYT----------------
C3RFN5          --------------------GKIIINTTPNYV--K----GKAYT----------------
A0A3A5Z014      --------------------GKIIINTTPNYV--K----GESYI----------------
A0A7J5GD93      --------------------GKIIINTTPNYV--K----GKAYT----------------
A0A7K0HGR5      --------------------GKIIINTTPNYV--K----GKAYT----------------
A0A078S3Q8      --------------------GKIIINTTPNYV--K----GKAYT----------------
A0A069SJV7      --------------------GKIIINTTPNYV--K----GKAYT----------------
A0A3E5DXI5      --------------------GKIIINTTPNYV--K----GKAYT----------------
A0A3E5EM98      --------------------GKIIINTTPNYV--K----GKAYT----------------
A0A6N2YYD4      --------------------GKIIINTTPNYV--K----GKAYT----------------
I9T3G6          --------------------GKIIINTTPNYV--K----GKAYT----------------
A0A3E4SYU0      --------------------GKIIINTTPNYV--K----GESYT----------------
A6LGY1          --------------------GKIIIHTTPNYV--K----GKAYT----------------
K5ZSH4          --------------------GKIIINTTPNYV--K----GKAYT----------------
A0A6A2RTB3      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A7J5PEN4      --------------------GKIIIHTTPNYV--K----GEAYT----------------
A0A1M4YZ07      --------------------GKIIIHTTPNYV--K----GKAYT----------------
A0A7J5I238      --------------------GKIIIHITPNYV--K----GEAYT----------------
A0A0P0FQW1      --------------------GKIIIHITPNYV--K----GEAYT----------------
A0A7K0I229      --------------------GKIIIHITPNYV--K----GEAYT----------------
A0A5M5C0W6      --------------------GKIIIHITPNYV--K----GEAYT----------------
A0A642NJ89      --------------------GKIIIHITPNYV--K----GEAYT----------------
A0A6L3JTQ2      --------------------GKIIIHITPNYV--K----GEAYT----------------
A0A7J5FQU6      --------------------GKIIIHITPNYV--K----GEAYT----------------
A0A7J4YLH7      --------------------GKIIIHITPNYV--K----GEAYT----------------
A0A6N3AEV2      --------------------GKIIIHITPNYV--K----GEAYT----------------
A0A6G0G4T5      --------------------GKIIIHITPNYV--K----GEAYT----------------
A0A6L3KG29      --------------------GKIIIHITPNYV--K----GEAYT----------------
A0A1Y4PQK7      --------------------GKVTLETTSGYV--R----GTEYK----------------
A0A1Y4IH41      --------------------GKVTLEATSGYV--R----GTEYK----------------
A0A3A6AAP4      --------------------GKVTLEATSGYV--R----GTEYK----------------
A0A6I0ZRD2      --------------------GKVTLEATSGYV--R----GTEYK----------------
A0A1Y4DYA7      --------------------GRLLIKPTHGIK--D----FKET-----------------
A0A1Y3X4I9      --------------------GRLLVKPMAGAE--T----WKEA-----------------
A0A1Y4FNK8      --------------------GKLSIKAMNDTV--T----YQEP-----------------
A0A355FD59      --------------------GKLSVMPTSHYT--N----ETSPL----------------
A0A359CEZ9      --------------------GKLSVMPTSHYT--N----ETSPL----------------
A0A353Q7B4      --------------------GKLSVMPTSHYT--N----ETSPL----------------
F8X3A5          --------------------GKIIVFPTSYYT--K----TEMPL----------------
A0A1M3KVR9      --------------------GKIIVVPTSYYT--K----NEMPL----------------
A0A4Y9IJS3      --------------------GKIIVVPTSYYT--K----NEMPL----------------
A0A416GA42      --------------------GQLVV--VPTGF--YQKFDREL-E----------------
A0A1T3IYP5      --------------------GKVFV--TPSKN--YKDYYGTD------------------
A0A7Z6RZU4      --------------------GELNI--IRTSY--FTPSYIGQ-A----------------
A0A4D7K1D4      --------------------GIITLF-LTEHY--SRGEGFDD------------------
A0A846MP44      --------------------MRLLLK-ANTEE--KTLQDINT-P----------------
A0A1G9E2A9      --------------------FRFEI--HKTRF--FTVPGSIR-R----------------
A0A098LL25      --------------------YSFTL--YPTTF--WSTNETGA-K----------------
A0A6J4H627      --------------------FELVI--RKMPG--FDPKASPG-A----------------
A0A6C0GJI1      --------------------FRFTI--DTTAQ--YSSELDNN-K----------------
A0A839GQ17      --------------------NNFIL--TTTSS--FGASSIGQ-T----------------
A0A127B287      --------------------NNINV--LTNPS--FSANHIGE-S----------------
A0A6P1P2P6      --------------------NNLVV--YTNSR--FNTNHIGE-S----------------
A0A2T2YJE8      --------------------FSFTL--TLRVP--LSADVIAQ-K----------------
A0A7L7LEW0      --------------------FSFTL--TLRVP--LSADVLSQ-Q----------------
A0A3M9N829      --------------------NNITI--TTTSS--FSSAKVGE-T----------------
A0A0P0CSF9      --------------------STFSI--NPVNN--FSSSNVGI-V----------------
A0A5M8QQB8      --------------------SRVTI--KTAPS--FSSASVGV-E----------------
A0A3M9MNC3      --------------------STITV--NSLPS--FTSVNVGE-T----------------
A0A5B6TAX2      --------------------STLTV--NPSSS--FTTSNVGE-T----------------
A0A7L5A132      --------------------MELTIY-RTSPA--TGAEELKV-N----------------
A0A512AYT3      --------------------ISLTLY-PNN-N--FNEDAQGR-K----------------
A0A5M6CYN7      --------------------ISLTLY-PNN-N--FGEGTLDG-K----------------
A0A369QP10      --------------------FTFTL--KLTAP--LNSDILAQ-K----------------
A0A7G7G7M4      --------------------FNFTL--NLRVP--LTSDILAQ-Q----------------
A0A126PDF2      --------------------LDLKVT-PT-QY--FGPASLIA-K----------------
A0A2Z3GKA1      --------------------LDLKVT-PT-RY--FGPATLTA-K----------------
A0A502GZP7      --------------------LDLTVT-TT-SY--FGPATLGE-K----------------
A0A0M3RW20      --------------------INLQLN-LT-PQ--FSSDVIGK-D----------------
A0A495VFX4      --------------------IHLKLV-KA-PY--FSDEAIGR-D----------------
A0A246FQC0      --------------------FRLVIS-KA-AN--YNESVLEE-Q----------------
A0A372E5P8      --------------------FRLTIR-QT-KD--YNLAALDG-Q----------------
A0A7Y7PLY0      --------------------FRLTIR-QT-KD--YNSAALDG-Q----------------
A0A1H3EMW1      --------------------FRLTVR-PT-RE--YSPEALDG-E----------------
A0A1H9ZSN3      --------------------FRLTIR-KA-AD--SGAAAPEG-Q----------------
A0A7W9SXN1      --------------------FTFRIY-PT-DL--YSADKLEA-D----------------
A0A418R9X5      --------------------FTLYMY-KT-AQ--YEGANRDA-N----------------
A0A428JSJ3      --------------------FTLRVY-KT-AQ--YTSADRDA-T----------------
A0A428KI59      --------------------FTLQVY-KT-PQ--HASADPDA-N----------------
W8F1I6          --------------------FTLQVY-KT-PQ--HANADPEA-N----------------
A0A1S9B3W0      --------------------FTLELQ-PT-KH--FNPQDTEG-A----------------
A0A1W1VRL3      --------------------LDLRLT-THGTY--FDANALDA-Q----------------
A0A7G6YQJ9      --------------------FILTVS-KT-DF--FGSETIDG-N----------------
A0A1M6R305      --------------------MTLRLR-PT-AY--MGATTLDN-N----------------
A0A7G7W8X3      --------------------MTLRIR-TT-PT--MDASALDR-T----------------
A0A4Z0PHK3      --------------------MELLLT-AT-PL--LTDESREK-N----------------
A0A2M9B9H9      --------------------MTLVVT-AT-PL--LDEEALEK-N----------------
A0A4Z0QCY9      --------------------MELKVT-ST-AL--LDADAREK-N----------------
A0A7Y0AH93      --------------------INL--------R--LLPDGESK-PLIGN------------
A0A519SBU8      --------------------IDLLVE-AAPDQ--TIPTSESS-P----------------
A0A4Q3JNZ3      --------------------MQLLLE-AVPGR--ALPVGDDP-Q----------------
A0A519Q9V3      --------------------MQLLLE-AAPGR--TLPVGNDP-Q----------------
A0A5N1J2M4      --------------------LDLKVL-K-TNT--FSNQVINQ-H----------------
A0A519S476      --------------------VELVLE-AVPGR--PLPTAEAA-Q----------------
A0A4Q3JRW8      --------------------MQLLLE-DVPGR--ALPVGDDP-Q----------------
A0A519M923      --------------------MQLRLT-PVAGR--ALPTGDAS-P----------------
A0A4Z0ENW1      --------------------ISLQLL----EI--LVPTQLDA-T----------------
A0A519UDB4      --------------------ISFRLLLTSPEG--LNENFSEN-P----------------
A0A3S0QKV1      --------------------FNLRLV-P-TKY--FSGQLADA-T----------------
A0A328BL48      --------------------FTLTLV-R-TRF--FNEQTPET-K----------------
A0A5R8WLY4      --------------------FTLNLT-R-TRF--FNEQTPET-K----------------
A0A1I5WSL8      --------------------ITLQIV-GTPAL---KGDVQDE-N----------------
A0A0U3JVM7      --------------------ITLAVL-GTNEL---TNAAQDA-S----------------
A0A1G1SSV2      --------------------IQLQVL-ETESF--AANNTADA-S----------------
A0A1G1SXV7      --------------------IQLQVL-GTKNL--VTDTPDDA-S----------------
A0A6G8CBJ6      --------------------ISLKLT-TDSSF--FDASALEA-Q----------------
A0A0W8EDI5      --------------------SFIVLK-P-TE----QAIQPNI-P----------------
A0A3B7RBP8      --------------------SSISVY-S-TN----KSPQAGV-N----------------
A0A3R9P8H7      --------------------FRMEVR-K-TPQ--FNDKAFEG-E----------------
A0A238WIA7      --------------------FRLRLY-R-TAF--YQPSDLER-N----------------
A0A212UCJ7      --------------------FWFRIY-P-TSL--FRPSDTER-N----------------
A0A4Z0MQE1      --------------------FTFKIL-Q-TPL--FRPVDTDR-S----------------
A0A4Z0PCF4      --------------------FRFKIQ-Q-TSR--FRPTDVER-S----------------
A0A6M6BED0      --------------------LRLKIE-Q-TPL--FRPTDVDR-S----------------
A0A5D6VDG1      --------------------ITLYLS-K-NKN--FTEDALNR-S----------------
A0A243WHR7      --------------------MELVLA-S-TPW--MNESVVGK-K----------------
A0A5B8A0P6      --------------------MVLAIT-T-TPA--FNDQAINK-K----------------
A0A076HRT9      --------------------MTLRIL-P-EGK--IDASVIER-N----------------
A0A4Z0PVM7      --------------------LELRIT-T-TDL--MNQEARDK-N----------------
A0A1M6DHW8      --------------------MELLFI-G-TSF--LNAEALDK-K----------------
A0A4Q5LC61      --------------------MEMRIL-A-TPL--LNAEAQDK-K----------------
A0A060RD97      --------------------VLIEI--KPTI---SAEKFVGK-E----------------
A0A350IHV0      --------------------GKIKI--VPTMH--IDKWHD---P----------------
A0A2A8CVM9      ------------------------------------------------------------
R5RVP0          --------------------GKIVI--VPTEF--IDK--WKK-P----------------
A0A2L2WX98      --------------------GNLHL--IADTY--IDKMPTGE-T----------------
A0A2E3R1D0      ------------------------------------------------------------
A0A800J826      ------------------------------------------------------------
A0A2T2USC0      ------------------------------------------------------------
A0A2T2V0F3      ------------------------------------------------------------
A0A2T2S682      ------------------------------------------------------------
A0A840DJZ8      -------------------------------------------R----------------
D5H561          -------------------------------------------P----------------
A0A2H3NWA9      ------------------------------------------------------------
A0A2A8CVB6      ------------------------------------------------------------
A0A2P6C1S6      ------------------------------------------------------------
A0A2T2UTM4      ------------------------------------------------------------
R6A0L2          --------------------GPLCV--VRGPG--F-GRWTDE-T----------------
R7LG80          --------------------GRLSV--VRSKM--F-NKWEDE-E----------------
A0A7W5UEN4      --------------------GDLAI--NKTTF--FSRFPVGK-T----------------
G5GD56          --------------------GDLAI--NKTTF--FSRFPVGK-T----------------
R5KD55          --------------------GRLTI--ERQPH--YPSAVADNDE----------------
A0A174QNT3      --------------------GRIIV--TPKAE--YVRLYIGK-D----------------
A0A4S2FGS1      --------------------GRILV--LPHVE--SIPHYQGK-E----------------
A0A7K3KG59      --------------------GRILV--LPHAE--SIPHYQGK-E----------------
R9I0H0          --------------------GRILV--LPHAE--SIPHYQGK-E----------------
K5BUT9          --------------------GRIVV--QLRPE--NLSAYLSQ-P----------------
A0A174FPA3      --------------------GRIVV--QLRPE--NLSAYLSQ-P----------------
R6S9Y6          --------------------GRIVV--QLRPE--NLSAYLSQ-P----------------
A0A7J4YSB2      --------------------GRIVV--QLRPE--NLSAYLSQ-P----------------
C9KX15          --------------------GRIVV--QLRPE--NLSAYLSQ-P----------------
A0A6H0KRK1      --------------------GRIVV--NLKPE--NLSAYIGK-P----------------
R6DAG6          --------------------GRIVV--NLKPE--NLSVYIGK-P----------------
A0A3L8AAP1      --------------------GRIVV--NLKPE--NLSAYIGK-P----------------
A0A4S2AYX2      --------------------GRIVV--NLKPE--NLSAYIGK-P----------------
A0A7J0A2L4      --------------------GRIVV--NLKPE--NLSAYIGK-P----------------
A0A7K3MN31      --------------------GRIVV--NLKPE--NLSAYIGK-P----------------
R6CQ93          --------------------EKILV--TSTDH--WSKSWVGR-D----------------
A0A3D1NQW3      --------------------GQMII--RPTLY--MSPDYYEKAP----------------
B0MT10          --------------------GQMII--RPTLY--MSPDYYEKAP----------------
R7JGW9          --------------------GQMII--RPTLY--MSPDYYEKAP----------------
A0A3D2BF46      --------------------GLLVV--TPTLY--MSDDYFGD-P----------------
A0A358R538      --------------------GKVVV--ERTPY--LTPAYEGV-P----------------
A0A1Y4AAB8      --------------------GRMII--RKTLY--LSPADEGT-A----------------
A0A1Y3WWY9      --------------------GEIVV--HKTLY--MNPKFNGV-P----------------
A0A1Y4U5L4      --------------------GEIVV--HKTLY--MNPEFNGV-P----------------
A0A1Y3VCJ1      --------------------GQIIV--RKTLY--MEPSYRET-P----------------
A0A1Y3QTW7      --------------------GQMVV--HKTPF--MDSTYVDR-P----------------
R6XWY7          --------------------GQMVV--HKTPF--MDSTYVDR-P----------------
A0A4Y1X9Y9      --------------------GQMVV--HKTPF--MDSTYVDR-P----------------
A0A4Y1WM66      --------------------GQMVV--HKTPF--MDSTYVDR-P----------------
A0A6N4GYT3      --------------------GQMVV--HKTPF--MDSTYVDR-P----------------
A0A174AVF1      --------------------GQMVV--HKTPF--MDSTYVDR-P----------------
A0A1Q6EIY0      --------------------GQVVV--HKTLF--MDSTYLKK-P----------------
A0A5B5VN71      --------------------GQVVV--HKTLF--MDSTYLKK-P----------------
E4M8L3          --------------------GQVVV--HKTLF--MDSTYLKK-P----------------
I3YQ50          --------------------GQVVV--HKTLF--MDSTYLKK-P----------------
R5UEY8          --------------------GQVVV--HKTLF--MDSTYLKK-P----------------
A0A1H4D866      --------------------GQVIV--RKSLY--MKPEYTGV-P----------------
A0A5B3G4Y7      --------------------GQVVV--QKSLY--MAPDYIGV-P----------------
A0A374A9J5      --------------------GQVVV--QKSLY--MAPDYIGV-P----------------
A0A5B3GQN5      --------------------GQVVV--QKSLY--MAPDYIGV-P----------------
A0A1Q6E9S3      --------------------GQVVV--QKSLY--MAPDYIGV-P----------------
D4IJ36          --------------------GQVVV--QKSLY--MAPDYIGV-P----------------
A0A414Q925      --------------------GKMVV--ASTLF--TDENSIGK-T----------------
A0A415PUS9      --------------------GKMVV--ASTLF--TDENSIGK-T----------------
A0A108TCU0      --------------------GKMVV--ASTLF--TDENSIGK-T----------------
A0A413BA42      --------------------GKMVV--ASTLF--TDENSIGK-T----------------
S3Y344          --------------------GKMVV--ASTLF--TDENSIGK-T----------------
A0A7J5LEW3      --------------------GKMVV--ASTLF--TDENSIGK-T----------------
A0A412TGL3      --------------------GKMVV--ASTLF--TDENSIGK-T----------------
A0A413VJ33      --------------------GKMVV--ASTLF--MDENSIGK-T----------------
A0A414L0W6      --------------------GKMVV--ASTLF--TDENSIGK-T----------------
A0A412DP39      --------------------GKMVV--ASTLF--TDENSIGK-T----------------
A0A413ZSE8      --------------------GKMVV--ASTLF--TDENSIGK-T----------------
B0NP84          --------------------GKMVV--ASTLF--TDENSIGK-T----------------
R6AK43          --------------------GKMVV--ASTLF--TDENSIGK-T----------------
A0A412N2D9      --------------------GKIAV--QPTLF--TNESYIGK-S----------------
A0A1Y4JYS9      --------------------GKIAV--QPTLF--TNESYIGK-S----------------
R6LHA4          --------------------GKIAV--QPTLF--TNESYIGK-S----------------
A0A3E5HPT8      --------------------GKLIV--FAAEN--YSESYFDR-P----------------
C6IJ48          --------------------GKLIV--FTAEN--YSESYFDR-P----------------
Q8A3U2          --------------------GKLIV--FTAEN--YSESYFDR-P----------------
A0A3R6S1H6      --------------------GKVVV--TPTLY--YSKMYYSV-P----------------
A0A3R6SD81      --------------------GKVVV--TPTLY--YSKMYYSV-P----------------
A0A354WXN6      --------------------GPLKI--EASLD--YSERYWNK-D----------------
A0A7G1HW11      --------------------GVLVV--NNTGI--PLTKFKKK-V----------------
R5IP14          --------------------GVLVV--NNTGI--PLTKFKKK-V----------------
A0A316SZX7      --------------------GKLVI--KPTPY--FDS--WKN-E----------------
A0A1Y4AIY1      --------------------GRIVV--QPSLY--YTDTYYNK-E----------------
A0A0J6CIR2      --------------------GKLVV--TPTLY--YADKYFGK-A----------------
A0A3D8HG59      --------------------GRVVV--TPTLF--YTTAYFGT-P----------------
A0A3R6S408      --------------------GRVVV--TPTLF--YTTAYFGT-P----------------
F3ZRU7          --------------------G-LLL--VKTTG--LGKAYEGE-T----------------
A0A1C5Q1F3      --------------------GKLVV--TPTLY--YTQDYYQV-P----------------
R7A239          --------------------GKLVV--TPTLY--YTQDYYQV-P----------------
A0A3R6HIK7      --------------------GRVVV--VPSLY--YADNYYNI-P----------------
K5ZVW7          --------------------GRVVV--VPSLY--YADNYYNV-P----------------
A0A1Y4D5Z0      --------------------GKLVV--VPSLY--YTDLCYGK-S----------------
A0A413VXJ7      --------------------GAMVV--MPTLY--YSDNFYEK-P----------------
I9RSN9          --------------------GAMVV--MPTLY--YSDNFYEK-P----------------
U6RJK5          --------------------GAMVV--MPTLY--YSDNFYEK-P----------------
A0A1Q6GA32      --------------------GAMVV--MPTLY--YSDNFYEK-P----------------
I9RPU6          --------------------GPMVI--TPTLY--YTDAFYGK-P----------------
I8YFS5          --------------------GTMVV--TPTLY--YTDTYYGN-P----------------
A0A7J4XCM0      --------------------GTMVV--TPTLY--YTDTYYGK-P----------------
I8Y597          --------------------GTMVV--TPTLY--YTDTYYGK-P----------------
A0A1Q6GBF5      --------------------GTMVV--TPTLY--YTDVFYDK-P----------------
I8YFZ3          --------------------GPMVI--TPTLY--YTDVFYGR-S----------------
A0A7J4XFW0      --------------------GPMII--TPTLY--YTDVFYGK-P----------------
A0A1Q6GDH2      --------------------GPMVI--TPTLY--YTDAFYGK-P----------------
U6RSB0          --------------------GPMVV--TPTLY--YTDVFYGK-P----------------
I9GXM2          --------------------GPMVI--TPTLY--YTDVFYGK-P----------------
I9SIK1          --------------------GPMVI--TPTLY--YTDVFYGK-P----------------
A0A7J4XIJ5      --------------------GPMVI--TPTLY--YTDVFYGK-P----------------
I9TP59          --------------------GPMVI--TPTLY--YTDVFYGK-P----------------
R5S343          --------------------GRAVV--APTGY--YNKNDLNR-T----------------
A0A1M6K7I9      --------------------GNIVV--TPTLY--YTNEYYGD-K----------------
A0A5M6A8C8      --------------------GNIVV--TPTLY--YTNEYYGD-K----------------
A0A7J4XCJ1      --------------------GTVVI--TPSLY--YTDAFYAK-P----------------
A0A7J4XNQ7      --------------------GTVVV--TPTLY--YTDTFYDN-P----------------
A0A3R5ZMK1      --------------------GRVVV--VPSLY--YGDKYFNT-V----------------
A0A7K1HMX0      --------------------GRVVV--VPSLY--YGDKYFNT-T----------------
A0A1Y3ZIA4      --------------------GRVVV--VPSLY--YGDKYFNT-T----------------
K5Y1A4          --------------------GRVVV--VPSLY--YGDKYFNT-T----------------
A0A7K1HDC0      --------------------GRVVV--VPSLY--YGDKYFNT-V----------------
A0A3R6K8X4      --------------------GRVVV--VPSLY--YGDKYFNT-V----------------
A0A6N8D6C8      --------------------GRVVV--VPSLY--YGDKYFNT-V----------------
A0A3R6BKI7      --------------------GRVVV--VPSLY--YGDKYFNT-V----------------
A0A412M2W1      --------------------GRVVV--VPSLY--YGDKYFNT-V----------------
K5ZX55          --------------------GRVVV--VPSLY--YGDKYFNT-V----------------
A0A415BDM7      --------------------GRVVV--VPSLY--YGDKYFNT-V----------------
A0A1Q6I3T6      --------------------GRVVV--VPSLY--YGDKYFNT-V----------------
A0A414XX40      --------------------GRVVV--VPSLY--YGDKYFNT-V----------------
A7AEU7          --------------------GRVVV--VPSLY--YGDKYFNT-V----------------
A0A5F0U645      --------------------GKVVV--TPSLY--YTDLYYGS-E----------------
K5ZBN2          --------------------GKVVV--TPSLY--YTDLYYGS-E----------------
A0A0J6CKW3      --------------------GKVVV--TPSLY--YTDLYYGS-E----------------
A0A0F5IQM7      --------------------GKVVV--TPSLY--YTDLYYGS-E----------------
A0A496CDT3      --------------------GKVVV--TPSLY--YTDLYYGS-E----------------
A0A6G1ZKM3      --------------------GKVVV--TPSLY--YTDLYYGS-E----------------
S0GLB0          --------------------GKVVV--TPSLY--YTDLYYGS-E----------------
A0A3R6NLC1      --------------------GKVVV--TPSLY--YTDLYYGS-E----------------
A0A416WYC9      --------------------GKVVV--TPSLY--YTDLYYGS-E----------------
A0A7W7AX81      --------------------GKVVV--TPSLY--YTDLYYGS-E----------------
A0A0F5IT40      --------------------GKLVV--TPTLY--YADKYFGK-A----------------
A0A496CX20      --------------------GKLVV--TPTLY--YADKYFGK-A----------------
A0A5F0UBI0      --------------------GKLVV--TPTLY--YADKYFGK-A----------------
A0A6G1ZHG0      --------------------GKLVV--TPTLY--YADKYFGK-A----------------
S0GSI7          --------------------GKLVV--TPTLY--YADKYFGK-A----------------
K5YB65          --------------------GKLVV--TPTLY--YADKYFGK-A----------------
A0A0F5IWP9      --------------------GKLVV--TPTLY--YSDKYFGK-P----------------
A0A0F5IZT8      --------------------GKLVV--TPTLY--YSDKYFGK-P----------------
A0A417LKQ2      --------------------GKLVV--TPTLY--YSDKYFGK-P----------------
A0A416TME1      --------------------GKLVV--TPTLY--YSDKYFGK-S----------------
A0A7W7F3X3      --------------------GKLVV--TPTLY--YSDKYFGK-S----------------
A0A416XPE8      --------------------GKLVV--TPTLY--YSDKYFGK-S----------------
A0A3B0C2S4      --------------------LPFNITFLENAQ--PIAYEGI-------------------
A0A5M8NYX7      --------------------GTLTFEKNPFGT--GEYPI---------------------
A0A1M6GR99      --------------------FKILVTINENDS--LLSSDNRR------------------
A0A7C5M4P4      --------------------LKLTV---HLQP--IWNPSMGHEF----------------
A0A1W2GF52      --------------------FSFTLEKTNF----FDDQKNLIDF----------------
A0A2G5L7B8      --------------------GELIVSKTIF----FKEQQNLIDF----------------
A0A2D8JJW3      YRQLHVLNTRDYKPVGWRETFNSAISLFGLWP--VSNQKKHDLV----------------
A0A6B5PK86      --------------------FDVVVKSENISA--FLEETESNEI----------------
A0A2G2F510      --------------------FDVVVKVISDDA--LRDASTINEL----------------
A0A316JZ08      --------------------MNVVVKSANPKV--FRKMASENEL----------------
A0A2W1NDY9      --------------------FKFVFKINNEKV--FKADLEKDDL----------------
A0A5C8AQR5      --------------------FKIVVKTASIGA--FKFASEANQL----------------
A0A1G0CI31      --------------------FDIAFKVDNIEN--LRSDDEQNEL----------------
A0A556N0M0      --------------------FDIAFKVENWNI--LKQDDEANRL----------------
F2IKD6          --------------------FEIGFKVNNWQS--LKQEDVSNDL----------------
A0A1I7BM74      --------------------FHIFIKSENEEV--LKRDINDNEL----------------
A0A2G2FJ17      --------------------FDLEIEIPNWES--FVTDAETNVL----------------
A0A1H4ADG3      --------------------GQLTLEKNELTN--DWDGSQNI------------------
A0A5B8VUR8      --------------------GKVTLVKNQAMS--SWDPARSI------------------
A0A1V5IPN7      ------------------------------------------------------------
A0A7G7G5F9      --------------------ATFTVNANPAA-----PASDVKYI----------------
A0A2N3U785      --------------------ATFTVTAAPGF-----STTNYSEV----------------
A0A0D3L8Q3      --------------------GEFTIVSDSR------LIRNGMTV----------------
A0A519U664      --------------------GSFTIVASSI------KNAVSDKI----------------
A0A519MA34      --------------------GSFTIVAAST------KNAVSDKI----------------
A0A519UCX0      --------------------GSFTIVASAT------KSAVSDKI----------------
A0A5B6TJH8      --------------------ATFTVLATYKLN--STPTSNLNQV----------------
A0A7Y0AA98      --------------------GVFTVVPAIASS--NTST----KI----------------
A0A0E3ZG78      --------------------GVFTVVPDSGLT--ASSKSIGSKL----------------
A0A1I6BRK6      --------------------GSFTVITAGG------QYNVGTKI----------------
A0A243WAB1      --------------------GLFTIIAASG------GNTADRKV----------------
A0A6G8C8X6      --------------------GKFTVVAATV------KDLGENKI----------------
A0A4R5DL69      --------------------ATLRKTI---YK--PDPENTY-------------------
A0A1M4YED3      --------------------GVLKFTKNDKAN--AAPQGAL-------------------
A0A7T9DAA2      -----------------------RITFAENYP--YDPKADY-------------------
A0A7Y5V8S3      -----------------------RIEFPADRR--YDPESDY-------------------
A0A126PFG0      --------------------AFAL-----------PAGSRL-------------------
A0A7V5VRT5      --------------------GKLRIALTGDRG--SLPGGEF-------------------
A0A3M1N7Z3      --------------------SSAQLRIDCDPN--CPSEGQY-------------------
A0A7V1R2A1      --------------------SSAQLRVDCDPN--CPSEGQY-------------------
A6EBM4          --------------------VSFMIRNTAQAA--PSSSY---------------------
A0A7X8C760      --------------------FMTVIGVNNYRE--FEM-----------------------
A0A501VZX6      --------------------GIIRFSLNTRKE--GIAKHPL-------------------
A0A399SH26      --------------------GVIKFIPNDHQS--SQAKEQL-------------------
A0A501W1A9      --------------------GELQFIENPQFS--WAATGRL-------------------
A0A0E3ZGV6      --------------------GVMLFSENEKQT--STTTNPL-------------------
A0A1I2N4S1      --------------------GEMLFEKNLLQN--GSAQHPL-------------------
A0A2T5YE44      --------------------GEMLFEKNLLQN--GSAQNPL-------------------
A0A4Q8RX32      --------------------FKFTVLLKEGVA--LEEVSANDY-----------------
A0A1M6TTV4      --------------------GELTIQKTSNFA--SQKNLVEF------------------
K0X1U5          --------------------TSFPIKVDYGEG--IVIDKTEFYKPGKKLKF---------
R5EXK3          --------------------TSFPIKVDYGEG--IIIDKTQFYEPGKKLKF---------
A0A401UAP7      --------------------FKVLIESAKGYT--YEPKNTY-------------------
A0A523GAC0      --------------------EHFALRLTMNLP--LNEVDKDQLY----------------
L8JW09          --------------------IEFIIYLTNYF-----DPKGDKNF----------------
A0A364XUP5      --------------------SVVTIKRNPNFK--ESDEEIEF------------------
A0A1M5RLA9      --------------------VDLYIEKNEAFR--KGD-EIGY------------------
A0A385SFR9      --------------------VDLYIEKNEAFK--KGD-EIGY------------------
A0A5M4A9J4      --------------------SEFAFRIIPVNG--ATLPEGTY------------------
A0A5M4B1C7      --------------------SQFSFCVVPKNG--EPIPSGTY------------------
A0A0D3LFR6      --------------------FNLTLTLLEGTT--GDAINSNY------------------
M7N6D4          --------------------LTFSLSLRNGIN--KDIPESRY------------------
A0A5C7MX19      --------------------KGVVIKKVPKFQ--KQDFRGVF------------------
A0A1M5BA90      --------------------GV-ARITRNLNL--KTASTNPL------------------
A0A512B879      --------------------GT-AKFNINRYF--KTATTNNL------------------
A0A559PPI3      --------------------GK-IMFYPNKNK--VQQAKKPL------------------
A0A1T5CS78      --------------------GQTIMFVKNDNV--NKKASNPL------------------
A0A0Q9Z8F1      --------------------GQTIMFVKNDHV--NKKASNPL------------------
A0A2N0U0M7      --------------------GQTIMFVKNDNV--NKNASDPL------------------
A0A1Q3ZMZ7      --------------------FEVIINGDKESF--SSSRDNDL------------------
A0A7Y3KMD1      --------------------GKIKVQIQNLKM--LQDFNNRFKKNSC-------------
A0A3C1ITV0      --------------------GTVVLKATKEYG--KNFEQAV-------------------
R7HN19          --------------------GTVVLKATKEYG--KNFEQAV-------------------
A0A2W2AFF7      --------------------GKLQVIKNPLVK--ADEEEY--------------------
A0A845PZ37      --------------------GQVLVRPSKYYA--S-YYGKEI------------------
A0A077ENE7      --------------------GKILITPSKYYK--KDYYGVEI------------------
A0A854FRG7      --------------------GEVLIVPSKFYG--TDFYGKDI------------------
T0NN57          --------------------GEVLIVPSKFYG--TDFYGKDI------------------
R7PCR1          --------------------GKIVLNKNSQYI--SEFVGKKI------------------
A0A2N5YXE2      --------------------MEVFIHFPSKKD--MEFELNPDNKSQY-------------
A0A2U1FKU2      --------------------GELQIDQTPFFV--AAWKGQVV------------------
A0A0A2F954      --------------------GELKLDTTLFFA--DSWKGEVL------------------
A0A0A2FW91      --------------------GELKLDTTLFFA--DSWKGEVL------------------
A0A2D2N2N1      --------------------GELKLNTTLFFA--DSWKGEVL------------------
Q7MWZ2          --------------------GELKLNTTLFFA--DSWKGEVL------------------
A0A212FSE5      --------------------GELKLNTTLFFA--DLWKGEVL------------------
T2NDT6          --------------------GELKLNTTLFFA--DSWKGEVL------------------
A0A1R4AFZ0      --------------------GELKLNTTLFFA--DSWKGEVL------------------
A0A1R4DVZ7      --------------------GELKLNTTLFFA--DSWKGEVL------------------
A0A1V9FHD0      --------------------GVLKFEKNARQT--TDSTGQL-------------------
A0A4V4H170      --------------------GELKFEHNDRQL--SMAEGPL-------------------
A0A1V9F098      --------------------GELKFEKNERQT--EAPGGPL-------------------
A0A4R2VU64      --------------------GELKFVENQKQA--DTPGGQL-------------------
A0A0K8QSK7      --------------------YSFAIRVKENAP--SGLSGTY-------------------
A0A7C0WKI7      ------------------------------------------------------------
A0A1T5K9D4      --------------------GSFTIDKTRNLG--KHWFGEAI------------------
A0A5M4B212      --------------------YAFRIIPAADTQ--LEGSY---------------------
A0A3D1KEX9      --------------------GNIRISQAEFDP--EFVGKII-------------------
A0A358Y7S2      --------------------FDIMFKVKNIDE--LKEHCAENEV----------------
A0A2J6HHN3      --------------------VIFSVEPVDTVN--FMQKFKNREF----------------
A0A1Y3WMT8      --------------------TSFPIRVDYGEG--IVIDTTRYYNPDKKLRF---------
A0A1Y4GQU1      --------------------TSFPIKVDYGEG--IVIDKTSYYKPGEKLRF---------
A0A6A0R272      --------------------FEESYSIDRVYS--EPLKSIETDGSY--------------
A0A1V5W8T5      --------------------LKLYVNIINVEQ--ILENKGNKF-----------------
A0A2T8HKA9      --------------------GKLTISSNKLYK--PSIFGEEI------------------
A0A1X7J248      --------------------CKYKLEITPHFF--NTESL---------------------
E4TQD2          --------------------CGYKLETTPHFF--NTERL---------------------
A0A2I0QZ80      --------------------FDIKMKVNDFQE--LKTDAETNQL----------------
A0A3E1F1A3      --------------------FKMRVDILNWNQ--FKTNSSNNKY----------------
A0A2U2XBJ3      --------------------FDMRVIVDNWSQ--FVLNSTSNKL----------------
A0A4Q4KU94      --------------------FDMRVSIDNWDQ--YLANTTSNKL----------------
A0A3B8INU3      --------------------LDLRLESTSHLN--SSYLGEPM------------------
A0A7V6V2N8      --------------------IKFVLIPKDEIK--EGDY----------------------
A0A414ZBF2      --------------------GKVVVASTLFMN--EEYMGKPV------------------
A0A7X9D3Q8      --------------------GDIIVTIAPLIE--RDYIGKPV------------------
A0A1Q3Q573      --------------------FQATISLKPDKL--SDGSFNSLY-----------------
A0A662BAY3      --------------------FSFIIKPKRERN--KIETATY-------------------
A0A4U3L369      --------------------FVFYINRNKYIK--IDKDNEDKF-----------------
A0A4S8HY23      --------------------GELKFENNNRQS--DTVVAPL-------------------
A0A1V9F383      --------------------GELKFIPNDRQT--TAPVGPL-------------------
G8TRZ6          --------------------GVVKFMPNERQT--SKPVGPL-------------------
A0A357YNR3      --------------------GEIEVATTPIIH--SRNMMV--------------------
A0A7X6YKE8      --------------------GEIEVATTPIIH--SRNMMV--------------------
A0A5E8AX52      --------------------YNLLIEKTENFA--EDNGIGKY------------------
A0A1V6CN82      --------------------CSFKINLNEGFF--PPVTDYF-------------------
A0A1M4XZ45      --------------------FSITILLNEKFN--PNAANSY-------------------
A0A399D319      --------------------FSFTILLNELFD--SNASNNY-------------------
A0A7Y1YS85      --------------------GYFKISQSKTAT--LNPGIY--------------------
F4KK08          --------------------GKVVVEATPYYS--NFPNYEVL------------------
A0A7V5VE02      ------------------------------------------------------------
A0A496LCF9      --------------------FLVKVIPNSDFM--DLKTV---------------------
A0A5P2G2A9      --------------------GKFVIYKQTFFD--KKKANY--------------------
A0A3C0ZQC7      ------------------------------------------------------------
A0A3N2N6F7      --------------------GRMVISAGPNFS--PDFDHDI-------------------
A0A419VXB7      --------------------FSFTLQKKVLPT--EGDY----------------------
A0A1Q6E6I7      --------------------GVFRLERAVATA--GYNPKAANSL----------------
A0A3B9CNN6      --------------------GVFRLERAVATA--GYNPKAANSL----------------
R5X290          --------------------GVFRLERAVATA--GYNPKAANSL----------------
C3J7R8          --------------------GRVLVTATEHFP--SSEASFSL------------------
A0A1G8BVM8      --------------------GKIKIKPTIFMH--SGYIGQNI------------------
A0A1I1FXP9      --------------------VKFKITKTPFYK--PDVINYEY------------------
A0A4P7VVU7      --------------------GPITINPGPAYA--KRFGNTI-------------------
A0A2V1ILM4      --------------------GPITINPGPAYA--KRFGNTI-------------------
A0A3N2L0E8      --------------------GPITINPGPAYA--KRFGNTI-------------------
A0A3N2LFC5      --------------------GPITINPGPAYA--KRFGNTI-------------------
A0A7K3KWJ8      --------------------GPITINPGPAYA--KRFGNTI-------------------
A0A3N4H5N3      --------------------GVFSLVKKEEEG--ERLESVSSF-----------------
A0A2P8EAX2      --------------------GVFSLEKKSEED--AISFPFSTF-----------------
A0A4V2F6N9      --------------------GVFSIEKKSEES--AVSFPFSTF-----------------
A0A838T9G8      --------------------FTFTALLNNSIF--ETENKASLYASY--------------
A0A3B9FXJ0      --------------------FSISVSRNGKGK--VLAESY--------------------
A0A848SUJ0      --------------------FKISIQHDPKFR--IDKDKAVY------------------
A0A847ALW2      --------------------FSFSVFLNSKFN--LNSSGNY-------------------
B2RKZ8          --------------------GELQIDKTIFFA--DSWKGGIL------------------
A0A0K2J6Z0      --------------------GELQIDKTIFFA--DSWKGGIL------------------
A0A212GC82      --------------------GELQIDKTIFFA--DSWKGGIL------------------
A0A0E2M2Y7      --------------------GELQIDKTIFFA--DSWKGGIL------------------
A0A829KSZ7      --------------------GELQIDKTIFFA--DSWKGGIL------------------
R5GSU5          --------------------QRIATPAGNVYL--TRKMNLEGLEPTTV------------
A0A7X8I6A2      --------------------NQFKIIMQNFQA--VENMSKSEPLNK-Y------------
A0A0A2G557      --------------------GSFFLTSNTIAT--SKKEPI--------------------
A0A1T4PT95      --------------------GSFVLTGNPSTE--VEDKEI--------------------
A0A6I6JYY3      --------------------FSFTILLNEKFD--PQAPNEF-------------------
A0A651GU15      --------------------FEGRIDLAPPLE--ENSDKGSYNEL---------------
A1ZKR2          --------------------YSFKVIKTSFYK--PAFRQIPF------------------
A0A1Q3GX01      --------------------LSFKVIKTPFYK--KRFHNIPF------------------
A0A349DQI4      --------------------FSFKVIKTPFYK--KRFHNIPF------------------
A0A4P5TMD1      --------------------FNFIAKLTAHDF--KNNPNVYLSSNY--------------
A0A3Q9FR88      --------------------RPIIIRSKSPNV--DNNKY---------------------
A0A553GEX3      --------------------QPIIIRSKSPNV--DNNRY---------------------
A0A150ADJ9      --------------------ADIIIEPNSKST--INNTF---------------------
A0A7X9P1P7      --------------------ADIIIDLKSKSS--LNNTY---------------------
A0A7X8SM94      --------------------TPLIISSKSVTL--DNNQY---------------------
A0A1S1Z228      --------------------QPLIVTPKNKIL--ETNKY---------------------
A0A1B1FWQ4      --------------------QSLIITPKNKIL--ETNKY---------------------
A0A7X9Y5D2      --------------------QSLIITPKNKIL--ETNKY---------------------
A0A7X8ISG0      --------------------IQFQLTINEPYQ--NLIAQSY-------------------
A0A2N3IIZ0      --------------------KDVELLITQKMP--LSTYSENI------------------
A0A7X8Q7Q7      --------------------VRFIFSPKSESI--SSFFNSHENEEY--------------
A0A2N2WFW8      --------------------VNFLLTPVAGDA--KSFFAANNGKQF--------------
A0A1F3IU95      --------------------VNFVLTPINNDA--HAFFKSNRNKQF--------------
A0A3D0VUF6      --------------------VNFVLTPINNDA--HAFFKSNRNKQF--------------
A0A7K3WUF2      --------------------FDFKLLIIDANH--YKRVDSGEIE---F------------
A0A497D5Z2      --------------------FSFTVYADGNAN--YDLNNYDEY-----------------
A0A662B170      --------------------FSFTVYADGNAN--YDLNNYDEY-----------------
A0A7X7FWB7      --------------------PDIKFQLIFNEP--IKTLLNLSY-----------------
A0A7X8DM61      --------------------PEIRFRLNFNVP--LKSQLSTSY-----------------
A0A3M1CDV2      --------------------LDFFIRLNEKRD--TTSIRKDLYNNQ-RT-----------
A0A1F3SJM1      --------------------MDVVIKSTNKQL--FISTSQNDDL----------------
A0A2G2EB96      --------------------FDVVVKATDPHS--FYQVSKENEL----------------
A0A2G6PRA9      --------------------FDIVVKAADPDN--FHKVSKENDL----------------
A0A7Y7A9N2      --------------------FDIVVKAADPDN--FHKVSKENDL----------------
A0A6C1QGZ7      --------------------MDIIINVHNFNM--IREEQSLFSRNH-F------------
A0A7W1EH85      --------------------FDINIFLNPKLS--NGQIRQFMKENK-AF-----------
A0A2E3XZI5      --------------------ISGILKID--WE--LEEFKKNLEKSN-F------------
A0A6I7QXV0      --------------------FILKASLTESAA----EQIHSHVGEP-Y------------
A0A7Y3V126      --------------------GVFKIKINNYST--VVDMQNQLKQQE-F------------
A0A7Y5C3U1      --------------------GVFKIKINNYAT--IVDMQNQLKQQE-F------------
A0A2M7NLQ9      --------------------FKLIISLSDTFD--KLKSTSDSY-----------------
I4AFR0          --------------------FTLIISLNNTFD--KLQSPSSNY-----------------
A0A2N2Y3E5      --------------------SWLRIEIRDTAA--LLEYENMLKKDG-L------------
A0A2D9D7T6      --------------------FEIIVKAKNKFG--ITEINKNNRL----------------
A0A1F3PPL5      --------------------IDVKVTITNYKG--IEELHKSLNHES-F------------
A0A357QK06      --------------------IDVKVTITNYKG--IEELHKSLNHES-F------------
A0A7X9JJJ8      --------------------LKLKLNVTDSNA--VKEQTEKIKTDS-Y------------
A0A522EYA6      --------------------MNFTITVLNFPE--IQSQQNAVKGNS-Q------------
A0A662AEA4      --------------------GEIKLNINNYKR--IELQQSNLKKTA-Y------------
A0A0S2HYK8      --------------------LSCKAEILRYNV--IKSMYESAKQNS-Y------------
A0A2N5ZWN6      --------------------FKIFVTINNFAA--IQSMYEKESQNS-Y------------
A0A2E0FJ09      --------------------FICSIQISDLNR--FYAQQNDGEF----------------
A0A1F3FZ62      --------------------MEFVLKLNPKSS--IKTDLNADEY----------------
A0A1F3K211      --------------------MEFVLKLNPKSS--IKTDLNADEY----------------
A0A7Y1UDU0      --------------------GEIVVNVGKPNE--LKIINKNLELGS-Y------------
A0A1V6I2U9      --------------------MDIYVHFPSKKD--LEQELDPQNKSQ-Y------------
A0A2H0B957      --------------------FEIILNITDLAA--IREQSNKIKTDS-Y------------
A0A1F3CFW6      --------------------LEIKIEVTDIDA--IRTQINKIKNDS-Y------------
A0A2M7E2T8      --------------------LEIKIEVTDIDA--IRTQINKIKNDS-Y------------
A0A2M7NC69      --------------------LEIKIEVTDIDA--IRTQINKIKNDS-Y------------
A0A1F3KLL5      --------------------TEIKININNIDD--LLADKQNLKQNS-F------------
A0A359D1M1      --------------------TEIKININNIDD--LLADKQNLKQNS-F------------
A0A0F2NS19      --------------------VTLRIVFDNYNE--FGADKNNSM-----------------
A0A2A5H8X6      --------------------VTLRIVFDNYNE--FGADKNNSM-----------------
A0A2H0GAU8      --------------------VDLKIQIDEYES--LKDVKNNKM-----------------
A0A2M8FTK1      --------------------VDLKIQIDEYES--LKDVKNNKM-----------------
A0A2A5B3B0      --------------------VELKISLLDKDL--YVTPQGGDL-----------------
A0A5C6RXM7      --------------------IDFKIKILKEKV---TDFIGAVI-----------------
A0A7W1FWM4      --------------------IDLKITINNYQA--IQEQQNLVKQNS-I------------
A0A7T9QP55      --------------------FNGRIVTDAGRK--WPAGIERGTL----------------
A0A7V9MK11      --------------------CTISVTVNNPDA--IKEQILQNKKER-F------------
A0A1F3C1M2      --------------------IEFKLTVNNYNA--ILEEHDELTKNN-Y------------
A0A1F3DS87      --------------------VELKLTVSNYTA--ILEEHDELKKNN-Y------------
A0A7Y5QSG1      --------------------DLNERVTTPHFR--CSVWVDEVAMRE-RM------EADGS
A0A7Y2EX06      --------------------VKEGLTVGAVED--IPEFKFRLTLNR-KLVDLDEISGEN-
A0A7Y7NV14      --------------------VEKSFNINEEAI--FNELNIKVSPNA-NLMQSNFSASETG
A0A6A0R6K9      --------------------VISINNYEHIKN--ETTAVKPIS-----Y-----------
A0A2E7CT70      --------------------ISGKLIIDDIPT--FSESLDKFN-----Y-----------
A0A2D5V560      --------------------ISGKLKFSS-NN--WKDNLNSMSTNE-RL-----------
A0A2D7K5A8      --------------------ISGKLSFSN-GN--WKDLLSSLSSNE-RL-----------
A0A2E1XQ82      --------------------LSGKLSFSN-ED--WKDFLSSLSSNE-RL-----------
A0A1F3K695      --------------------AEIKLKIDDTSQ--IQAQLSDLKQNS-F------------
A0A353KZR1      --------------------AEIKLKIDDTSQ--IQAQLSDLKQNS-F------------
A0A2N2WYB5      --------------------GEIKVSILNIDD--IESQQEYYKSNR-Y------------
A0A1F3K4G0      --------------------DSIRCTVSDYLT--IESQKENYKGNR-F------------
A0A356H8Y3      --------------------DSIRCTVSDYLT--IESQKENYKGNR-F------------
A0A351HSA6      --------------------DSIRCTVSDYLT--IESQKENYKGNR-F------------
A0A2A4PYG9      --------------------LEVKIDVTDFSL--ISTQQNQFAQNP-Y------------
A0A350JJ90      --------------------FSFTIV--RLDE--AQAQSSGLTEDR-K------------
A0A2A4YXP3      --------------------VDLKITLLRKE------NYEILKEGN-L------------
A0A1F3R158      --------------------AEFTVIFNNYEE--AKNAQSDIKNTL-L------------
A0A2M8ADX2      --------------------VDFKISIDGYEE--LKKSQSDIKGTS-I------------
A0A1J5B2H0      --------------------VDLDVKVTNPEV--VFNKSGILNSDN-Y------------
A0A1V5N756      --------------------FDMFVTLKDPG---YFKNISFIDKDD-Y------------
A0A4P5U6G4      --------------------FDFTANTDQEVL--KSNIESLKTGQ--F------------
A0A2E2TFD1      --------------------VTLSIKILDFDI--IKNDQETGTRND-V------------
A0A2E4ELE6      --------------------VELKFIIIDFDI--IKSEQTDLSNND-F------------
A0A2A3UE91      --------------------FDINIYLNPNIQ--ASVINEIVKDNKGF------------
A0A7V9SRJ9      --------------------FDINIFINPKLE--KEDIAIILKENTSL------------
A0A2E6SYP1      --------------------LALKINISNINQ--NKLSDQ---NLK-F------------
A0A2E5RLE8      --------------------LELKINISNRKL--NELNNS---GKK-F------------
A0A2E7TQF6      --------------------LELKINISNRKL--NELNNS---GKK-F------------
A0A2E6GVY9      --------------------LELKINISNRNL--NDLNDS---GKR-F------------
A0A2A5FYT6      --------------------VNLRIKDVDFIQ--ITTSKKQLKQND-Y------------
A0A6N9NIX1      --------------------GRIKIIIKNFDF--IKNFNNQIKQNQ-L------------
A0A1F3Q014      --------------------MDLFISIKNFTE--IANEQNVVKKNA-Y------------
A0A2D5KD44      --------------------AEVIVTVTDYSR--IKKEVEAVKGIE-Y------------
A0A7Y2F301      --------------------IEFVILVTNES-----ISTDLSLGNR-K------------
A0A0E3V905      --------------------GR---LKIVTKK--QTFDSENPY-----------------
A0A553ETH6      --------------------LN--FTLELTEH--YDENGESDY-----------------
A0A2D4ZVH1      --------------------GN--------KF--PILWRAYPV-----------------
A0A6P1P355      --------------------GE--LMFLPNDN--KRDTPSLPL-----------------
A0A3D0MYJ7      --------------------ANSYLSYSLELS--KSELTLKRK-----------------
A0A4Q5WS95      --------------------GS--LTFSPNPR--YKAGSQGPF-----------------
A0A7V9RTA1      --------------------GN--IKFTVNKY--FWKPTEKPL-----------------
A0A5C8KAD6      --------------------GE--MKFSKNKN--MLFAATNPL-----------------
A0A5N1J695      --------------------GI--MLFQRNEK--QSAAPIGPL-----------------
L8JI02          --------------------RP---NELYAPK--E----NTRY-----------------
A0A1Q3PII2      --------------------GL---SIIDTTR--FKPASHYLY-----------------
A0A351BXT2      --------------------SQ---IVKIDQK----------------------------
A0A2K8Z965      --------------------GR---LKIVSRK--ATA-RIKKM-----------------
A0A418M8U8      --------------------GR---FLIKTRR--SVGDTTNQV-----------------
I2GTA4          --------------------GR---FLIKTRR--AVGDTTNQV-----------------
A0A2K8ZAJ2      --------------------GQ---LRIFVRK--PLSSKLKPI-----------------
A0A368JPA3      --------------------GR---LQIFIKQ--PVVYTNEPL-----------------
A0A5N1JI29      --------------------GR---LQIFIKQ--PVVYTNEPL-----------------
A0A7K0EGC9      --------------------GR---LQIFVKQ--PVVYTNDPL-----------------
A0A3P1BT12      --------------------GR---MQIFIKQ--PVVYSNEPL-----------------
A0A3P1CI15      --------------------GR---LKIFIKQ--PVVYSNEPI-----------------
A0A4R8CUK1      --------------------GR---LRMLVNE--PVDYANEPV-----------------
A0A7Y6XX71      --------------------KS---FLTFLPQ--NEEGVLSQE-----------------
A0A2H3NSN0      --------------------FD---MVDFAAE--A-------------------------
A0A800J4N3      --------------------PS---YVTIAQD--G-------------------------
A0A2P6C324      --------------------QE---MVSFVPD--Q-------------------------
A0A7V2F6E1      --------------------QM---QVRFQPL--S-------------------------
A0A1M6XHU0      --------------------RE---RVRFRPL--S-------------------------
G2SF81          --------------------RE---RVRFSPL--S-------------------------
A0A5S9EYW1      --------------------RE---RVHFQPL--S-------------------------
D0MHQ9          --------------------RE---RVRFSPL--S-------------------------
A0A662AH13      --------------------LE---DTKIEQK----------------------------
A0A5C7QA01      --------------------TV---EINSKDI--QS----GLY-----------------
A0A3D3LS70      ------------------------------------------------------------
A0A1G1TM36      --------------------NA---TASLRGF--EG----GEV-----------------
A0A1G7ZF38      --------------------MD---TTRFKPS--SH----YQY-----------------
C6VS52          --------------------VD---TTRFKPS--AL----YQY-----------------
                                                                            

A0A7V5RJC2      -EVNFTIHNFRRTVQAF-----RERIRVNYG----------GA-GTIMEVTLQDNDPYLA
A0A7C1LGX3      QEYEVVISPIKNTVLGL-----INKMEIQTT--T-------KD-SDVLAISLSGNYPTKS
A0A1T5MMH4      IDLFFIINSPDALLGYL-----ISGLSVEPL--N-------YA-AQTIRIAFQDNNPLKA
A0A2W4R1L8      LNCFFVINSPEVLMNYL-----MRNLTVEPI--N-------FN-ANTIRISFKDHNPLKA
A0A7L9BFB6      NQYSFIVNSKRALLDYI-----LTNLTVEPL--N-------VN-ANTIRVSFRDNNPFKA
A0A5C8A5B4      --YHFEIYSLKDLVRVY----RAMTMAVPLS----------DE-SNVVNLSIQVEVVEKG
A0A2E5CV79      ------EPYSDAIGEKF-----SQNVMNGISIKR-------RNATGVLEITFQSVFADEA
A0A2A4G4B1      --YQIYCTPISKTVNQI-----INNLQINPL--S-------DK-THGLTLTMEVEQAERG
A0A0P7X1V8      --------TADTVFARL-----YGNLTFTRA--D-------RN-SNLLRVSYRSPSPYEA
A0A4Y9ITE2      LNITIVVNNYNQATENL-----QDDIKCSIP--N-------KK-ARVITISLNSTNVPFA
A0A3N2M1H3      --LKVVKKPMQTTVENY-----GEKLNGDLV--N-------QD-AEIIGLTIRDVSVQRA
A0A4S2G8T2      --LKVVKKPMQTTVENY-----GEKLNGDLV--N-------QD-AEIIGLTIRDVSVQRA
A0A212K7W5      --ILFVKSNLRSIVNHY-----TNALNVGLS--N-------ED-ATIIDISLNDVSAQRA
F5IU11          --ILFTKFNLRGIVNNY-----TNALNVGLS--N-------EN-ATIINISLNDVSAQRA
A0A7C1QWC7      --TFFRLHHVDNITSQY-----LKRLVVEPV--S-------TR-STLINVFFQGENRELT
A0A7Z8P8P1      --VLVKRMSPEAATAIY-----KGGISTSLA--G-------KG-TTMVQITCVGNNVSRA
K0XJ09          --VEVSRIDLNTAANIY-----HSFISTSLA--G-------ER-TTLVQINCVDSNISRA
R5EUZ0          --VEVSRIDLNTAANIY-----HSFISTSLA--G-------ER-TTLVQINCVDSNISRA
W0EQS0          --VEVSRISLDAASGMY-----HA--SASLA--G-------ER-TTLVQINCVDSNISRA
A0A1Y3WE15      --IEVSRMDLNTAANIY-----HSLISAALA--G-------ER-TTLVQINCIDSNTSRA
A0A1Y4GUK3      --VEVSRMDLNTAADIY-----HSLISAALA--G-------ER-TTLVQINCVDSNISRA
A0A352Z1R7      --FRLKLLPLQNIAVSL-----KGGFKATEV--G-------NR-TNIVRISYSSTDPVQA
A0A7X7BZF5      --YFVKRRGIDAEASAI-----LKRLEVALN--D-------DK-GNLINITIEDYSKQRG
A0A0A2F501      --IYVSYQNLYNVQELY-----SSGLKASIN--N-------DK-ASIIDIAYQDRSIQRA
R5B7P0          --VNVRKSGQRGVTQSY-----LNRLQVNLA--D-------KN-ADVISLSIKDVSTQRA
R5B0L5          --IYVTKMPLQTAASIF-----SGRLTVALK--E-------KL-GNTINLSVMDYSPERA
A0A6I1TEC0      --LYVSHTDLYSMTNRI-----LGSLTVGLN--E-------EK-TTIVNLTYTDVQTKRA
A0A3R5XWG1      --LYVSHTDLYSMTNRI-----LGSLTVGLN--E-------EK-TTIVNLTYTDVQTKRA
A0A5P0Y910      --LYVSHTDLYSMTNRI-----LGSLTVGLN--E-------EK-TTIVNLTYTDVQTKRA
A0A414YFM3      --LYVSHTDLYSMTNRI-----LGSLTVGLN--E-------EK-TTIVNLTYTDVQTKRA
A0A6A7UIA7      --LYVSHTDLYSMTNRI-----LGSLTVGLN--E-------EK-TTIVNLTYTDVQTKRA
A0A6A7VPS3      --LYVSHTDLYSMTNRI-----LGSLTVGLN--E-------EK-TTIVNLTYTDVQTKRA
A0A374THP7      --LYVSRSNIYAMTDRI-----KGSLAASLS--E-------EK-STVIDLTYKDVLPKRA
A0A6G1VND1      --LYVSRSNIYAMTDRI-----KGSLAASLS--E-------EK-STVIDLTYKDVLPKRA
A0A0A2EVS5      --IHVSRSNLSTTMAEC-----QKRLQVGLI--N-------DK-TSILELSYTDVSIERA
A0A1T4NAJ7      --IHVSRSNLSTTMAEC-----QKRLQVGLI--N-------DK-TSILELSYTDVSIERA
A0A255T941      --ITYSKQNIDDLADAL-----STKLVAELD--N-------KE-GTVITLTTEATSPKKA
A0A4P7VSV0      --LEVVKAPVSATAGGY-----GSRMVIAMS--G-------DK-SSVINLTVTDQSTQRS
A0A7J0AX49      --LEVVKAPVSATAGGY-----GSRMVIAMS--G-------DK-SSVINLTVTDQSTQRS
A0A3N2KCL3      --LEVVKAPVSATAGGY-----GSRMVIAMS--G-------DK-SSVINLTVTDQSTQRS
A0A2V1IJY1      --LNVVKAPVSATAGGY-----ESRMVIAMS--G-------DK-SSVINLTVTDQSTQRA
A0A4P7VXK7      --LNVVKAPVSATAGGY-----ESRMVIAMS--G-------DK-SSVINLTVTDQSTQRA
A0A1Y4CHN5      --VYVSRSTIYGAVQSY-----SQRLSVGLA--N-------ED-ATIINLSITDVCIQRA
A0A7Y5JED7      --IAYNHGSIVGITDYY-----TKNLRAELG--N-------ED-ATIINLSIEDASIQKA
A0A1M6I2S6      --IRYNKGSVRAVTDYY-----ATALRADLG--N-------ED-ATIINLSIDDVSIPKA
A0A1Y3V692      --IRYNKGSVRAVTDYY-----ATALRADLG--N-------ED-ATIINLSIDDVSIPKA
F3PXM2          --IHYGKQSVQAVTDYY-----TGALRAELG--N-------ED-ATIINLSIDDSSVWKA
A0A174JCE8      --IQYSKEPADAVADSY-----TQKLRADLG--N-------EN-ATIINLSIDDASVQKA
A0A3E4JMC4      --IQYSKEPADAVADSY-----TQKLRADLG--N-------EN-ATIINLSIDDASVQKA
A0A412SND6      --IQYSKEPADAVADSY-----TQKLRADLG--N-------EN-ATIINLSIDDASVQKA
A0A414IEQ9      --IQYSKEPADAVADSY-----TQKLRADLG--N-------EN-ATIINLSIDDASVQKA
A0A7K0HNT3      --IQYSKEPADAVADSY-----TQKLRADLG--N-------EN-ATIINLSIDDASVQKA
A0A0M1W8D8      --IQYSKEPADAVADSY-----TQKLRADLG--N-------EN-ATIINLSIDDASVQKA
A0A3R6GKX5      --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A7V4S1          --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
B0NU19          --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
D4V601          --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A0A4Q0U3M9      --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A0A7J5G2G2      --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A0A7J5HH13      --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A0A397WLT5      --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A0A6N8DDD8      --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A0A6A2J529      --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A0A7S9QIA5      --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A0A015XH67      --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A0A078RZN2      --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A6L0K5          --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A7ACT5          --IQYSKEPADMVADSY-----TQKLWAELG--N-------ED-ATIINLSIDDASVQKA
A6KY94          --IRYSKESADMMADSY-----TQKLRAELG--N-------ED-ATIINLSIDDASVQKA
A0A173UQR8      --IRYSKESADMMADSY-----TQKLRAELG--N-------ED-ATIINLSIDDASVQKA
A0A3R6HK75      --IRYSKESADMMADSY-----TQKLRAELG--N-------ED-ATIINLSIDDASVQKA
A0A412B7D1      --IRYSKESADMMADSY-----TQKLRAELG--N-------ED-ATIINLSIDDASVQKA
A0A412VNY9      --IRYSKESADMMADSY-----TQKLRAELG--N-------ED-ATIINLSIDDASVQKA
A0A414LTU9      --IRYSKESADMMADSY-----TQKLRAELG--N-------ED-ATIINLSIDDASVQKA
A0A8B2YHC3      --IRYSKESADMMADSY-----TQKLRAELG--N-------ED-ATIINLSIDDASVQKA
I9Q4U4          --IRYSKESADMMADSY-----TQKLRAELG--N-------ED-ATIINLSIDDASVQKA
A0A373ISF0      --IRYAIGKADGAADRY-----LNALRVELG--S-------KE-ATIINLSINDTSIARA
U6RF62          --IRYAIGKADGAADRY-----LNALRVELG--S-------KE-ATIINLSINDTSIARA
A0A662ZZD5      --IRYRKGNVCAVTDYY-----TAALHAELG--N-------ED-ATIINLSINDASIQKA
A0A415NEB6      --IRYRKGNVCAVTDYY-----TAALHAELG--N-------ED-ATIINLSINDASIQKA
A7AJ60          --IRYRKGNVCAVTDYY-----TAALHAELG--N-------ED-ATIINLSINDASIQKA
A0A6A2JF01      --IRYRKGNVCAVTDYY-----TAALHAELG--N-------ED-ATIINLSINDASIQKA
A0A7J5MKN5      --IRYRKGNVCAVTDYY-----TAALHAELG--N-------ED-ATIINLSINDASIQKA
A0A015UXN7      --IRYRKGNVCAVTDYY-----TAALHAELG--N-------ED-ATIINLSINDASIQKA
A0A642KJV3      --IRYRKGNVCAVTDYY-----TAALHAELG--N-------ED-ATIINLSINDASIQKA
A0A6I2NTL0      --IRYRKGNVCAVTDYY-----TAALHAELG--N-------ED-ATIINLSINDASIQKA
A0A6I2Q447      --IRYRKGNVCAVTDYY-----TAALHAELG--N-------ED-ATIINLSINDASIQKA
A0A016E4F9      --IHYNKGSVNAVTDYY-----TQNLRAELG--N-------ED-ATIINLSIDDASIPKA
A0A6N3HG44      --IRYNKGSVRAVTDYY-----ATGLRADLG--N-------ED-ATIINLSIDDASIQKA
A0A7K0HSP7      --IRYNKGSVRAVTDYY-----ATGLRADLG--N-------ED-ATIINLSIDDASIQKA
A0A7K1HEJ5      --IRYNKGSVRAVTDYY-----ATGLRADLG--N-------ED-ATIINLSIDDASIQKA
A0A6H9P0U9      --IRYVRGSVRAAVDTY-----SNALVAELG--N-------ED-ATIINLSINDTSIRKA
A0A108TH71      --IRYVRGSVRAAVDTY-----SNALVAELG--N-------ED-ATIINLSINDTSIRKA
I8VXH0          --IRYVRGSVRAAVDTY-----SNALVAELG--N-------ED-ATIINLSINDTSIRKA
A0A412S0N6      --IRYVRGSVRAAVDTY-----SNALVAELG--N-------ED-ATIINLSINDTSIRKA
A0A412IIJ0      --IRYVRGSMRAAVDTY-----SNALVAELG--N-------ED-ATIINLSINDTSIRKA
A0A0P0FM97      --IRYVRGSVRAAVDTY-----SNALVAELG--N-------ED-ATIINLSINDTSIRKA
R6KTP3          --IRYVRGSVRAAVDTY-----SNALVAELG--N-------ED-ATIINLSINDTSIRKA
A0A139LU87      --IRYVRGSVRAAVDTY-----SNALVAELG--N-------ED-ATIINLSINDTSIRKA
A0A1C6B3Y5      --IRYVRGSVRAAVDTY-----SNALVAELG--N-------ED-ATIINLSINDTSIRKA
A0A6L3KCD1      --IRYVRGSVRAAVDTY-----SNALVAELG--N-------ED-ATIINLSINDTSIRKA
E2NMQ4          --IRYVRGSVRAAVDTY-----SNALVAELG--N-------ED-ATIINLSINDTSIRKA
A0A412YDB9      --IQYVRGSVSAAADTY-----ANTLVAELG--S-------DD-ATIINLSISDASIRKA
R7DY01          --IQYVRGSVSAAADTY-----ANTLVAELG--S-------DD-ATIINLSISDASIRKA
A0A414LGK8      --IQYVRGSVSATADTY-----ANALVAELG--S-------DD-ATIINLSISDASIRKA
A0A415IPQ4      --ILYSRGSVRAAADTY-----ANALVAELG--N-------ED-ATIINLSINDASIQKA
A0A3E5BRW7      --VRYARRSVRDVADAY-----TRELVAELG--N-------ED-ATIINLSISDASIRKA
K9DXS6          --VRYARRSVRDVADAY-----TRELVAELG--N-------ED-ATIINLSISDASIRKA
A0A1M6KFV3      --IRYVRRNVRSVSDAY-----AKELVAELG--N-------ED-ATIINLSINDASTRKA
A0A1Q6G7L3      --IRYVRRSVRSVSDAY-----AKELVAELG--N-------ED-ATIINLSINDASTRKA
A0A413H235      --IRYVRRSVRSVSDAY-----AKELVAELG--N-------ED-ATIINLSINDASTRKA
A0A358R8U0      --LKVSRTGLYGAVGSY-----SGNLTVTLS--D-------KK-ASAIDLTFRDVSTQRA
R6WSB6          --LKVSRTGLYGAVGSY-----SGNLTVTLS--D-------KK-ASAIDLTFRDVSTQRA
A0A401LPX7      --IYVTRQSLSAASAGC-----SANLTISQN--D-------EK-SNIITLSFQDVSTQRA
A0A6G0GNY9      --IYVSRQSLAATSANC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
A0A6I1BFM0      --IYVSRQSLAATSANC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
A0A3A5Z900      --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVCTQRA
A0A7K0GW19      --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
A0A285TGL6      --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
A0A3A5RFX4      --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
A0A1Q6IUW9      --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
A0A413XDP6      --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
A0A6N8CVT6      --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
K6AP24          --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
A0A6I2NHV3      --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
A0A662ZYI7      --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
A0A078RYI7      --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
C7XEQ8          --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
D7INX6          --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
K5ZG55          --IYVTRQSLSAASAGC-----SARLNISQN--D-------EK-SNIITLSFQDVSTQRA
A0A7Y5MWI8      --VYVSRRGYQDATGDY-----ASNLSVTLS--D-------EK-STVINLSFKDVCIQRA
A0A1M5B2J8      --IEVIRSTIKGAVGDA-----SSRLSVVQN--D-------EK-SNIISLSFQDVSIQRA
A0A255RCT5      --VEVLRSTLKEAVAGA-----SSRLTVSQD--D-------EK-SNIISLSFQDVSIQRA
A0A1Y4GLF5      --LYVDRSTLYSAVNAY-----SANLSVSLN--N-------EK-ASVIDLSFKDLSTQRA
A0A1H3XSC0      --LYVFRSSLHGTVGQY-----SSNLSVALS--S-------EK-TSIVNLTFRDHSIQRA
A6LE40          --LYISKSSLYNAVNSY-----SSNLSISLN--N-------EK-ASVIDLSLKDNSTQRA
A0A4Y1VPX5      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A6N2XMM4      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A7U8L0B4      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
B3JI46          --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A3N2N9B8      --LKVNRLPLDAARASY-----SSRLSVTQG--S-------DN-SSLIRLTLSDRSIERA
A0A3N2NMI0      --LEVNKIPVKTAQAIY-----SSHLGVSQS--G-------EN-SSVIRLTLSDRSIQRA
A0A359I8H7      --IIVERDGMQSTVETY-----GGLVKADLA--D-------KD-ADVIDLSMKDVSTQRA
A0A3N2KA63      --IIVERDGMQSTVETY-----SGLVKADLA--D-------KD-ADVIDLSMKDVSTQRA
A0A4Q0IMT7      --IIVERDGMQSTVETY-----SGLVKADLA--D-------KD-ADVIDLSMKDVSTQRA
A0A7J0B660      --IIVERDGMQSTVETY-----SGLVKADLA--D-------KD-ADVIDLSMKDVSTQRA
A0A3B9FAU3      --ILVTRTDLYTKTEGV-----QRNLSVELT--D-------KM-STLVRISYKDKEPYRA
A0A3C1E5L7      --ILVTRTDLYTKTEGV-----QRNLSMELA--D-------KM-STLVRISYKDKEPYRA
A0A4Q0UAV1      --IHNTPEAL---AASF-----SGNITFELK--E-------FS-TSIINLIMTDESPQRA
A0A354SN68      --ICVRKCNITSATERV-----QRMYLATGR--E-------DG-SSVVNITCNGEHIGML
A0A6L5XFL0      --IEVSHRSVKAVAGAL-----DHGLKVELN--D-------DN-SSVVDLTLNDENPFRA
A0A3N2N595      --LEIDKKPLGWAVATY-----LGNLMVSLN--N-------KE-GTVIDLTLNDRSTQRA
A0A7J0ACS3      --LIVTKMPLSAARDSY-----NGRLAVAMS--N-------DK-GTVLRLTFADQSPQRA
A0A0A2DUD9      --LIIKRSSLYDAVENL-----GKNLTVNLA--D-------EK-STILSLSLLDRSQERA
A0A3P1ZBJ5      --IQVVKYPLSDVVD-Y-----FGRINVELK--E-------KE-STMVDISINDVSVERA
R5FHS9          --LYVTHVPMMSAMSSY-----QKGLSVSLA--D-------NK-AAVINLEMQDVNIQRA
A0A413TW79      --LHVTRTNLYAMTDHI-----KASLSASIS--E-------EK-ATVIDLTYKDQLTQRA
A0A7K0AAG2      --LHVTRTNLYAMTDHI-----KASLSASIS--E-------EK-ATVINLTYKDQLTQRA
A0A7K0ASF1      --LHVTRTNLYAMTDHI-----KASLSASIS--E-------EK-ATVIDLTYKDQLTQRA
A0A3E5E9M7      --LHVTRTNLYAMTDHI-----KASLSASIS--E-------EK-ATVIDLTYKDQLTQRA
A0A3E4SK73      --LHVTRTNLYAMTDHI-----KASLSASIS--E-------EK-ATVIDLTYKDQLTQRA
A0A415GGC6      --LHVTRTNLYAMTDHI-----KASLSASIS--E-------EK-ATVIDLTYKDQLTQRA
A0A413DBH9      --LHVTRTNLYAMTNHI-----KASLSASIS--E-------EK-ATVIDLTYKDQLTQRA
A0A495WI87      --IYVSCSSLYSAVRRY-----APNLSVVLN--D-------EK-STVVDLSFKDVSIQRA
A0A354M4S6      --IYVSRSGLYSAVRRY-----APNLSVVLN--D-------EK-STVVDLSFKDVSIQRA
R7DH52          --IYVSRSGLYSAVRRY-----APNLSVVLN--D-------EK-STVVDLSFKDVSIQRA
A0A7J5IAE7      --LYVGKSSLYSAVNNC-----SSNLSVSLN--N-------EK-ASVIDLSYKDNSIQRA
A0A016CWA4      --LYVDKSGLYNAVNSC-----SSNLSVSLN--N-------EK-ASVVDLSFRDNSIQRA
A0A4P8LP09      --LYVDKSGLYNAVNSC-----SSNLSVSLN--N-------EK-ASVVDLSFRDNSIQRA
A0A0M1W0V2      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A139KA16      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A174VQ92      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A1Q6HCG0      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A1Y4JYM9      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A3A5QW67      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A3A5RQE6      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A3A6BP07      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A3E5E153      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A3Q9IP20      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A412WV15      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A413ICP6      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A414KYB9      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A5B3FWR2      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A7J5QHB9      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
E5WX00          --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
K0X3P3          --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A1C6H117      --LYVGKSSLYDAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFRDNSVQRA
A0A6I1AQV4      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A5C6L2P1      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A3E4WKT5      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVINLSFKDNSTQRA
A0A3A5YY33      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A1E9CFZ7      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A373FYU5      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A3A5XBP2      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A3A6MEG9      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A3E4JP35      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A3E4KP40      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A3E4NX82      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A3E4XFU8      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A412RG70      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A412TD37      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A413GAA4      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A414M7I4      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A496BTA0      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A496D2V6      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A5C6KCA6      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A5M5AHM5      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A6I0Y5K7      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A6I1BFB8      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A6I2P5W5      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A6N8DC51      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A7J5HGP0      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A7J5HVL8      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A7J5JHD3      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A8B3EKM1      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
E5UZA2          --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A069SMG6      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
C3RFN5          --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A3A5Z014      --LYIDKSSLYNAVNSC-----SSNLSVSLN--N-------EK-SSVIDLAFKDNSIQRA
A0A7J5GD93      --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLAFKDNSTQRA
A0A7K0HGR5      --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLAFKDNSTQRA
A0A078S3Q8      --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLAFKDNSTQRA
A0A069SJV7      --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLAFKDNSTQRA
A0A3E5DXI5      --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLAFKDNSTQRA
A0A3E5EM98      --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLAFKDNSTQRA
A0A6N2YYD4      --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLAFKDNSTQRA
I9T3G6          --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLAFKDNSTQRA
A0A3E4SYU0      --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLAFKDNSTQRA
A6LGY1          --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
K5ZSH4          --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A6A2RTB3      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A7J5PEN4      --LYVGKSSLYNAVNSC-----SSNLSVSLN--S-------EK-ASVIDLSFKDNSTQRA
A0A1M4YZ07      --LYVGKSNLYNAVNSC-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A7J5I238      --LYIGKSSLYNAVNSY-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A0P0FQW1      --LYIGKSSLYNAVNSY-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A7K0I229      --LYIGKSSLYNAVNSY-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A5M5C0W6      --LYIGKSSLYNAVNSY-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A642NJ89      --LYIGKSSLYNAVNSY-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A6L3JTQ2      --LYIGKSSLYNAVNSY-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A7J5FQU6      --LYIGKSSLYNAVNSY-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A7J4YLH7      --LYIGKSSLYNAVNSY-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A6N3AEV2      --LYIGKSSLYNAVNSY-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A6G0G4T5      --LYIGKSSLYNAVNSY-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A6L3KG29      --LYIGKSSLYNAVNSY-----SSNLSVSLN--N-------EK-ASVIDLSFKDNSTQRA
A0A1Y4PQK7      --VRVVRSGLYGAVRTC-----SSRLSVALN--D-------EE-STVLSLSYRDVSPARA
A0A1Y4IH41      --VHVVRSGLYGAVGTC-----SSRLSVALN--D-------EE-STVLSLSYRDVSPARA
A0A3A6AAP4      --VHVVRSGLYGAVGTC-----SSRLSVALN--D-------EE-STVLSLSYRDVSPARA
A0A6I0ZRD2      --VHVVRSGLYGAVGTC-----SSRLSVALN--D-------EE-STVLSLSYRDVSPARA
A0A1Y4DYA7      --VYISHSGLQATTSVY-----SGKLTVALK--D-------EK-STVINLSIEDVCIQRA
A0A1Y3X4I9      --VYVSRSGLQSTAAAY-----SDKLNVALN--D-------EK-STVINLSLEDVCIQRA
A0A1Y4FNK8      --VYVTRISYQAATSAY-----ASNLSVALN--D-------EK-STVVNLTFTDVCTQRA
A0A355FD59      --IYVSRTNLYSATNAC-----KEALTISLS--D-------EK-VTVIDLSYNDVSTQRA
A0A359CEZ9      --IYVSRTNLYSATNAC-----KEALTISLS--D-------EK-VTVIDLSYNDVSTQRA
A0A353Q7B4      --IYVSRTNLYSATNAC-----KEALTISLS--D-------EK-VTVIDLSYNDVSTQRA
F8X3A5          --IYISRTNLYSATDLF-----KQNLTASLS--E-------EK-ATVIDLSYKDVSTQRA
A0A1M3KVR9      --IYISRTNLYSATDLF-----KQNLTASLS--E-------EK-ATVIDLSYKDVSTQRA
A0A4Y9IJS3      --IYISRTNLYSATDLF-----KQNLTASLS--E-------EK-ATVIDLSYKDVSTQRA
A0A416GA42      --IEVLKSTVRNTGNAL-----VARLGVAKA--S-------KE-SSMIQLNITDPVPQRA
A0A1T3IYP5      --VFVAKYPREVIMSQF-----VANLKIKQM--E-------ED-ASLLQVSMEDQSPERA
A0A7Z6RZU4      --IYVKHSTVSSVVSSF-----ITPLTVEKV--D-------DT-ATLLDITYKDMNQDRS
A0A4D7K1D4      --YSFKINNKESQINFI-----QQNLKVEAQ--S-------LA-ANTIKITFTDNDKYKA
A0A846MP44      --LYFIFHSDSYLYNYL-----QQNLEARIA--N-------QA-AKVIQLSFRDYEPYKA
A0A1G9E2A9      --YYFVINSRGALISYL-----AENLTVNVV--N-------AN-ASTIRIAFKDYTPEKA
A0A098LL25      --YFFTMNSKEALVKNL-----MDNVSVSIL--N-------LD-ANTILLSYKNHNYSKA
A0A6J4H627      --YYFVINSIDALNNYL-----ASNLRVDVL--N-------PS-ANIIGIFFKDKNIRKA
A0A6C0GJI1      --YYFRINSAGALINYL-----ASNIRVDVL--N-------QM-ANSLGISFKDHSIAKA
A0A839GQ17      --YFFIVRSNKALKSYL-----DNNLSVAII--N-------PD-AKTLSISFKDNNRYKA
A0A127B287      --FYFIVHSSGALKRYL-----NDNLSVAVL--N-------PE-AKTISISFKEFNREKA
A0A6P1P2P6      --FYFIVHSNGALKRYL-----NENLTVAVL--N-------PE-AKTISISFKEFNREKA
A0A2T2YJE8      --YYFIVNSNAAIRQYL-----TSNVAVNIV--N-------LD-ASTVEISFTDHNPFKA
A0A7L7LEW0      --YFFTINSNSAIRQYL-----TSNVAVNIV--N-------LD-ASTVEISFTDHNPYKA
A0A3M9N829      --YYFIVHSSQRLKRYI-----DENLSTAIL--N-------PE-SKTIQISFKDFNRYKA
A0A0P0CSF9      --YYFIVNSDQRLKGYI-----DTNLTTAIL--N-------PE-SKTIQIAFKDFNRFKA
A0A5M8QQB8      --YYFVINSDQRLKGYI-----DGNLTTAIL--N-------PE-SKTIQISFKDFNRFKA
A0A3M9MNC3      --YYFIVHSNQSLKGYI-----DNNLTTAIL--N-------PE-SKTIQISFKDFNRYKA
A0A5B6TAX2      --YYFIVHSNQALKGYI-----DNNLTTAIL--N-------PE-SKTIQISFKDFNRYKA
A0A7L5A132      --YYFVINDDGAMARYF-----DENLVVEIV--N-------PE-ANTIGISFKDNNALKA
A0A512AYT3      --YFFVINSDGALNSYF-----NQNLSVEIV--N-------PD-AHTIGIFFTDFNPAKA
A0A5M6CYN7      --YYFVINSDGALNAYF-----NQNLSVEIV--N-------PD-AHTVGIFFTDFNPAKA
A0A369QP10      --YYFTINSTGAIRQYL-----TSNVAVNIV--N-------LD-ASTVDISFTDHNPFKA
A0A7G7G7M4      --YYFVINSTSAIRQYL-----TSNVAVNII--N-------LD-ASTVEISFTDHNPYKA
A0A126PDF2      --YHFTIQDQGTVNAYL-----EKNLAVDIS--S-------AD-ANTIQISFTDFNPKKA
A0A2Z3GKA1      --YHFTVQDEGTVNAYL-----EKNLAVDIS--S-------AD-ANTIQISFTDFNPKKA
A0A502GZP7      --YHFTIQDEGTVNGYL-----EKNLAVDIS--S-------AD-ANTIQISFTDFNAKKA
A0A0M3RW20      --YHFVVKDNGAINQYI-----DQNLTVEII--N-------PE-ANTIGISFADHNPLKA
A0A495VFX4      --YHFVVNDKSSINQYI-----DQNLIVEII--N-------PE-ANTIGISFSDHNPLKA
A0A246FQC0      --YSFRINSNSALNEYF-----DTNLLVDIV--N-------LD-ANTISISFTDHNPAKA
A0A372E5P8      --YSFVINSAGALGNYF-----NTNLLVDIV--N-------LD-ANTISISFTDHNPAKA
A0A7Y7PLY0      --YSFLINSPSALSTYF-----NTNLLVDIV--N-------LD-ANTISISFTDHNPAKA
A0A1H3EMW1      --YSFMINSPGALSNYF-----NTNLLVDIV--N-------VD-ANTISISFTDHNPAKA
A0A1H9ZSN3      --YSFMVNSPGALSNYF-----NSNLLVDIV--N-------VD-ANTISISFTDHNPAKA
A0A7W9SXN1      --YHFVIHDEGSLNAYL-----SQNLLVEIG--N-------AD-ANVIGISFTDHNPLKA
A0A418R9X5      --YSFIINDQNAINGYL-----NQNLSVDII--N-------PD-ASTISISFTDYNPSKA
A0A428JSJ3      --YSFVIQDGGTVNAYL-----TQNLAVDIV--N-------PD-ASTISISFADHNPVKA
A0A428KI59      --YSFVINDDGTVNGYL-----NQNLAVEIV--N-------PD-ASTISIAFTDHNSVKA
W8F1I6          --YSFVINDDGTVNGYL-----NQNLAVEIV--N-------PD-ASTISIAFTDHNPVKA
A0A1S9B3W0      --YYFIIKDPGSINGYL-----GSNLGVSVI--N-------PD-ASTIGISFTDNNPAKA
A0A1W1VRL3      --FYFVILDEGTLNTYL-----NTNLSVQIV--N-------PD-ANTVQISFKDFNPAKA
A0A7G6YQJ9      --YHFVINDNSAINNYL-----NANLSVAIE--N-------PD-ASTINISFTDNTPLKA
A0A1M6R305      --YHFTINDEGTINSYL-----DRNLLVEIV--N-------PD-ANTIQISFQDFTPAKA
A0A7G7W8X3      --FHFIINDEGAINSYL-----DRNLLVEIV--N-------PD-ANTIQISFQDFTPSKA
A0A4Z0PHK3      --YHFVINDEGAVNNYL-----NTNLSVDIV--N-------PD-ANTIQIGFTDFNPAKA
A0A2M9B9H9      --YHFVINDDGAVNNYL-----NTNLSVDIV--N-------PD-ANTIQIAFTDFNPAKA
A0A4Z0QCY9      --YHFVINDDGAVNAYL-----NTNLSVDIV--N-------PD-ANTIQISFTDFNPAKA
A0A7Y0AH93      -AYHFTLLDDTAIDRYL-----NLNLTVEVL--N-------PN-ANTIQIAFTDNNRLKA
A0A519SBU8      --YFFVILDDGALNAYL-----DRNLDVAVV--N-------PS-ANTIQISFTDNNPSKA
A0A4Q3JNZ3      --YHFVVLSDGDISGYL-----NRNLDVTVV--N-------PS-ANTIQISFTDNNPEKA
A0A519Q9V3      --YHFVILDDGAVSDYL-----DTNLDVAVV--N-------PS-ANTIQISFTDNNPEKA
A0A5N1J2M4      --YYFTINSPAAVLNYI-----GSNLSAQVV--N-------FD-AQTIKISFTDHNPKKA
A0A519S476      --YHFVILNDGAINAYL-----DKNLDVKVI--N-------PN-ANTIQISFTDNNPVKA
A0A4Q3JRW8      --YHFVILNDGAVSGYL-----DRNLDVAVV--N-------PN-ANTIQISFTDNNPEKA
A0A519M923      --YYFTILNDGAVNAYL-----DKNLDVAVV--N-------PS-ANTIQISFTDNNPEKA
A0A4Z0ENW1      --YYFIILDDNTINSYL-----DRNLKAEVL--N-------PS-ASTLQISFLDNNRVKA
A0A519UDB4      --YHFVLLEDNAITAYL-----DRNLTAEVL--N-------PS-ANTIQISFQDNNRLKA
A0A3S0QKV1      --YYFTINDAAAINGYL-----SANLTVSVI--N-------PE-ASTIGISFSDNTPQKA
A0A328BL48      --FFFVINTPEAINGYL-----AQNLTVSVI--N-------PD-ANTIGISFTDYNPAKA
A0A5R8WLY4      --YFFVVNTPEAINSYL-----AQNLAVSII--N-------PD-ANTIGISFTDYTPTKA
A0A1I5WSL8      --YHFTILSDGAVNQYL-----DKNLAVEIV--N-------PE-ANTIQISFNDFNPTKA
A0A0U3JVM7      --YHFTILDDRTVNEYL-----DKNLTVEIV--N-------PE-ASTIQISFNDFNPSKA
A0A1G1SSV2      --YHFTIQDDRSVNAYL-----DKNLTVEIV--N-------PE-ANTIQIAFNDFNASKA
A0A1G1SXV7      --YHFTIQDDYTVNAYL-----DKNLTVEII--N-------PE-ASTIQIAFNDFNPSKA
A0A6G8CBJ6      --FYFIILDDGSVNGYL-----NKNISVEIV--N-------PE-AHTVEISFADFNPLKA
A0A0W8EDI5      --YYFIIHDNSSVWSYI-----DQGLTVEII--N-------PE-ANTIAISFKDHNPKKA
A0A3B7RBP8      --YYFVIHDDATVWGYI-----GENLTVEII--N-------PE-ANTIGISFKDHNPGKA
A0A3R9P8H7      --YFFTINSNGALNAYF-----NKNLLVDIV--N-------VD-ANTISISFTDHNPTKA
A0A238WIA7      --LFFIIHDEGTINGYL-----SQNLQVQVV--N-------PD-ANTISIGFTDYNPLKA
A0A212UCJ7      --FYFVIRDEGFINQYL-----SSNLQVQII--N-------PD-ANTISISFTDNNSLKA
A0A4Z0MQE1      --FYFIIRDEGFINGYL-----SSNLQAQIV--N-------PD-ANTISIAFTDHNPLKA
A0A4Z0PCF4      --FYFIIRDDAFINGYL-----SSNLQVQVV--N-------PD-ANTISISFTDHNPLKA
A0A6M6BED0      --FYFIIRDDGFINGYL-----SSNLQVQVV--N-------PD-ANTISISFTDHNPLKA
A0A5D6VDG1      --FQFVIRDDASINRYF-----DENLTVEIV--N-------PE-ASTISISFKDHNPRKA
A0A243WHR7      --YFFVINDDGTISNYL-----NKGLNVQVV--N-------PD-ANTIQISFTDFNPSKA
A0A5B8A0P6      --YYFIINDEGTLNSYF-----EKNISVDII--N-------PN-ANTIQISFQDFNPLKA
A0A076HRT9      --YFFTINDEAAINAYL-----DRNLLVEIV--N-------PD-ANTIQISFQDFSPSKA
A0A4Z0PVM7      --YHFVINDDGAVNAYL-----NTNLSVDIV--N-------PD-ANTIQISFTDFNPAKA
A0A1M6DHW8      --YHFVINDEGTLNAYL-----SSNLSVDII--N-------AD-ANTIQIAFTDFNPAKA
A0A4Q5LC61      --YHFVINDDGGLNAYL-----SNNLSVEIV--N-------AD-ANTIQIAFTDFNPAKA
A0A060RD97      --VNVAVTSVAKAQLDF-----SSRLTVARA--D-------KV-SSVVNLSFIDQSPQRA
A0A350IHV0      --IVVSWVNAKRLAKAY-----CKKLNVSLS--G-------KE-STVLVLSLEDTFPRRA
A0A2A8CVM9      ----------------------TNEVMSHMM--QRVSFVPMQS-QSMIQFTVESGVPEEA
R5RVP0          --MRVSWVNSAKLAKAY-----CKGVTVALS--G-------KE-STVIVLTMKDRFPSRA
A0A2L2WX98      --VTVTRLPKKMAAASY-----CKQFSAGEY--DK------KE-SSLIILGCEDINETRA
A0A2E3R1D0      -------LTVQEVAFRL----QRGSIKSTME--T-------GG-ADAIRVNAVSTDPQEA
A0A800J826      -------VTLRSVGMLL----QGRYIRSQTA--G-------QD-TDAIRVTATSTNPGEA
A0A2T2USC0      --------TVSEIAGDLVSQGGKATMSASAA--GGNLAGQYES-ADAINISVKGVSASEA
A0A2T2V0F3      --------TVGEIAGDLVAQGGKATMSAAAA--GENLGNQYES-ADAIRISVRGVSASEA
A0A2T2S682      --------SRAVLAGLL-----RRRVRAQSA--G-------RE-VDAIRITAQGPVPAEA
A0A840DJZ8      --LDTTQLSPSSVAPAL-----AGRVRFSRA--G-------SE-ANVIQVVAQDKTPAVA
D5H561          --VDTTQLSPASVAPAL-----AGRVRFSRA--G-------AE-TNVIQIVAQDETPAVA
A0A2H3NWA9      --------SAQQLAGRL-----MGRVQASPG--G-------EE-IDAIRLSATSTDPQEA
A0A2A8CVB6      --------SQNQIAHRV-----RGSIRAGTY--G-------EQ-FDAIRIVATGRDAADV
A0A2P6C1S6      --------SISAVAGQV-----QNMISAQPS--G-------EE-TDALYISASSHHPNEA
A0A2T2UTM4      --------STAEVANQV-----KGMISAQPS--G-------EK-TDALYISAKSHHPYEV
R6A0L2          --IEVDRLSKEKAAARF-----LKMLSASEY--D-------KE-TSLIVLNCNDTNIERA
R7LG80          --ITVNRNSVSATADAL-----RKRMDVAQI--E-------KE-ASLIGLTFQDINPKRA
A0A7W5UEN4      --IQIHHLPIEMAAKIY-----QEKIKASAY--D-------KE-TSLVVLSAQDINTARA
G5GD56          --IQIHHLPIEMAAKIY-----QEKIKASAY--D-------KE-TSLVVLSAQDINTARA
R5KD55          --IDVRKSDNASATGRF-----LGGLSVEIG--D-------KK-STILDLSYNDVSGKRA
A0A174QNT3      --VLVTRSDLETVTNSM-----MERIQTSAM--D-------QK-STLVNIVYQDVNIARA
A0A4S2FGS1      --IRVTRSDLESATNAV-----MGRIQTSAM--D-------TK-STLVNIVCQDVNIARA
A0A7K3KG59      --IRVTRSDLESATNAV-----MARIQTSAL--A-------SQ-STLVNIICQDVNIARA
R9I0H0          --IRVTRSDLESATNAV-----MARIQTSAL--A-------SQ-STLVNIICQDVNIARA
K5BUT9          --ISVSRISPEIATNIY-----QSKIATSLA--G-------ER-TTLVQITCSDTNISRA
A0A174FPA3      --ISVSRISPEIATNIY-----QSKIATSLA--G-------ER-TTLVQITCSDTNISRA
R6S9Y6          --ISVSRISPEIATNIY-----QSKIATSLA--G-------ER-TTLVQITCSDTNISRA
A0A7J4YSB2      --ISVSRISPEIATNIY-----QSKIATSLA--G-------ER-TTLVQITCSDTNISRA
C9KX15          --ISVSRISPEIATNIY-----QSKIATSLA--G-------ER-TTLVQITCSDTNISRA
A0A6H0KRK1      --VSVTRISPETAAAIY-----KGGISTSLA--G-------KG-TTMVQITCTGDNISRA
R6DAG6          --VSVTRISPETAAAIY-----KGGISTSLA--G-------KG-TTMVQITCTGDNVSRA
A0A3L8AAP1      --VSVTRISPETAAAIY-----KGGISTSLA--G-------KG-TTMVQITCTGDNVSRA
A0A4S2AYX2      --VSVTRISPETAAAIY-----KGGISTSLA--G-------KG-TTMVQITCTGDNVSRA
A0A7J0A2L4      --VSVTRISPETAAAIY-----KGGISTSLA--G-------KG-TTMVQITCTGDNVSRA
A0A7K3MN31      --VSVTRISPETAAAIY-----KGGISTSLA--G-------KG-TTMVQITCTGDNVSRA
R6CQ93          --IHVSKIPLNAAAGRF-----LGSMGIRQE--E-------DE-SSILVLSLKDDSPLRA
A0A3D1NQW3      --IRVTKGNLGVVTQFY-----QHEVKSFVA--N-------KQ-ASIITISMKSSVPKKA
B0MT10          --IRVTKGNLGVVTQFY-----QHEVKSFVA--N-------KQ-ASIITISMKSSVPKKA
R7JGW9          --IRVTKGNLGVVTQFY-----QHEVKSFVA--N-------KQ-ASIITISMKSSVPKKA
A0A3D2BF46      --ISVSKQIVSSVASGY-----NKRIAIELV--E-------KQ-ANAISISLDDNIPRRA
A0A358R538      --VRVRKRSLGSATSAY-----RNAVKCDVA--N-------KQ-ASVVTVTMSNTVPRRA
A0A1Y4AAB8      --IQVAKSSLEAATSAY-----RAAVKCAVE--D-------KQ-TSVVGIAMNDAVPKRA
A0A1Y3WWY9      --IRVGKSSLKALTDTY-----RGAIKCDVA----------KQ-GSVVTISMSNSVAKRA
A0A1Y4U5L4      --IRVGKSSLKALTDAY-----RGAIKCDVA----------KQ-GSVVTISMSNSVAKRA
A0A1Y3VCJ1      --IRVSKGDLKTIANMY-----RGAVKCEVT--N-------QQ-ASVVTLSMNNAIPKRA
A0A1Y3QTW7      --ITVTKSSPMVTTNAY-----RATVKSDVA--N-------KQ-ASIVTISMNSSVPKRA
R6XWY7          --ITVTKSSPMVTTNAY-----RATVKSDVA--N-------KQ-ASIVTISMNSSVPKRA
A0A4Y1X9Y9      --ITVTKSSPMVTTNAY-----RATVKSDVA--N-------KQ-ASIVTISMNSSVPKRA
A0A4Y1WM66      --ITVTKSSPMVTTNAY-----RATVKSDVA--N-------KQ-ASIVTISMNSSVPKRA
A0A6N4GYT3      --ITVTKSSPMVTTNAY-----RATVKSDVA--N-------KQ-ASIVTISMNSSVPKRA
A0A174AVF1      --ITVTKSSPMVTTNAY-----RATVKSDVA--N-------KQ-ASIVTISMNSSVPKRA
A0A1Q6EIY0      --ITVIKNSLAATTNAY-----RAAVKSDVA--N-------KQ-ASIVTISMNNSVPRRA
A0A5B5VN71      --ITVIKNSLAATTNAY-----RAAVKSDVA--N-------KQ-ASIVTISMNNSVPRRA
E4M8L3          --ITVIKNSLAATTNAY-----RAAVKSDVA--N-------KQ-ASIVTISMNNSVPRRA
I3YQ50          --ITVIKNSLAATTNAY-----RAAVKSDVA--N-------KQ-ASIVTISMNNSVPRRA
R5UEY8          --ITVIKNSLAATTNAY-----RAAVKSDVA--N-------KQ-ASIVTISMNNSVPRRA
A0A1H4D866      --IRVVKNSLSRTTNAY-----RNAVKSDVA--N-------KQ-ASVVTISMNNSVPRRA
A0A5B3G4Y7      --IRVTKSSLGRTTNAY-----RAAVKSDVA--N-------KQ-ASVVTISMNNTVPRRA
A0A374A9J5      --IRVTKSSLGRTTNAY-----RAAVKSDVA--N-------KQ-ASVVTISMNNTVPRRA
A0A5B3GQN5      --IRVTKSSLGRTTNAY-----RAAVKSDVA--N-------KQ-ASVVTISMNNTVPRRA
A0A1Q6E9S3      --IRVTKSSLGRTTNAY-----RAAVKSDVA--N-------KQ-ASVVTISMNNTVPRRA
D4IJ36          --IRVTKSSLGRTTNAY-----RAAVKSDVA--N-------KQ-ASVVTISMNNTVPRRA
A0A414Q925      --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
A0A415PUS9      --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
A0A108TCU0      --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
A0A413BA42      --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
S3Y344          --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
A0A7J5LEW3      --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
A0A412TGL3      --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
A0A413VJ33      --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
A0A414L0W6      --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
A0A412DP39      --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
A0A413ZSE8      --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
B0NP84          --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
R6AK43          --VYVTKGNMKEVAESY-----NKALNVGVA--N-------KQ-SSLIALSIEDENVQRA
A0A412N2D9      --VYVAKGNLKEVAEEY-----NKALNAGVT--N-------KQ-SSLIALSIEDENVQRA
A0A1Y4JYS9      --VYVAKGNLKEVAEEY-----NKALNAGVT--N-------KQ-SSLIALSIEDENVQRA
R6LHA4          --VYVAKGNLKEVAEEY-----NKALNAGVT--N-------KQ-SSLIALSIEDENVQRA
A0A3E5HPT8      --IKVTSKSREGMVAFW-----LSNLTIRQM--S-------GD-AALLSMTMNDLSPTRA
C6IJ48          --IKVTSKSREGMVAFW-----LSNLTIRQM--S-------GD-AALLSMTMNDLSPTRA
Q8A3U2          --IKVTSKSREGMVAFW-----LSNLTIRQM--S-------GD-AALLSMTMNDLSPTRA
A0A3R6S1H6      --VTVTKYNLLQVAKAC-----NAGLRAYLA--D-------KK-ASIINLAIEDVSKARA
A0A3R6SD81      --VTVTKYNLLQVAKAC-----NAGLRAYLA--D-------KK-ASIINLAIEDVSKARA
A0A354WXN6      --ISINKRAASAVTNAY-----QAALNASLA--S-------KT-STIINLTLQDRSIPRA
A0A7G1HW11      --ITVNKRRLKDATTRY-----RRAVSVSLE--S-------KN-GGALNITMNDTDIKRA
R5IP14          --ITVNKRRLKDATTRY-----RRAVSVSLE--S-------KN-GGALNITMNDTDIKRA
A0A316SZX7      --IKISKNPVKAVAASY-----KGRMNVSLI--G-------KT-TSSVSITLQDPNPKRA
A0A1Y4AIY1      --VHVRKSNLKGIATGY-----QNALVSELV--A-------EY-ATIIKLSLSDVSASRA
A0A0J6CIR2      --VTISKRNREEIALTY-----SNSLQVALA--S-------KT-ATIINLTLQDVSIPRA
A0A3D8HG59      --VRVTKSDLDETVLHF-----NRILQVALA--S-------KT-ATIINLTLQDESIQRA
A0A3R6S408      --VRVTKSDLDETVLHF-----NRILQVALA--S-------KT-ATIINLTLQDESIQRA
F3ZRU7          --IQIHHRGLKNVTLGY-----GNAIQIALA--D-------KK-ATIINLSLRDEVPQRA
A0A1C5Q1F3      --VTVNKMNLEKVGMAY-----NAALQSMVA--S-------KT-SSIIHLSISDVSPRRA
R7A239          --VTVNKMNLEKVGMAY-----NAALQSMVA--S-------KT-SSIIHLSISDVSPRRA
A0A3R6HIK7      --IQVTKSRLKSVAKRY-----QSALQSTLA--D-------KM-STIINLSLSDVSIARA
K5ZVW7          --IQVTKSRLKSVAKRY-----QSALQSTLA--D-------KM-STIINLSLSDVSIARA
A0A1Y4D5Z0      --ITVRKSNLSNVARAY-----LNKLQSTVA--S-------KT-ATIINLSLSDVSISRA
A0A413VXJ7      --ISVTKSNMERVVDAY-----QSSMEVSLA--S-------KT-ATIINLTLKDVSIARA
I9RSN9          --ISVTKSNMERVVDAY-----QSSMEVSLA--S-------KT-ATIINLTLKDVSIARA
U6RJK5          --ISVTKSNMERVVDAY-----QSSMEVSLA--S-------KT-ATIINLTLKDVSIARA
A0A1Q6GA32      --ISVTKSNMERVVDAY-----QSSMEVSLA--S-------KT-ATIINLTLKDVSIARA
I9RPU6          --VNVVKSNLESVIEGY-----RGRLKVSLA--S-------KT-ATIINLVLDDVSTARA
I8YFS5          --VFVTKANMEKVVEGY-----QSKMKISLA--S-------KT-ATIINLVLDDVSTARA
A0A7J4XCM0      --VYITKSNMEKVVEGY-----LRRINISLA--S-------KT-ATIINLVLDDVSTARA
I8Y597          --VYITKSNMEKVVEGY-----LRRINISLA--S-------KT-ATIINLVLDDVSTARA
A0A1Q6GBF5      --VHVTKSNMESVVENY-----RNRLKVSLA--S-------KT-ATIINLVLDDVSTARA
I8YFZ3          --VNVVKFNMESVVESY-----RNKLKVSLA--S-------KT-ATIINLVLDDVSIARA
A0A7J4XFW0      --VSVVKSNLESVIEGY-----RTRLKVSLA--S-------KT-ATIINLVLDDVSTARA
A0A1Q6GDH2      --VNVVKSNLESVIEGY-----RGRLKVSLA--S-------KT-ATIINLVLDDVSTARA
U6RSB0          --VNVIKSNLESVIEGY-----RARLKVSLA--S-------KT-ATIINLVLDDVSTARA
I9GXM2          --VNVVKSNLESVIEGY-----RGRLKVSLA--G-------KT-TTIINLVLDDVSTARA
I9SIK1          --VNVVKSNLEGVIEGY-----RGRLKVSLA--G-------KT-TTIINLVLDDVSTARA
A0A7J4XIJ5      --VNVVKSNLEGVIEGY-----RGRLKVSLA--G-------KT-TTIINLVLEDVSTARA
I9TP59          --VNVVKSNLEGVIEGY-----RGKLKVSLA--G-------KT-TTIINLVLEDVSTARA
R5S343          --VMIEKNIVSDVVDAY-----RERMRIELA--D-------KS-TTIIYLTLQDVSVARA
A0A1M6K7I9      --ILVQKFVTERVVDDC-----MATLSVSLA--S-------KM-ATIIDLEYKDESIARA
A0A5M6A8C8      --IQVQKSVTERVVDDC-----MTTLSVSLA--S-------KM-ATIIDLEYKDESIARA
A0A7J4XCJ1      --IYVVKSNMEKVVEGY-----QNRIKISLA--S-------KT-ATIINLVLDDVSTARS
A0A7J4XNQ7      --IYVTKSNMEKVVEKY-----LNEINISLA--S-------KT-ATIINLVLKDVSTARA
A0A3R5ZMK1      --VQVTKSPLQDVALRF-----QGGLQATLA--S-------KT-ATIINLTLQDVSIPRA
A0A7K1HMX0      --VQVTKSPLQNVAIGF-----QANLQATLA--S-------KT-ATIINLTLQDVSIPRA
A0A1Y3ZIA4      --VQVTKSPLQNVALRF-----QSGLQATLA--S-------KT-ATIINLTLQDVSIPRA
K5Y1A4          --VQVTKSPLQNVALRF-----QSGLQATLA--S-------KT-ATIINLTLQDVSIPRA
A0A7K1HDC0      --VQVTKSPLQDVALRF-----QGGLQATLA--S-------KT-ATIINLTLQDVSIPRA
A0A3R6K8X4      --VQVTKSPLQDVALRF-----QGGLQATLA--N-------KA-STIINLTLQDVSIPRA
A0A6N8D6C8      --VQVTKSPLQDVALRF-----QGGLQATLA--N-------KA-STIINLTLQDVSIPRA
A0A3R6BKI7      --VQVTKSPLQDVALRF-----QGGLQATLA--N-------KA-STIINLTLQDVSIPRA
A0A412M2W1      --VQVTKSPLQDVALRF-----QGGLQATLA--S-------KT-ATIINLTLQDVSIPRA
K5ZX55          --VQVTKSPLQDVALRF-----QGGLQATLA--S-------KT-ATIINLTLQDVSIPRA
A0A415BDM7      --VQVTKSPLQDVALRF-----QGGLQATLA--N-------KA-STIINLTLQDVSIPRA
A0A1Q6I3T6      --VQVTKSPLQDVALRF-----QGGLQATLA--N-------KA-STIINLTLQDVSIPRA
A0A414XX40      --VQVTKSPLQDVALRF-----QGGLQATLA--N-------KA-STIINLTLQDVSIPRA
A7AEU7          --VQVTKSPLQDVALRF-----QGGLQATLA--N-------KA-STIINLTLQDVSIPRA
A0A5F0U645      --ITVSKSNQDRVALDY-----NESLQVVLA--S-------KT-ATILNLSLQDVSASRA
K5ZBN2          --ITVSKSNQDRVALDY-----NESLQVVLA--S-------KT-ATILNLSLQDVSASRA
A0A0J6CKW3      --ITVSKSNQDRVALDY-----NESLQVVLA--S-------KT-ATILNLSLQDVSASRA
A0A0F5IQM7      --ITVSKSNQDRVALDY-----NESLQVVLA--S-------KT-ATILNLSLQDVSASRA
A0A496CDT3      --ITVSKSNQDRVALDY-----NESLQVVLA--S-------KT-ATILNLSLQDVSASRA
A0A6G1ZKM3      --ITVSKSNQDRVALDY-----NESLQVVLA--S-------KT-ATILNLSLQDVSASRA
S0GLB0          --ITVSKSNQDRVALDY-----NESLQVVLA--S-------KT-ATILNLSLQDVSASRA
A0A3R6NLC1      --ITVTKSSRDWVALNY-----NEALQVALA--S-------KT-ATILNLSLQDASVSRA
A0A416WYC9      --ITVTKSSRDRVALNY-----NEALQVALA--S-------KT-ATILNLSLQDASVSRA
A0A7W7AX81      --ITVTKSSRDRVALNY-----NEALQVALA--S-------KT-ATILNLSLQDASVSRA
A0A0F5IT40      --VTISKRNREEIALTY-----SNSLQVALA--S-------KT-ATIINLTLQDVSIPRA
A0A496CX20      --VTISKRNREEIALTY-----SNSLQVALA--S-------KT-ATIINLTLQDVSIPRA
A0A5F0UBI0      --VTISKRNREEIALTY-----SNSLQVALA--S-------KT-ATIINLTLQDVSIPRA
A0A6G1ZHG0      --VTISKRNREEIALTY-----SNSLQVALA--S-------KT-ATIINLTLQDVSIPRA
S0GSI7          --VTISKRNREEIALTY-----SNSLQVALA--S-------KT-ATIINLTLQDVSIPRA
K5YB65          --VTISKRNREEIALTY-----SNSLQVALA--S-------KT-ATIINLTLQDVSIPRA
A0A0F5IWP9      --VAVVKKNRVDVALGY-----SNTLQVALA--S-------KT-ATIINLTLQDVSIPRA
A0A0F5IZT8      --VAVVKKNRVDVALGY-----SNTLQVALA--S-------KT-AAIINLTLQDVSIPRA
A0A417LKQ2      --VAVGKKNREDVTLSY-----SNALQVALA--S-------KT-ATIINLTLQDVSIPRA
A0A416TME1      --VVVGKKNREDVALNY-----SNALQVVLA--S-------KT-ATIINLTLQDVSIPRA
A0A7W7F3X3      --VVVGKKNREDVALNY-----SNALQVVLA--S-------KT-ATIINLTLQDVSIPRA
A0A416XPE8      --VVVGKKNREDVALNY-----SNALQVVLA--S-------KT-ATIINLTLQDVSIPRA
A0A3B0C2S4      -QFRVVLKSVKDAVFAL-----SEKLQVQPT--D-------KR-SEVLSLSIKGQSPERS
A0A5M8NYX7      -VVVVR-------HPKY-----IPYIQVNPL--N-------KM-TTVVDVTTKTEVPQKG
A0A1M6GR99      --FAFKLSTIKQLVSHY-----EQKLEFNIP--D-------RL-GTFIEISMKTNSVQLG
A0A7C5M4P4      -YFRIN--SHDALINYL-----EKNLRVEPV--N-------LD-ANIFRISFRDHNQGKA
A0A1W2GF52      -YFVLN--SKESLINYL-----ESHVTVEPI--N-------FN-ANTIKISLSDFNQTKA
A0A2G5L7B8      -YFVIN--SREALIDYF-----QQNIIVEPI--N-------FN-ANTIKIALADPNKYKA
A0A2D8JJW3      -NYTFKDGDIRAAVERL-----QESLNINHV--K--------E-TSHLVITVESLDSKEA
A0A6B5PK86      -YFTFN--STQSLSERF-----IRNLYVLPI--D-------ER-ARTVSIAFKGDNSKLC
A0A2G2F510      -YFTFN--SIESVTERL-----RKGLKVVPV--E-------VG-AKTISISYRGYTPQLC
A0A316JZ08      -YFTFN--SRQGLVERL-----HGGLDVIPM--D-------PN-ARTIQVSFKGHNARMC
A0A2W1NDY9      -FFKIN--NYKTLTNVL-----IHSLIVNIE--N-------AD-ANTIKVSFRSNNNVLA
A0A5C8AQR5      -YFVFN--ERKALIDRL-----LPGLIIVPI--N-------LE-AKTIEISYQAYNPVLC
A0A1G0CI31      -YFTFN--NKKTLVTRL-----LPNLEITPA--D-------IE-AKTILIRYQGYNAELC
A0A556N0M0      -YFTFN--NQKTLASRL-----ITNLEVNPI--D-------IN-AKTIELRYSGNNPDLC
F2IKD6          -YFTFN--NQKNLAARL-----ISNLEVNPV--D-------AN-AKTIELRYTGNNPELC
A0A1I7BM74      -YFVFN--NTQSLMARL-----HGDLTIAPL--D-------VK-AKSILISYRSNNAHLS
A0A2G2FJ17      -YFHFN--SEDNLASKY-----LSGLAVSPV--D-------IQ-AKTIEISYRNTNANLA
A0A1H4ADG3      -KMDVS--SINAVADGF-----KENINAEIS--D-------KQ-TSIINLSLNTTIPEQG
A0A5B8VUR8      -KMAVA--SINAVADSY-----KENINADIS--D-------KQ-TGIINLSLNTTIPQQG
A0A1V5IPN7      ---------------------------------S-------KRDTDILNLSFESTNRGEA
A0A7G7G5F9      -EVKFN--NLTKLANSY-----NSKLEVAPI--T-------KE-TNVLSITLTDAVPEKG
A0A2N3U785      -LVEFK--DYRRVANYY-----RNALSIYPI--N-------KE-TKVIAIELTEPVPEKG
A0A0D3L8Q3      -RVHFN--NIQRLASNY-----SDRLVVEKD--K-------LAWSSALILSLVDPVPEKG
A0A519U664      -IVRFN--DIHQVAAHY-----SQAIGIQPV--G-------KS-SNVLTLSLVDPIPEKA
A0A519MA34      -IVRFN--DIHQIAAHY-----SQAIGIQPV--G-------KS-SNVLALSLVDPIPEKA
A0A519UCX0      -IVQFN--DIHQVAVHY-----SQAISVQSV--G-------KS-SNVLNLTLIDPIPEKA
A0A5B6TJH8      -KVQFQ--NIQEVASRY-----HNAIEVMQA--G-------KTWTNVIKLELTDSKPERA
A0A7Y0AA98      -IVRFQ--NIKQIADYY-----NHALGVQPV--N-------KN-ASILLLSLTDPIPAKA
A0A0E3ZG78      -TVKFK--NVQQLAEHY-----SQAIQIGPV--N-------KS-ASVLWVGLTDPIPEKA
A0A1I6BRK6      -IVYFQ--DIYQVANHY-----SQAINIKPV--G-------KT-TNVLNISLIDPMPERA
A0A243WAB1      -IVSFQ--DIHQVADHY-----NKAIAVQPV--G-------KS-ASVLSLSLVDPIPEKA
A0A6G8C8X6      -IVHFQ--DIKQVAAHY-----NKAIVVQPV--S-------DG-ASVLSLSIVDPIPEKA
A0A4R5DL69      -SIKIS--GFESTVSEY-----SRRLSISAT--N-------KQ-VSIISLRLTDILPRKG
A0A1M4YED3      -KLFLY--NPESLASSY-----ANRVSIPPN--P-------KS-STVLTLYFQDESAYRA
A0A7T9DAA2      -FFFIN--SLEGLVDSY-----GQRLGTESM--G-------EK-SNIVVLSIVGEAITKE
A0A7Y5V8S3      -YFYIN--SLDGLTKLY-----KGITFAEPA--S-------DN-SNIVQLSVVGEVVSKG
A0A126PFG0      -RIVAR--DPDLVVTAY-----QKALEVDLI--N-------KI-SPAISLQIKDEVPQRG
A0A7V5VRT5      -LIYWY--PQQQVVQSW-----QMRISV-LP--K-------RG-LTTWLVSVTDVSSLRA
A0A3M1N7Z3      -EVVVF--APQATTFAW-----QRRVSV-IP--K-------RG-TTILQVSVTDISPVRA
A0A7V1R2A1      -EVVVF--APQATAFAW-----QRRVSV-IL--K-------RG-TTILQVSVTDISPVRA
A6EBM4          -LFRFN--TPEDFLDRI-----REGLRIGEA--G-------KN-SNILSLQQTDVNPRFA
A0A7X8C760      -YFRFR--TRESLIADF-----KSRLSSKYV--I-------EG-SSVLEISLSSETPERD
A0A501VZX6      -YFSLI--RPKKIVESL-----EKNIKIEAE--N-------KL-STVVNFTLYDQIPARG
A0A399SH26      -YFQLL--PLKAVTASL-----LNNLQVNAA--N-------KL-STVVNLQLKDAVPERG
A0A501W1A9      -FFSIK--DPRKAARQL-----ASSIQIETP--G-------KL-SSVVNLYIEDQTPERG
A0A0E3ZGV6      -YFSII--SPTRAANQL-----SGSIFIESA--G-------KL-SSVVNLYLEDKVPERG
A0A1I2N4S1      -FFSIN--NPKAVAKQL-----ISRIYVESP--G-------KA-SSVVNLYIEDNVPERG
A0A2T5YE44      -FFSIN--NPKAVAKQL-----ISRIYVESP--G-------KA-SSVVNLYIEDNVPERG
A0A4Q8RX32      -FFDVK--GKTQLVGEL-----KEQLTIEPA--N-------VD-GTVVNVLLKSNNARMG
A0A1M6TTV4      -YFIIN--SEDALINYF-----QKNIVVEPI--N-------FN-ANTIKIALSDPNKYKA
K0X1U5          -VAHVN--GYDGEAEIL-----EKRLDIDLS--D-------KK-ANGISLKIRESNKQRG
R5EXK3          -VAHVN--GYDGEAEIL-----EKRLDIDLS--D-------KK-ANCISLKIRESNKQRG
A0A401UAP7      -SFMLN--DAQALRAYF-----TERLMVTPK--N-------YN-ANTIRISFKEFSAEKA
A0A523GAC0      -SFKIN--SQNSLLLYL-----ENNITVEPL--N-------LT-ANTIRISFRDHNRYKA
L8JW09          -FFIIN--SKAAQIKYL-----GSNLTVEPL--N-------LN-ANTIRIAFKDYNPLKA
A0A364XUP5      -FFIIN--SRDVLMNYL-----IANLTVEPL--N-------FY-AKTIRVAFKDNNPSKA
A0A1M5RLA9      -FFVLN--TRDALLGYL-----LRSLTAEPL--N-------YN-AHTLRISFKDNNPTKA
A0A385SFR9      -FFVLN--TRDALLGYL-----LRNLTAEPL--N-------FN-ANTLRISFKDNNPSKA
A0A5M4A9J4      -RFRFN--THGALVDYF-----RHSLTVATV--N-------KD-ATLLNLKMESATPSKS
A0A5M4B1C7      -RFSFH--NHNGLVNVF-----RKNLTIETV--N-------KD-ATLLKLSMLSPTPQKD
A0A0D3LFR6      -YFIIN--SDQSLIDYL-----STNLTVTIL--N-------PN-AKTIKISLTDYNPYKA
M7N6D4          -YFIIN--SDNALINYF-----RQNLSVSIL--N-------PS-AKTIKISLSDHNPFKA
A0A5C7MX19      -YVRKY--DKSFVIADV-----INKVSIEPL--D-------FK-TKSFKISYKDKSAVKT
A0A1M5BA90      -YFSLN--NPKMVLNSL-----VTNLRVIAA--S-------KL-STVIDLAIMDEVPERG
A0A512B879      -YFSLV--PPKQALNSL-----ILNLNVSPI--N-------KL-SSVIHLTIKDEVTQRG
A0A559PPI3      -YFILI--NPRSVTQSL-----LKSLEVAPP--E-------KL-STVINLYLQDAVPNRG
A0A1T5CS78      -FFYLL--NPKIISTSL-----LDELDISTS--N-------KL-SSVVNLSIKDEVPERA
A0A0Q9Z8F1      -FFYLL--NPKMISSEL-----IDELDISTS--N-------KL-SSVVNLTIRDAVPERA
A0A2N0U0M7      -FFYLL--NPKMISSEL-----IDELDISTS--N-------KL-SSVVNLTIRDAVPERA
A0A1Q3ZMZ7      -YFIIQ--DPGLLTRQM-----MSSLKIIPL--N-------PE-AQTIEIKFESHNANLS
A0A7Y3KMD1      -YFVIN--DSVNLADEF-----YPLITVTLL--N-------PE-AKTIKISCRNVVDRVA
A0A3C1ITV0      -IVGYE--RPELTAKSC-----QARLTAELA--D-------KL-ATVINFSYTDASEKRA
R7HN19          -IVGYE--RPELTAKSC-----QARLTAELA--D-------KL-ATVINFSYTDASEKRA
A0A2W2AFF7      -RVDVQ--STDEAVEDY-----RKALTANVV--N-------KQ-VTLINLSLQSNIPHQG
A0A845PZ37      -KVFKS--PQRVIVDYF-----KNNLKIRQL--E-------ED-ASLLQITLQDSSPERA
A0A077ENE7      -QVAKS--PREAVMSNF-----VGNLSIKQM--E-------EE-ASLMQVTMTDDSSERA
A0A854FRG7      -QVTKY--PREAMMENF-----KGKMKIAQM--D-------ED-ASLLQITMEDQSPERA
T0NN57          -QVTKY--PREAMMENF-----KGKMKIAQM--D-------ED-ASLLQITMEDQSPERA
R7PCR1          -SITRI--SVKDAAKIY-----VKRISATPV--D-------KQ-SSLIQLVCQDVNKKRA
A0A2N5YXE2      -FFTIN--NTKTVLTNI-----ASNLEIQVL--N-------EN-AGTILITYNDYNARKS
A0A2U1FKU2      -YVVKE--DMRKVVERY-----NQELQVALA--D-------KK-STIVRLSLNNTDLDRA
A0A0A2F954      -YVKKE--NTRKVAERY-----NQDLQVSLA--D-------KK-ATIVNLSLKNEDLDRA
A0A0A2FW91      -YVTKE--NTRKVVERY-----NQDLQVSLA--D-------KK-ATIVNLSLKNEDLDRA
A0A2D2N2N1      -YVTKE--NTRKVVERY-----NQDLQVSLA--D-------KK-ATIVNLSLKNEDLDRA
Q7MWZ2          -YVTKE--NTRKVVERY-----NQDLQVSLA--D-------KK-ATIVNLSLKNEDLDRA
A0A212FSE5      -YVTKE--NTRKVVERY-----NQDLQVSLA--D-------KK-ATIVNLSLKNEDLDRA
T2NDT6          -YVTKE--NTRKVVERY-----NQDLQVSLA--D-------KK-ATIVNLSLKNEDLDRA
A0A1R4AFZ0      -YVTKE--NTRKVVERY-----NQDLQVSLA--D-------KK-ATIVNLSLKNEDLDRA
A0A1R4DVZ7      -YVTKE--NTRKVVERY-----NQDLQVSLA--D-------KK-ATIVNLSLKNEDLDRA
A0A1V9FHD0      -YFDLY--KTKNLAPTI-----SLNLVVTSE--N-------KL-SSTMDLTYSDAVPQRG
A0A4V4H170      -FFRLY--KPKNIAPGF-----ISNLGVKSA--S-------KL-STTINLTFRDEVPERG
A0A1V9F098      -FFRLS--KPKNVAPGY-----IASLEVKSS--S-------KL-SSTINLTFRDEVRDRG
A0A4R2VU64      -YFQLI--KPKNVAPGI-----IASLDAKPA--S-------KL-SSTINLTFRDEVPQRG
A0A0K8QSK7      -AIEFN--TVQQTGKLY-----ASRLTVAQS--N-------RQ-TSILTLTVQDHNSAKG
A0A7C0WKI7      -------------VARI-----RRNLSISPV----------RD-TDIIKIKMKAPSGWEA
A0A1T5K9D4      -YIQKI--PVSQAAAAY-----SSALSISQN--N-------SA-ETVLNLSIQDFSLQRA
A0A5M4B212      -RIAFH--SLDQLTNEY-----MEKLTVAPV--S-------KE-GTMIKLSTTCENPEKG
A0A3D1KEX9      -HVTRI--KKEDAITKF-----NKAVTASEV--N-------KE-ASLISLTCKDNNKDRA
A0A358Y7S2      -YFEFI--QREKLIEEI-----KEKLTVIAV--N-------PE-AKTIEITYENSNAKLS
A0A2J6HHN3      -IVVFN--NIDNLVYKY-----SRKINISVV--S-------DA-AKTIRISLRDINASKA
A0A1Y3WMT8      -VAHIN--GYDTQTELL-----EKRLEIDLS--D-------KK-ANGISLKIKDSNRKRG
A0A1Y4GQU1      -VAHIN--GYDVQTELL-----SKRLEIDLS--D-------KK-ANGISLKIEDSNRRRG
A0A6A0R272      -VIKVV--DKVKLAQEF-----AKQLTVTQV--E-------EK-VALLSIVYQSSNPLLC
A0A1V5W8T5      -YFRIL--DDKGAFAEH-----ITGLDVSIL--N-------FD-AKTIRIYYTSNNAQKT
A0A2T8HKA9      -TVTKI--PRETMVSYF-----LSRMKIVQI--E-------DD-AGLLQLTLEDHSPKRA
A0A1X7J248      -TFTIS--TPESLMSYV-----ESNLSVAPE--N-------LN-ANTIKITFEDYNPYKV
E4TQD2          -FFTIS--TPESLINYV-----ESNLSVAPE--N-------LN-ANTIKITFEDYNPYKV
A0A2I0QZ80      -YFVFN--DLNTVSSRF-----HDDLSIRPI--D-------QK-AKTVEISYRSHSPTFA
A0A3E1F1A3      -YIVLN--EDKVLANNL-----HSGLSVSLV--D-------NN-AKTVEVAYRSSSPQLA
A0A2U2XBJ3      -YFELN--DKSTMSRRL-----RPGLTVTPV--D-------AN-ARTVQISFRSHSPLLA
A0A4Q4KU94      -YFVLN--EKKSIARQL-----RSGLTVTPV--D-------PN-ARTVELSFRSHSPTLA
A0A3B8INU3      -YFVIN--SNGALLNYI-----GAHLAVTPL--N-------LN-ANTIRVSFQEYNRQKA
A0A7V6V2N8      -CIIIH--DLPSLIKQY-----RYQLSTNIL--N-------PN-AGSIELSFSDQNPLKC
A0A414ZBF2      -YVKKG--NRKNVSDNY-----NANLQVEVV--D-------K--SSLINLTIEDENIGRA
A0A7X9D3Q8      -QISKR--SLKAVSDSY-----NARLKVDVD--N-------KM-SSIINLTLEDVNIKRA
A0A1Q3Q573      -FVKFN--DKQTIINDI-----NSKITIEPI--E-------AG-NNTLAITYADQNPEKA
A0A662BAY3      -KFRFN--IRSDLLKQY-----KNDLSVNML--S-------QE-TSIIELSLKTLNVAKG
A0A4U3L369      -FFQIT--SYDNATAAY-----QKNLVITVP--D-------DK-ANVIDLSMTSKVPSKG
A0A4S8HY23      -FFRLY--KPKNRAPAI-----ISNLQVKSS--S-------KL-STTINLTLRDEVPERG
A0A1V9F383      -FFELN--KPKDVAPGI-----LLNLQVNSP--N-------KL-STTIDLTLRDPIPRRA
G8TRZ6          -FFNLN--KTKDVVPGL-----LLNLLVVSP--N-------KL-SSTIDLTLRDEIPKRG
A0A357YNR3      -EIDIY--RPADVANMY-----LGNLTVELT--S-------KT-SSVADVSLICSNVALG
A0A7X6YKE8      -EIDIY--RPADVANMY-----LGNLTVELT--S-------KT-SSVADVSLICSNVALG
A0A5E8AX52      -YFTIN--SESALISFF-----QSNVTVQPL--N-------FS-AKTIKISLRDFNKYKA
A0A1V6CN82      -FFRFH--TPDELINAY-----RSRMTVSLR--D-------WE-TSIVDIDLKDYHPQKA
A0A1M4XZ45      -KFRFN--TKKSLVDKY-----RKSLEVTLS--G-------KE-TSILNLTLRDYNVSKG
A0A399D319      -KFRFN--SKKALLKRY-----REQLDVTLN--D-------KE-TSILNLTLRDFNVKKG
A0A7Y1YS85      -MVSVW--PAEDIAAYY-----KSKLLIEIVGAQ-------NS-SSILELKLTDQTPEKA
F4KK08          -KVQKD--NFNAVVRNY-----MKALQVSLQ--Q-------KD-ASVIKLTIQAGNPLLA
A0A7V5VE02      ---------FDDMVQEL-----MENRLTVTP--I-------RN-TDMIEIKVTAVSPEEA
A0A496LCF9      -NFQFR--TRQSLISEF-----FAKLQIRLI--E--------N-TSVLDVSVNSDNPARD
A0A5P2G2A9      -TFVIN--PIKSEVQGI-----LQNLSAEIP--N-------KQ-VSAINLTLPVEIPSKG
A0A3C0ZQC7      ----LL--TASEIAKRL-----MTAVEFEPI----------RD-SDVIKVTARSVQPKEA
A0A3N2N6F7      -RFSYW--PMPTAISKY-----QAKLTETLS--N-------ED-ASVIDFAIKDDNVQRG
A0A419VXB7      -YFEFN--DLEKLTLSY-----LRQLQVSTV--N-------KD-ADVISLQLTGQNPDQK
A0A1Q6E6I7      -RIYVR--PVRNAAEAY-----AKALHVAQA--Q-------KF-SNIVNVSISDHNPQKA
A0A3B9CNN6      -RIYVR--PVRNAAEAY-----AKALHVAQA--Q-------KF-SNIVNVSISDHNPQKA
R5X290          -RIYVR--PVRNAAEAY-----AKALHVAQA--Q-------KF-SNIVNVSISDHNPQKA
C3J7R8          -EVEKN--TRERSIRSF-----SHIFNVSSA--S-------KQ-GSIITLTMQHQNPEVA
A0A1G8BVM8      -IISKI--NKMNLAKSL-----VAKFNIESV--D-------KQ-SSLVQLSIIDTHPQRA
A0A1I1FXP9      -FFTIN--SRNKLLMQM-----FFNTSAYIL--N-------QS-ANTIRIIIKDHHPQKA
A0A4P7VVU7      -KIFRY--SISDAIEAY-----KARLSENLA--D-------DN-STVIDFTIKDVSIQRA
A0A2V1ILM4      -KIFRY--SISDAIEAY-----KARLSENLA--D-------DN-STVIDFTFKDVSIQRA
A0A3N2L0E8      -KIFRY--SISDAIEAY-----KARLSENLA--D-------DN-STVIDFTIKDVSIQRA
A0A3N2LFC5      -KIFRY--SISDAIEAY-----KARLSENLA--D-------DN-STVIDFTIKDVSIQRA
A0A7K3KWJ8      -KIFRY--SISDAIEAY-----KARLSENLA--D-------DN-STVIDFTIKDVSIQRA
A0A3N4H5N3      -VLNFV--NPVLITEQF-----SKSLTLEQP--S-------IK-SSTIYLTMLNTSPARG
A0A2P8EAX2      -VVRLE--NPIVKTERY-----AKALNFEQS--S-------VK-SSTLFIRLLDSSPTRG
A0A4V2F6N9      -VVILE--NPIVKTERY-----AKALKFEQS--S-------VK-SSTLFIRLLDSSPTRG
A0A838T9G8      -FFVIN--TRSSLYSQI-----RSALQVAPN--D-------P----TIGILMRNRKPQKA
A0A3B9FXJ0      -ELIIR--NKLTVAKAM-----EKRIRIDAE--N-------TY-GGKIVIEYTDVNDQRA
A0A848SUJ0      -FFKFN--DRNKLIGEY-----TSRVEVLPL--I-------QN-TKTVQILLKDQNKQKA
A0A847ALW2      -KFRFN--SQKALIKKY-----RTNLEASLL--S-------KE-TSIIMLTLHEHDIQKG
B2RKZ8          -YVTKE--NIRKVIQRY-----NKDLQISLA--D-------KN-ATIVNLSMKNEDMDCA
A0A0K2J6Z0      -YVTKE--NIRKVIQRY-----NKDLQISLA--D-------KN-ATIVNLSMKNEDMDCA
A0A212GC82      -YVTKE--NIRKVIQRY-----NKDLQISLA--D-------KN-ATIVNLSMKNEDMDCA
A0A0E2M2Y7      -YVTKE--NIRKVIQRY-----NKDLQISLA--D-------KN-ATIVNLSMKNEDMDCA
A0A829KSZ7      -YVTKE--NIRKVIQRY-----NKDLQISLA--D-------KN-ATIVNLSMKNEDMDCA
R5GSU5          -TVSRL--PVFTATEMY-----RSKLSCGEI--D-------KE-SSLIVLTFQDTNKKRA
A0A7X8I6A2      -FFQIT--NPREIEDEI-----LENLSVRIL--S-------QQ-TQTIEISYSSNNALQA
A0A0A2G557      -EIIVN--SKEKTVADL-----SKKLTISQS--G-------KQ-SSVIDLRFKDENTDFA
A0A1T4PT95      -KITIS--SREEIISDL-----AKRLTIAQS--S-------KG-SSIIDLRFRDENPHLA
A0A6I6JYY3      -KFVFN--KKSALVKKY-----TKALTVNLA--D-------KE-TSIVGLTLRDLNQEKG
A0A651GU15      -YFVIN--NPNSLVSRF-----RSNMEVRVM--N-------NI-AQTIQISCKNHNATLA
A1ZKR2          -YFKIN--SRQALISYL-----NNNLQVGIL--N-------KS-ARIIGINFRDHHPQKA
A0A1Q3GX01      -YFKLN--SRQTLIDYL-----NKNLQVGIL--N-------RS-ARIIGVNFRDYNPLKA
A0A349DQI4      -YFKLN--SRESLIRYL-----NTNLQVGIL--N-------RS-ARIIGVNFRDFNPLKA
A0A4P5TMD1      -YFVIN--SRDNLSKDI-----RTKIRIELY--P-------P----TIQFSLQDPVPLKA
A0A3Q9FR88      -SFQFN--SKSSITNFI-----RKNISVLIF--D-------PK-ANTIQISFKAANREKA
A0A553GEX3      -SFQFN--SKSSITKFI-----KKNISVLIF--D-------PK-ANTIQISFKAANREKA
A0A150ADJ9      -SFVVN--SRPSLVKFL-----KKNISVQVF--N-------PK-ANTIQISFTAGNREKA
A0A7X9P1P7      -SFVVN--SRSSLVSFL-----RQNISVQVF--N-------PK-ANTIQISFTAGNREKA
A0A7X8SM94      -SFKFN--SRSEIISFL-----RKNLSVMIF--D-------PR-AKTIQISFTAGNQQKA
A0A1S1Z228      -SFTFN--SKSRIIGFL-----KANLSVMIY--D-------PR-AKTIQISFTARNRKKA
A0A1B1FWQ4      -SFTFN--SKASIIGFL-----KRNLSVMIY--D-------PK-AKTIQISFTARNRKKA
A0A7X9Y5D2      -SFTFN--SKASIIGFL-----KRNLSVMIY--D-------PK-AKTIQISFTARNRKKA
A0A7X8ISG0      -YIVVP--DTVSKNKKY-----IRSLSVVPD--P-------EE-SGSFTITLKHTCPNKA
A0A2N3IIZ0      -YFVLN--SKGKSMNYL-----ANNLEAFIL--N-------PQ-AKIIAISFKDHNATKA
A0A7X8Q7Q7      -ILQFN--NIDQLSLVY-----SKKINITVV--N-------DI-AKTISISLKDNNPQKA
A0A2N2WFW8      -LIVFN--SVKDLANSY-----SQKINIAVL--N-------DV-AKTIRISIRDMNPRKA
A0A1F3IU95      -IVQFN--NLTDIAAQY-----SQQVNIAVI--N-------DV-AKTIRISLKDYNPRKA
A0A3D0VUF6      -IVQFN--NLTDIAAQY-----SQQVNIAVI--N-------DV-AKTIRISLKDYNPRKA
A0A7K3WUF2      -YFKLN--RAGTLASSY-----IRQMGIKIL--N-------ST-AQTIEISLKDNNPGIA
A0A497D5Z2      -FFRFR--TNESLADQY-----KKNLTIENV--P-------KE-SSILEISLLEENEQKG
A0A662B170      -FFRFR--TNESLADQY-----KKNLTIENV--P-------KE-SSILEISLLEENEQKG
A0A7X7FWB7      -FVVIP--DSISKNNRY-----IRSLNVVPD--P-------EE-SGSFTITLQHTCPAKA
A0A7X8DM61      -YIVVP--DSISKNRKY-----RNNLNVSSD--P-------DE-SGSITISLKHTCPQKA
A0A3M1CDV2      -FIIIQ--SKDAVASYL-----QKKLEVKPL--N-------DL-AQTISISIKDVNPQKT
A0A1F3SJM1      -YFIFN--SVQSVAERM-----RNGVTITPI--D-------VA-AKTISISFRGHNAQLC
A0A2G2EB96      -FFIFN--GREQLSNRL-----IQDLSVSSI--D-------PY-AKTISISFRGYNAVLC
A0A2G6PRA9      -FFIFN--GREQLSNRL-----IKDLSVAAI--D-------PN-AKTISISFRGHNATLC
A0A7Y7A9N2      -FFIFN--GREQLSNRL-----IKDLSVAAI--D-------PN-AKTISISFRGHNATLC
A0A6C1QGZ7      -FFVLN--NPETLASVY-----SRDIKINVL--N-------PA-AKTIQINYQGTNAAKA
A0A7W1EH85      -YFTVS--DGDAVTAQL-----QAKLEVKLI--N-------ES-AKTMLLKVSDVNSEKS
A0A2E3XZI5      -YFIIP--TIKQIKKEL-----LGGLEVNII--D-------RS-AHTINIIHKHSNTFFS
A0A6I7QXV0      -FFILE--NREQLISRV-----SRNIQVSAI--N-------PR-TKTLQIKYSDNHPQKA
A0A7Y3V126      -TFIIN--TPSAMVDKC-----ISNLNITLI--N-------PS-AQTIQISFRDNNSTKA
A0A7Y5C3U1      -TFIIN--TPSAMVDKC-----ISNLNITLI--N-------PS-AQTIQISFRDNNSTKA
A0A2M7NLQ9      -FFTLN--SPEYQIAYI-----ASSLRANVL--N-------PK-AYTIQVSFTDNNPYKA
I4AFR0          -FFTLN--SHEYQINYI-----ASSIKANVV--N-------PK-AYTIQISFTDNNPYKA
A0A2N2Y3E5      -FFIVN--NPETQLNKI-----IQNLVVGVL--N-------FE-AQTIQITYTDFNPQKT
A0A2D9D7T6      -YFVFN--KKYDVMRSL-----KKNLTVSAI--D-------PS-AKTIQITFDHYNPELT
A0A1F3PPL5      -FFILK--NPTTLLNEH-----ISKLEIKLQ--N-------PE-ANTIEISYVDNNALKT
A0A357QK06      -FFILK--NPTTLLNEH-----ISKLEIKLQ--N-------PE-ANTIEISYVDNNALKT
A0A7X9JJJ8      -YFIIN--DSDYVQNFN-----SNLLEVFVL--N-------GE-ANTIQINFTDKNPVKA
A0A522EYA6      -YFVVN--NIDALANEY-----FSRLSVKLL--S-------DA-AKTIQISFQDNNAAKT
A0A662AEA4      -SFIIN--NPDNIYLKH-----IDEIEIRLL--N-------KY-ANTIEISCTSNNANKT
A0A0S2HYK8      -YFVIY--NDEQIFTEH-----SKKLNIKLL--S-------SS-SNSIEISYQSHNSQQA
A0A2N5ZWN6      -YFIIS--NMDQIYSEH-----SAKLTIRLL--N-------SS-SNSIEITYESNNSQQA
A0A2E0FJ09      -YFLYS--DLEKLASEF-----SAMLEVSIA--N-------SN-ANTIGLSFTHPNQVLT
A0A1F3FZ62      -YFIIN--NPDLIVNEH-----INQIDVSIL--N-------VL-AQTVLINVTNQNATKS
A0A1F3K211      -YFIIN--NPDLIVNEH-----INQIDVSIL--N-------VL-AQTVLINVTNQNATKS
A0A7Y1UDU0      -YFFFN--SADQIVKNL-----NNAVTVLPL--N-------PD-ANTILIRTRHQNAEKA
A0A1V6I2U9      -FFTIN--NPNTTLKNL-----SKRLNVQIL--N-------ET-AGTIKITYQDFNARKS
A0A2H0B957      -YFTLN--DSETVYQKY-----SSRLEVSLL--N-------QE-ANTISISITDNNARKT
A0A1F3CFW6      -YFIIN--DTESVYKKY-----SSQLEVSLL--N-------QE-ANTIQISFKDNNAQKT
A0A2M7E2T8      -YFIIN--DTESVYKKY-----SSQLEVSLL--N-------QE-ANTIQISFKDNNAQKT
A0A2M7NC69      -YFIIN--DTESVYKKY-----SSQLEVSLL--N-------QE-ANTIQISFKDNNAQKT
A0A1F3KLL5      -YFIIN--NPTYLLQAY-----KANLLVEVL--S-------DE-AKTISIKYSDYNAQKT
A0A359D1M1      -YFIIN--NPTYLLQAY-----KANLLVEVL--S-------DE-AKTISIKYSDYNAQKT
A0A0F2NS19      -FFAIN--DLEALTNKY-----IQQLGVFPL--N-------PS-AKTISISFNDNNALKT
A0A2A5H8X6      -FFAIN--DLEALTNKY-----IQQLGVFPL--N-------PS-AKTISISFNDNNALKT
A0A2H0GAU8      -LFVIN--NIDDLTSRY-----ISQLNIFPL--N-------PS-AKTINISFQDNNSTKA
A0A2M8FTK1      -LFVIN--NIDDLTSRY-----ISQLNIFPL--N-------PS-AKTINISFQDNNSTKA
A0A2A5B3B0      -FFKIN--DYDKLTFAY-----IGKLAVFPL--N-------NA-AKTINISFQDNNGEKA
A0A5C6RXM7      -YFKLN--DNASLANNY-----ISKLSVFPI--N-------IS-AKTINISFKDYNAAKA
A0A7W1FWM4      -YFTVN--DTNTLVNVY-----FPFVDVKLM--N-------SE-AKTILVAFRDFNPHKA
A0A7T9QP55      -YFTIN--DPMSLTSVF-----ASRINVTIN--D-------PS-AKTINIGYSDHNALLA
A0A7V9MK11      -FFKIS--NIDNITRTY-----MGKLEVKLL--N-------SA-AKTIQIIIKDNNPEKC
A0A1F3C1M2      -FFIIN--NPINIIKDN-----LLKLKVNIL--N-------PS-AQTVDISFTDNNATKT
A0A1F3DS87      -FFIIK--NPANIIKEN-----LDKLKISIL--N-------PS-AQTVDISFIDNNATKT
A0A7Y5QSG1      TYFRIN--SPASLVAQY-----SKQIDARIL--D-------ND-ARTVAIDCRDNNPTLA
A0A7Y2EX06      -YFMLS--GKAGLTRSF-----RSRTVIKTL--N-------AN-AKTIQILHKSPSKLIA
A0A7Y7NV14      SFFVVN--DPNSIVPTY-----SKQLTISVL--S-------EA-AKTILIKFNDNNPQKA
A0A6A0R6K9      -FFIIN--DLQTLVKDV-----LSRLKIFVV--N-------IN-AKTVSIAYDDINRIKT
A0A2E7CT70      -FFKIP--FFQEKRNEI-----INDLEISII--D-------PA-ANTIGITYSHTNPKFA
A0A2D5V560      -FFRIP--SXNELKNSI-----LNGLTINIK--N-------QS-AHSXQISHQHTNPHFS
A0A2D7K5A8      -FFKIP--TKKEVINIL-----KNSLTITIQ--D-------QS-AHSIKISHLHTNPHFS
A0A2E1XQ82      -LFKIP--NKKEVINII-----KNSLTITIQ--D-------QS-AHSIKISHQHTNPHFS
A0A1F3K695      -YFIIK--NPNNVYLDH-----FSRLEVAVQ--N-------QL-AQTIEIAFSDNNPLKT
A0A353KZR1      -YFIIK--NPNNVYLDH-----FSRLEVAVQ--N-------QL-AQTIEIAFSDNNPLKT
A0A2N2WYB5      -YFIIN--NPQTLVDLH-----LQTLQVALQ--N-------RS-AQTIQITYSGYNPEKA
A0A1F3K4G0      -YFVIS--NPKNIVENH-----LQNLDIFLL--N-------RS-AQTIQISYSGYNAEKA
A0A356H8Y3      -YFVIS--NPKNIVENH-----LQNLDIFLL--N-------RS-AQTIQISYSGYNAEKA
A0A351HSA6      -YFVIS--NPKNIVENH-----LQNLDIFLL--N-------RS-AQTIQISYSGYNAEKA
A0A2A4PYG9      -FFIVN--NTAAEIDKY-----YHLIDVRIL--N-------QA-AKTIQVTVRENNPQKA
A0A350JJ90      -YFILN--SAPTLVQKL-----SKNYSVRIQ--S-------AA-AKTVQIVVTDNNPAKA
A0A2A4YXP3      -YFRIN--SYEEMTNAW-----DYKLSVFPL--N-------NA-AKTINISFEDHNPKKA
A0A1F3R158      -FFTIN--DIESLTNSY-----ISSLNVFPL--N-------PL-AKTISLSFQDNNAVKT
A0A2M8ADX2      -FFTIN--DIENLTNNY-----ISKLNVFPL--N-------PM-AKTISISFQDNNATKT
A0A1J5B2H0      -YFIIN--NPSTNLSNY-----VRPLNISII--N-------EA-AKTVSITFRDENAQKT
A0A1V5N756      -FFVLK--KPSDILSSY-----IPNLSVFVV--N-------EN-SQSIMVMYSDRNPVKA
A0A4P5U6G4      -YFVIN--NRQTVAKRI-----RDVIRI-----N-------PY-TPSILISFQDKNPYRA
A0A2E2TFD1      -FFTLN--NNASIVNRY-----SKSLDLKVL--S-------QS-AKSISISFTDPNPRKA
A0A2E4ELE6      -YFRLN--SDAEIISKY-----SKSLKVKLL--N-------QA-ANSVEISFSDYNPRKA
A0A2A3UE91      -YFIVH--DVDAVTAQL-----QAKVELKLL--N-------EL-AKTILIRVKDVNAAKS
A0A7V9SRJ9      -YFTIS--DVDAVTAIL-----QSKLEVRLI--N-------EL-AKTILIRVQDVNSLKS
A0A2E6SYP1      -LFMIN--NEKQIVNHF-----SKGLDVSIF--N-------VR-AKTIKIGYSGDHPEKC
A0A2E5RLE8      -LVKIV--DKNQLISKY-----SKGLQVNIE--N-------TR-ANTIKISYTGNHPKKC
A0A2E7TQF6      -LVKIV--DKNQLISKY-----SKGLQVNIE--N-------TR-ANTIKISYTGNHPKKC
A0A2E6GVY9      -LVKIV--DKSQLINNY-----SKGLSVNIE--N-------SR-ANTIKISYTGNHPKKC
A0A2A5FYT6      -FFIIN--DVNQITEQY-----HHRLRVELL--N-------AA-AKTIKISFTDHSGKKA
A0A6N9NIX1      -FFKIN--NKEAIANAF-----AQKLTVTVL--N-------QA-AKTIQISFIDENPFKI
A0A1F3Q014      -YFTLN--DLDAIVNES-----YPKVEVKLL--N-------DQ-AKTILVSYKGFNPQKA
A0A2D5KD44      -HFVLN--NPQSLVKGI-----LSRLEIVIL--N-------PN-AKTLQVGISDNNRLKA
A0A7Y2F301      -YFVIP--SREALASEF-----IKQINVGVL--N-------PT-AKTLLLSCENNNARLA
A0A0E3V905      -SIQVT--KRATSVKNY-----LTNLHAIPT--G-------KG-STVILLSLEDAVPAKG
A0A553ETH6      -FFTIN--SRAQLISYF-----ERNLVVEPL--N-------LN-ANTIKIALQDFNRYKA
A0A2D4ZVH1      -DSTST--SIDTVAMRY-----RELIRFSEP--D-------PE-ADIVSISFESPLPTEA
A0A6P1P355      -FFAIM--HPKKVTDNI-----ISNLSIQAE--N-------KL-STAVNLNFTDASPQRG
A0A3D0MYJ7      -FLENE--KEKKFNELS-----IAESNLENF--Q-------KQ-NGIV------DVQQNV
A0A4Q5WS95      -YFRLI--DPKSVAAGL-----QKKLDVAPA--G-------KL-SSIVRLKYNDEVPQRG
A0A7V9RTA1      -YFALF--QPKQIANAI-----LGNLYVSAT--S-------KQ-SSIVYLYLKDEVPQRG
A0A5C8KAD6      -YFTLQ--DPRKVTDQL-----VAKLTIVPS--G-------KL-STVVDIRLRDEVPERS
A0A5N1J695      -YFSLI--PTRQVTDGL-----LANLKIEPA--N-------KL-STVINITLEDPVPQRG
L8JI02          -YFVIH--DLSEVIETY-----QTELEVYPI--S-------RE-SNIVELSMRGSVPHKT
A0A1Q3PII2      -SFKIS--TEESVLDLY-----TRVLNIYAP--N-------KT-ASLVNLSWQDVLPRKG
A0A351BXT2      -----------------------------------------RG-LDVVDIIVESPAKYEA
A0A2K8Z965      -IVQVS--KQTSAAKSY-----LSNLHVIPT--G-------KG-STVILISLEDGVPSKG
A0A418M8U8      -LVQAM--KRPAAVNGY-----LRTLQAEPT--S-------KA-STVVVLTLEDAVPEKG
I2GTA4          -LVQAM--KRPAAVNGY-----LKTLQAEPT--S-------KA-STVVVLTLEDAVPEKG
A0A2K8ZAJ2      -FATVS--LHNDAVEGY-----LGNLKIGST--T-------ML-STVLVMNLQEAVPSRG
A0A368JPA3      -VVQVM--SPAQTIRYY-----QSKLTVAPS--G-------KE-STVLVLTIEDAVATKG
A0A5N1JI29      -VVQVM--PQAQTIRYY-----QSKLTVAPS--G-------KE-STVLVLTIEDAVPTKG
A0A7K0EGC9      -VVQVM--TDPETIRYY-----LSKLKVEPS--S-------KS-STVLVLSIEDAVPVKG
A0A3P1BT12      -IVQVM--EHPQAIRYY-----LSKLNVEPS--S-------KT-STVLVLTIEDAVPAKG
A0A3P1CI15      -LVQVM--TDPQAIRYY-----LSKLTVEPS--S-------ST-SSVLVLTIEDAVPAKG
A0A4R8CUK1      -SVQVM--PDLEAIEYY-----LGKLQVEPS--S-------DA-STVLLLTFEDAVPAKG
A0A7Y6XX71      -EIDWI--EKQKIIDFF-----MESMAVSPV--S-------NT--QVVKISFESESPKLA
A0A2H3NSN0      -----------------------------------------DQ--GLIRIVARSQYPEEA
A0A800J4N3      -----------------------------------------QG-VNGVRVTAQSRSPYEA
A0A2P6C324      -----------------------------------------QQ--GLINIRVESQDPAEA
A0A7V2F6E1      -----------------------------------------DQ--DMIVITAESTTPEEA
A0A1M6XHU0      -----------------------------------------DQ--DMIVITAESTTPEEA
G2SF81          -----------------------------------------DQ--DMIVITAESTTPEEA
A0A5S9EYW1      -----------------------------------------DQ--DMIVITAESTTPEEA
D0MHQ9          -----------------------------------------DQ--DMIVITAESTTPEEA
A0A662AH13      -----------------------------------------RG-LDIVTISYESHSPFEA
A0A5C7QA01      -NIRKQ--SLPNAIKSL-----SANYAVAER--G-------KL-TGVLGLNYQGADKIHI
A0A3D3LS70      -----------------------------------------RG-LDIISIDVDSPSRTEA
A0A1G1TM36      -RIRTS--SPEAVVQAY-----QKLLDIELI--N-------KV-APAIRLQIKDQVPQRG
A0A1G7ZF38      -SFKIS--ATETILDHY-----DRVLRIQAP--N-------KA-ASLVNLSIQDVLPRKG
C6VS52          -SFRTL--AKETVVDHY-----ARTLSIQAP--N-------KI-ASMVNLSIQDVLARKG
                                                                            

A0A7V5RJC2      SRKTNKLAEIFVRESKASDTSITSKRLSIYEERLQRAEKNLKESSDELKRFR--DRYGI-
A0A7C1LGX3      ELILNTLIKKFNQDGINDRQQVSKRTLDFIDERFVYLSTELDSIEGGKQAFK--TRNNLS
A0A1T5MMH4      HAIVDAINKTYLHYSYEQKKLTTKQKIDWLNNELQQIELKMEGFEDYFERFT--LKNKTN
A0A2W4R1L8      QTVVNKIDSLYLIFSNEQKTLANRQKITWLTNELKQIEEKMSQYENYFEDFI--LANKTS
A0A7L9BFB6      QDLVNGIDSLYLRYSNAQKNLANLQKIAWLNNELSQIEQQMEQYENYFENFT--LKNKTS
A0A5C8A5B4      QAFLNKLMETYIDYELDKQQQKGRKTIDFIDKQIGTVSDSLQKVENSMEQFRG-VSGGMI
A0A2E5CV79      RRISDGIAQVYKNLEKTIGNEDATLRVEFMDDLVNQQEGKLLLAEDSLKQFK--IENSFF
A0A2A4G4B1      QLILEELVATYNKLEQDDKNLISENTAAFIDSRLKGITKELVMVEGHLESFK--TQRVLT
A0A0P7X1V8      SRVVDLAIETYTDVSTRINRSQARNAIDFLDSELDKVSMQLNYSEEQLRDFM--NQNQLV
A0A4Y9ITE2      EKVVNALVEGYNERGIEENRVKNQITADFIETRLGSIAEELNAAEREVEAYK--VDNNFV
A0A3N2M1H3      EDILNTVLLVYNENWIEDKNKMAVATSAFIDERLRLIQQELGDVDSNIAKYQ--TTTGSP
A0A4S2G8T2      EDILNTVLLVYNENWIEDKNKMAVATSAFIDERLRLIQQELGDVDSNIAKYQ--TTTGSP
A0A212K7W5      EDILDTLITVYNKNWIQERTQIAVNTSSFIEERLNVIEKELGGVEDSISRFK--SQNLIP
F5IU11          EDVLDTLITVYNKNWIQDRTQIAVNTSSFIEERLNVIEKELGGVEDSISRFK--SQNLIP
A0A7C1QWC7      VDFLNAYIQTYLDNDLAKKNSIALNTMNFIDAQLSEISDSLYLSESKLRDYR--STHQVT
A0A7Z8P8P1      DAILSALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFK--QRNRII
K0XJ09          EAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDVENELTDFK--QKNRIV
R5EUZ0          EAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDVENELTDFK--QKNRIV
W0EQS0          DAILSTLIDVYRETIIEDKNRIATSTAKFINERVEIISRELGDVENELTDFK--QKNRIV
A0A1Y3WE15      EAILNTLIDVYRETIIEDKNRIATSTAQFINERVEIISRELGDVENELTNFK--QQNRIV
A0A1Y4GUK3      EAILMALIDVYRETIIEDKNRIATSTAKFINERVEIISRELGDVENELTDFK--QKNRIV
A0A352Z1R7      RDLVNTLVQVYLGQNIELKTEEASRTVSFIENQLKGLRGELEGAEQDLETYK--SSSGMF
A0A7X7BZF5      DDIISTLIDVYNDNWIKDKNQIAVSTSLFINERLAVIERELGGVDENISSYK--STKLVP
A0A0A2F501      EDFLNMLINVYNESWVKDKNQVAISTSLFINERLSVIEQELGHVDKDISSFK--SANLIP
R5B7P0          QDILNTLIAVYNENWVRDKNQIANSTSVFINDRLRVIEGELAGVDSDISAYK--SENMIP
R5B0L5          VDLLNGVIAVYNEKWLADKNQVSVSTASFINERLAVIENELGHVDSDIASYQ--SEHLIP
A0A6I1TEC0      EDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFK--SANLLP
A0A3R5XWG1      EDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFK--SANLLP
A0A5P0Y910      EDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFK--SANLLP
A0A414YFM3      EDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFK--SANLLP
A0A6A7UIA7      EDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFK--SANLLP
A0A6A7VPS3      EDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFK--SANLLP
A0A374THP7      EDVISTIISVYRKNWLEDKNQMTISTSHFITERLGVIERELGDVDKNISAFK--SSNLLP
A0A6G1VND1      EDVISTIISVYRKNWLEDKNQMTISTSHFITERLGVIERELGDVDKNISAFK--SSNLLP
A0A0A2EVS5      EDFLDTLISVYNENWVKDKNKIAVSTSQFINERLSVIEQELGAVDSDISSFK--SKNLIP
A0A1T4NAJ7      EDFLDTLISVYNENWVKDKNKIAVSTSQFINERLSVIEQELGAVDSDISSFK--SKNLIP
A0A255T941      EDILNTLIEVYNENWILDKNQIAISTSQFIGERLGVIEGELGHVDANISSFK--SANLLP
A0A4P7VSV0      QALLNTLIGVYNEYWVRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYK--SANLIP
A0A7J0AX49      QALLNTLIGVYNEYWVRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYK--SANLIP
A0A3N2KCL3      QALLNTLIGVYNEYWVRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYK--SANLIP
A0A2V1IJY1      QALLSTLIGVYNEYWIRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYK--SQHLIP
A0A4P7VXK7      QALLSTLIGVYNEYWIRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYK--SQHLIP
A0A1Y4CHN5      EDVLNTLIAVYNENWLKDKNQIAVSTSMFINDRLKVIENELGTVDADIASYK--GENLLP
A0A7Y5JED7      EDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLGVIESELGHVDENISSYK--SEHLLP
A0A1M6I2S6      EDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGYK--SEHLLP
A0A1Y3V692      EDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGYK--SEHLLP
F3PXM2          EDILNTLIEVYNEYWIRDKNQIAVSTSQFIGDRLGVIENELGHVDANIAGYK--SEHLLP
A0A174JCE8      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A3E4JMC4      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A412SND6      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A414IEQ9      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A7K0HNT3      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A0M1W8D8      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A3R6GKX5      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYK--SEHLLP
A7V4S1          EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYK--SEHLLP
B0NU19          EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYK--SEHLLP
D4V601          EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYK--SEHLLP
A0A4Q0U3M9      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYK--SEHLLP
A0A7J5G2G2      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYK--SEHLLP
A0A7J5HH13      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYK--SEHLLP
A0A397WLT5      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYK--SEHLLP
A0A6N8DDD8      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYK--SEHLLP
A0A6A2J529      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYK--SEHLLP
A0A7S9QIA5      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYK--SEHLLP
A0A015XH67      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A078RZN2      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A6L0K5          EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A7ACT5          EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A6KY94          EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A173UQR8      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A3R6HK75      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A412B7D1      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A412VNY9      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A414LTU9      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A8B2YHC3      EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
I9Q4U4          EDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYK--SEHLLP
A0A373ISF0      EDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGHVDENISSFK--SEHLLP
U6RF62          EDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGHVDENISSFK--SEHLLP
A0A662ZZD5      EDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYK--SEHLLP
A0A415NEB6      EDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYK--SEHLLP
A7AJ60          EDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYK--SEHLLP
A0A6A2JF01      EDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYK--SEHLLP
A0A7J5MKN5      EDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYK--SEHLLP
A0A015UXN7      EDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYK--SEHLLP
A0A642KJV3      EDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYK--SEHLLP
A0A6I2NTL0      EDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYK--SEHLLP
A0A6I2Q447      EDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYK--SEHLLP
A0A016E4F9      EDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGFK--SEHLLP
A0A6N3HG44      EDILNTLIEIYNEKWIQDKNQIAVSTSQFIGDRLSIIESELGNVDENIAGFK--SEHLLP
A0A7K0HSP7      EDILNTLIEIYNEKWIQDKNQIAVSTSQFIGDRLSIIESELGNVDENIAGFK--SEHLLP
A0A7K1HEJ5      EDILNTLIEIYNEKWIQDKNQIAVSTSQFIGDRLSIIESELGNVDENIAGFK--SEHLLP
A0A6H9P0U9      EDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYK--SEHLLP
A0A108TH71      EDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYK--SEHLLP
I8VXH0          EDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYK--SEHLLP
A0A412S0N6      EDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYK--SEHLLP
A0A412IIJ0      EDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYK--SEHLLP
A0A0P0FM97      EDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYK--SEHLLP
R6KTP3          EDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYK--SEHLLP
A0A139LU87      EDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYK--SEHLLP
A0A1C6B3Y5      EDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYK--SEHLLP
A0A6L3KCD1      EDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYK--SEHLLP
E2NMQ4          EDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYK--SEHLLP
A0A412YDB9      EDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAGYK--SEHLLP
R7DY01          EDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAGYK--SEHLLP
A0A414LGK8      EDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAGYK--SEHLLP
A0A415IPQ4      EDILNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIESELGHVDENISSYK--SEHLLP
A0A3E5BRW7      EDLLNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIENELGHVDENISSYK--SEHLLP
K9DXS6          EDLLNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIENELGHVDENISSYK--SEHLLP
A0A1M6KFV3      EDILNTLIEVYNENWIQDKNQIAISTSQFISDRLDVIENELGHVDENISNYK--SEHLLP
A0A1Q6G7L3      EDILNTLIEVYNENWIQDKNQIAISTSQFISDRLGVIENELGHVDENISNYK--SEHLLP
A0A413H235      EDILNTLIEVYNENWIQDKNQIAISTSQFISDRLGVIENELGHVDENISNYK--SEHLLP
A0A358R8U0      EDVLNTMISVYNENWVRDKNQIAVSTSMFINERLGVIERELGNVDENISTYK--SENLLP
R6WSB6          EDVLNTMISVYNENWVRDKNQIAVSTSMFINERLGVIERELGNVDENISTYK--SENLLP
A0A401LPX7      EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A6G0GNY9      EDVLNTLIAVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A6I1BFM0      EDVLNTLIAVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A3A5Z900      EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A7K0GW19      EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A285TGL6      EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A3A5RFX4      EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A1Q6IUW9      EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A413XDP6      EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A6N8CVT6      EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
K6AP24          EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A6I2NHV3      EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A662ZYI7      EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A078RYI7      EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
C7XEQ8          EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
D7INX6          EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
K5ZG55          EDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFK--SEHLLP
A0A7Y5MWI8      EDVLNTVIAVYNENWIKDKNQIAVSTSAFISDRLGVIEQELGNVDENISSYK--SEHLLP
A0A1M5B2J8      EEVLNTLISVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDNDISSYK--SQHLLP
A0A255RCT5      EEVLNTLISVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDNDISSYK--SQHLLP
A0A1Y4GLF5      EDVLNTLISVYNENWVKDKNQVAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A1H3XSC0      EDILNTLISVYNENWVKDKNQIAVSTSMFINERLRVIERELGNVDEDISSYK--SEHLLP
A6LE40          EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A4Y1VPX5      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A6N2XMM4      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A7U8L0B4      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
B3JI46          EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A3N2N9B8      DDVLSTLIDVYKDAWIRDKNEIAVSTSQFINDRLGVIESELGNVDQDISSYK--SAHLIP
A0A3N2NMI0      DDVLATLIDVYKDSWIRDRNEIAVSTSQFINERLNVIEGELGNVDNDISSFK--SEHLIP
A0A359I8H7      VDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFK--RDHRVP
A0A3N2KA63      VDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFK--RDHRVP
A0A4Q0IMT7      VDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFK--RDHRVP
A0A7J0B660      VDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFK--RDHRVP
A0A3B9FAU3      DDIINTLITVYKESWVREKNMLTIATTKFINERLAIIERELSGIDSDISSYK--SSNLLP
A0A3C1E5L7      DDIINTLITVYKESWVRDKNMLTIATTKFINERLAIIERELSGIDSDISSYK--SSNLLP
A0A4Q0UAV1      EDVLNTLLDVYNQRYVIERNQAAQAASQFITDRLNVIENELGDVESNISNYR--SSNLIG
A0A354SN68      NDILNAVIKAYNKKWVEDRNQVALNTSKFINERLKVIEKDLGLVDEDISSYK--SMNYVP
A0A6L5XFL0      EDVLNRLYVVYNQKWVEDINQQAISTSQFIDQELRAIEAELSNVDEDISSYK--SKNMVP
A0A3N2N595      QDLLNTLIGVYNEYWISDKNQVAVSTSNFINERLGVIEGELGHVDSDISSYK--SENLIP
A0A7J0ACS3      DDVLSTLIGVYNENWIRDRNQIAVSTSNFINDRLGVIEGELGDVDSDISSYK--SANLVP
A0A0A2DUD9      DAILNTLVATYNESWLADRNLSAVSASLFIDERLGLIEKDLGEVDKNITKYK--SQHLLP
A0A3P1ZBJ5      EDVLKTLIDVYNQNWVEDKNQVAVNTSKFINERLRVIESDLGNVDKNISSYK--SSNLLP
R5FHS9          EDILNTIIAVYKDRWVRDKNQVAVATSAFIDDRLKKIELELGNVDNSISSFK--SKNLIT
A0A413TW79      EDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFK--SRNLLP
A0A7K0AAG2      EDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFK--SRNLLP
A0A7K0ASF1      EDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFK--SRNLLP
A0A3E5E9M7      EDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFK--SRNLLP
A0A3E4SK73      EDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFK--SRNLLP
A0A415GGC6      EDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFK--SRNLLP
A0A413DBH9      EDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFK--SRNLLP
A0A495WI87      EDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYK--SEHLLP
A0A354M4S6      EDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYK--SEHLLP
R7DH52          EDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYK--SEHLLP
A0A7J5IAE7      EDMLNMLISVYNENWVKDKNQVAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A016CWA4      EDVLDMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A4P8LP09      EDVLDMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A0M1W0V2      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A139KA16      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A174VQ92      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A1Q6HCG0      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A1Y4JYM9      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A3A5QW67      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A3A5RQE6      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A3A6BP07      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A3E5E153      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A3Q9IP20      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A412WV15      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A413ICP6      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A414KYB9      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A5B3FWR2      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A7J5QHB9      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
E5WX00          EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
K0X3P3          EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A1C6H117      EDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A6I1AQV4      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A5C6L2P1      EDVLSMLISVYNENWVKDKNQIAVSSSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A3E4WKT5      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A3A5YY33      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A1E9CFZ7      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A373FYU5      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A3A5XBP2      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A3A6MEG9      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A3E4JP35      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A3E4KP40      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A3E4NX82      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A3E4XFU8      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A412RG70      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A412TD37      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A413GAA4      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A414M7I4      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A496BTA0      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A496D2V6      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A5C6KCA6      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A5M5AHM5      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A6I0Y5K7      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A6I1BFB8      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A6I2P5W5      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A6N8DC51      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A7J5HGP0      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGIIERELGNVDEDISSYK--SEHLLP
A0A7J5HVL8      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A7J5JHD3      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A8B3EKM1      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
E5UZA2          EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A069SMG6      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
C3RFN5          EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A3A5Z014      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A7J5GD93      EDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A7K0HGR5      EDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A078S3Q8      EDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A069SJV7      EDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A3E5DXI5      EDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A3E5EM98      EDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A6N2YYD4      EDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
I9T3G6          EDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A3E4SYU0      EDVLSMLISLYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A6LGY1          EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
K5ZSH4          EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A6A2RTB3      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A7J5PEN4      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A1M4YZ07      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYK--SEHLLP
A0A7J5I238      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A0P0FQW1      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A7K0I229      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A5M5C0W6      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A642NJ89      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A6L3JTQ2      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A7J5FQU6      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A7J4YLH7      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A6N3AEV2      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A6G0G4T5      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A6L3KG29      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYK--SEHLLP
A0A1Y4PQK7      EDILNTVISVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYK--SEHLLP
A0A1Y4IH41      EDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYK--SEHLLP
A0A3A6AAP4      EDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYK--SEHLLP
A0A6I0ZRD2      EDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYK--SEHLLP
A0A1Y4DYA7      EDVLNTLIAVYNENWVKDKNQIAVSTSMFINERLEVIEQELGHVDENISSYK--SENLLP
A0A1Y3X4I9      EDVLNTLIAVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDENISSYK--SENLLP
A0A1Y4FNK8      EDVLNTVIAVYNENWIKDKNQIAVSTSAFISDRLGVIEQELGNVDENISSYK--SEHLLP
A0A355FD59      EDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISSFK--SKNLLP
A0A359CEZ9      EDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISSFK--SKNLLP
A0A353Q7B4      EDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISSFK--SKNLLP
F8X3A5          EDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISSYK--RQNLVP
A0A1M3KVR9      EDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISSYK--RQNLVP
A0A4Y9IJS3      EDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISSYK--RQNLVP
A0A416GA42      EDILNTLVDAYKEDIVNDKNTVARNTERFVVDRLAILEKELGNVDNQIASYR--SANQLI
A0A1T3IYP5      ADVLTALINVYNEVYLQDKNKIAENTANFIKDRLEIIEGELGSVESNIEDLK--IANQGI
A0A7Z6RZU4      AAIIETLIEAYNDDATQDKNQILFNTSLFIDDRLQIINKELGLVDGDIEKYK--KKNGLT
A0A4D7K1D4      YDVVNTIDSLYLEYSREQKMQANKQKIAFLEEQMGNTAQTLENYENYFESFT--IENQTV
A0A846MP44      YEIIKKAVQAYTAVSIDIKNKANKQKEQWLETKIQETEAELGILEKEIEDFI--ISNKSQ
A0A1G9E2A9      RDIVNKIDSIYLVQTIENKNLATEQTLKFLDDQLDSTAQKLAQQEESIEDFV--RENRTL
A0A098LL25      TDIVNTIDSVYLEQTLENKSKSHEQTIKFLEASLLKTEENLAKAEKDLETFV--RNNRTV
A0A6J4H627      HDIVNKIDSVYLSKTKELKNKANKQKIAFLEEQLQSTEDKLQEYESQLEHFV--VQNKSS
A0A6C0GJI1      RDIVNTIDSVYLTKTLEIKNTSNKKKIEFLEGQLLATEKNLEKYELEQEDFI--VKNRTT
A0A839GQ17      RDIVNKLDTVYLQQKLARGNQASQQTVDFLNEQLQETQDNLRKAEFDMEYFV--KQNKSY
A0A127B287      RDVVNKIDTVYLQQKLARSNQASQQTIDFLSNQLQETQDNLQKAEIDMEYFV--KQNKSY
A0A6P1P2P6      RDVVNKIDTVYLQQKLSRTNQASQQTIEFLTNQLQETQDNLQKAEIDMEYFV--KQNKSY
A0A2T2YJE8      HEIVNSIDSVYLEQKIALKDLATRQTLSFLDEQLKETNENLGNSEIQMENFV--KENKTY
A0A7L7LEW0      HEIVNSIDSVYLEQKIALKDLATRQTLSFLDEQLKETNENLGESEIQMENFV--KENKTY
A0A3M9N829      RDIVNNIDTVYLQHKLERSNQASRQTLNFLTEQLKETENSLKKVEDEIESFV--RQNKSY
A0A0P0CSF9      RDIVNNIDTVYLQYKLERSNQASKQTLNFLNEQLKETEDSLRKAENDIERFV--RQNMSY
A0A5M8QQB8      RDIVNNIDAVYLQHKLERSNQASKQTLSFLNEQLKETEDSLRKAENDIEQFV--RQNKSY
A0A3M9MNC3      HDIVTNIDAVYLQHKIERSNQASRQTLTFLNDQLKETEDSLRKAENDIERFV--RQNKSY
A0A5B6TAX2      HDIVNNIDAVYLQHKIERSNQASRQTLSFLNDQLKETEDSLRKAENDIERFV--RQTKSY
A0A7L5A132      HDIVDKIDTLYLQEKLAKNSLASQQTLAFLEGQLDENSRKLQQAEVALQDFV--RRNKTF
A0A512AYT3      RDIVTEIDTAYLEQKIHQKNLASSQRQKFLDQLLKETETNLQNSEENMESFV--RQNRTY
A0A5M6CYN7      RDIVNKIDSAYLEQKIRQKNLATSQIEQFLNEQLKETQDNLANSEGKMENFV--RENRTY
A0A369QP10      HEIVNSIDSVYLEQKIALKDMATRQTLSFLDEQLKETNENLGNSEIQMENFV--KQNKTY
A0A7G7G7M4      QEIVNSIDSVYLEQKIALKDMATRQTLSFLDEQLKETNENLGNSEIQMENFV--KQNKTY
A0A126PDF2      QRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERAENRYQGFV--EKTKTY
A0A2Z3GKA1      QRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERAENRYQGFV--EKTKTY
A0A502GZP7      QRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLDVNYDNLQRAENRYQGFV--EKTKTY
A0A0M3RW20      KDIVNRIDTVYLVEKLAKNSQGQQQTLQYLDEQLDITRDSLQRAELALQRFV--KANKTY
A0A495VFX4      QDIVNRIDTVYLVEKLAKNSQGQQQTLEYLDEQLDVTRDSLQRAELALQRFV--KANKTY
A0A246FQC0      QAIVNGIDSVYLVEKLVRKQEQATRAMGYINDQLGDNNQKLNQAEEAMQSFV--KRTGSY
A0A372E5P8      RDIVNAVDAVYLEEKLTRKREQAARALRYINEQLGSNNQSLSQAEENMEAFV--KRTGSY
A0A7Y7PLY0      RDIVNAVDAVYLEEKLTRKREQAARALRYINEQLGSNNQSLSQAEENMEAFV--KRTGSY
A0A1H3EMW1      RDIVDAVDAVYLEEKLVRKREQSARALRYINEQLSNNNESLGQAEENMQSFV--KRTGSY
A0A1H9ZSN3      RDIVNAVDAVYLEEKLARKREQSARALRYINEQLGSNNQSLSQAEEAMEAFV--KRTGSY
A0A7W9SXN1      RDIVNKVDSAYLVEKLARKQEQAARATRYINEQLGENRKDLQSAEEDMQAFV--KRNGTY
A0A418R9X5      SDIVNYVDSVYLVEKILRKQETMARATNYIDRQLGVNSDKLSQAEAKMQDFV--RKNKVF
A0A428JSJ3      SDIVNKIDTVYLVEKLLRKQETMARATSYIDQQLGINDNKLGQAESNMQDFV--KRNRVF
A0A428KI59      RDIVNKIDSVYLVEKLLRKQETMARATNYIDKQIDINDNKLGQAESNMQDFV--KRSRVF
W8F1I6          RDIVNKIDSVYLVEKLLRKQETMARATNYIDKQIDINDNKLGQAESNMQDFV--RRSRVF
A0A1S9B3W0      RDIVNKIDSVYLQVKLARTNQATQQTLTFLDGQLVENRDKLQNAEEALQNFV--KQNKTY
A0A1W1VRL3      QDIVNKIDTVYLQEKLAQKKKASDQSLQFLSEQADAFNNKLQLAEDNLQSFA--RENRTY
A0A7G6YQJ9      QDIVNKVDTVYLIEKVLKKQEQAARTLQFIDSELDKSKAGLNKAEGDIQSFA--ERNQAF
A0A1M6R305      RAIVNKIDTVYLQEKIAQKQAATAQTLQFLQQQLAENRQNLAVAEENLQSFA--RQNKTY
A0A7G7W8X3      RAIVNKIDTVYLQEKIAQKQAATAQTLQFLDQQLTENRQNLAVAEENLQSFA--RQNKTY
A0A4Z0PHK3      RAIVNKIDTVYLQEKLAKKQEATAQTLQFLDKTLTENQQQLQGAEENLQAFV--RENKTY
A0A2M9B9H9      RDIVNKIDTVYLQEKLAKKQEATAQTLQFLDKTLTENQQKLQSAEENLQAFV--RQNKTY
A0A4Z0QCY9      REIVNKIDTVYLQEKLAKKQEATAQTLKFLDRTLAENQDKLQDAEANLQAFV--QQNKTY
A0A7Y0AH93      VAIVNALDSVYLQAKLEEKSLTTTKIRAFVTTQLQEYGRKLTVAENNLKSFV--GRNRTY
A0A519SBU8      AHIINNIDTVYLKEKLDRKRQSSALTLSYINQVIADNDKLLRQAEDTQQEFV--RQNKTY
A0A4Q3JNZ3      AHIINNIDTVYLQEKLERKTKNSELSLGFIDRVIAENDKKWQAAEEAQKEFV--RRNKTY
A0A519Q9V3      AHIINNIDTVYLQEKLDRKKQSSALSLKFIDQVIADNDKRWRAAEEAQKEFV--RRNKTY
A0A5N1J2M4      QDIVNRVDSVYLEHKRETKNQSNEQTISFLREQLDATKVSLQEAEANLEAFA--KKNKSY
A0A519S476      AHIVNNIDTVYLQEKMARKKQGNDSTLSYLDKLIDETDKRFKAAQELQQQFV--LRNKTY
A0A4Q3JRW8      AHIINNIDTVYLQEKLDRKKQSSALSLQFIDQVIADNDKRWRAAEEAQKEFV--RRNKTY
A0A519M923      AHIINNIDTVYLQEKLARKKQQSELSLKFIDLVIADNDQRWRAAEEAQKEFV--RRNKTY
A0A4Z0ENW1      QRIVNALDTVYRDVKLAHKQETTEKSLDYLDKQLQENGKNLANAEDNLKEFV--QQNRTY
A0A519UDB4      QRIVNALDSVYREAKVARKQEATEKTLAYLDQQLAANGINLAKAEDNLKTFV--EQNGTY
A0A3S0QKV1      QAIVNKIDSVYLNVKLDRSSQATQQTLAFLQGQLLDNRAKLQDAEKALEEFV--RQSKTY
A0A328BL48      RDIVNKIDSVYQQVKLARNYQSTQQSMAFLDSQLNGNRDSLQKAENALQAAV--KRNRTY
A0A5R8WLY4      RDIVNKIDSVYQQVKLARNSQSTQQSMAFLDSQLNGNRDSLQKAENAFQAAV--KRNRTY
A0A1I5WSL8      QDIVNKIDSLYLVEKVTRKNEATRNQLKFLDQILDENGQNLERAEDRLQSFV--QKTGTY
A0A0U3JVM7      QDIVNKIDSVYLAEKLAQKSETTTRKLRFLDQILDQNGQNLERAEDRLQNFV--QQTGTY
A0A1G1SSV2      QDIVNKIDSVYLEEKLAQKSESTISKLRFLDQILDQNGQNLEDAEDRLQKFV--QKTGTY
A0A1G1SXV7      QDIVNNIDAVYLEERLAQKQESTISKLRFLDQILDQNGQNLEDAEDRLQNFV--QKTGTY
A0A6G8CBJ6      QDIVNKIDTVYLQEKLAQKKEASEKSLRFLGEQTDVTNNKLQQAEDNLQSFA--RENKTY
A0A0W8EDI5      RDIVNKIDTLYLQEKLAKNTQATQQALAFLEGQLDQNSQRLQGAEEALQEFV--KRNKTY
A0A3B7RBP8      RDIVNKIDTLYLQEKLAKNSLATQQTLAFLEGQLDENRNKLQGAEVALQEFV--RRNKTY
A0A3R9P8H7      RAIVNKIDSVYLVEKLLRKQEQAARAMSYINEQLGENNQKLGQAEENMQAFV--KRNGTY
A0A238WIA7      HDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEENRRLLRQAEEQLQDFM--KRNNLF
A0A212UCJ7      HDIVNKVDTAYLVEKIQRKQEQSAKTLRYLADQSNDNRQLLRQAEEQLQEFM--KQNRLF
A0A4Z0MQE1      HDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEDNRQLLRQAEEQLQDYM--KQNKLF
A0A4Z0PCF4      HDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSDENRQLLRQAEEQLQNYM--KQNKLF
A0A6M6BED0      HDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEENRRLLRQAEEQLQDYM--KQNKLF
A0A5D6VDG1      RDIVNRIDTVYLVAKLTKNTQSQQQIMQYLDKQLELTRDSLQRAEIALQSFA--KRAKMY
A0A243WHR7      QAIVNKIDTVYLQEKLAQKQEVTQRQLKFLETQIVENKDSLQGAEKNLEKFT--DRTKTY
A0A5B8A0P6      RDVVNKIDSVYLEEKLAQKQQATAQTLEFLDKTLTENKNKLEAAENNLQGFV--RRNKTY
A0A076HRT9      RAIVNKIDTVYLQEKIAQKQTATAQTLQFLDQQLTENRQSLAQAEENLQDFA--RQNKTY
A0A4Z0PVM7      RDIVNKIDTVYLQEKLAKKQEATAQTLQFLEKTLAENQQKLQGAEANLQAFV--QQNKTY
A0A1M6DHW8      QDIVNKIDTVYLQEKLTQKQQATAQTLQFLEKTLSENRKQLQLAEENLQSFV--RDNKTY
A0A4Q5LC61      QDIVNKIDTVYLQEKLAKKQQATAQTLQFLEQTLAENRTQLQNAEENLQSFV--RNNKTY
A0A060RD97      TAVLNTLIAEYNTESIMDKNRIARNTDIFIMERLAKLSKDLEGVDTDIADYK--QQSNVL
A0A350IHV0      EDILNTLIDVYNEQWVANKNRSARNTTAFINDRLVVIENELGGVEESLKQYK--ETHKIT
A0A2A8CVM9      STVANLYSSQYEIFSREKARASVTAARDFLETQAEKRREEIRELEQQWETFA--QNNQVV
R5RVP0          DAVLRTLIDVYNEHWVENKNRSARNTTAFINDRLIVIEKELGGVEENLKDYK--SSHKIT
A0A2L2WX98      EDIINVVFDAYKRDIVANKNRVANNTAIFIDERIRIIDGERIASRDQMAKFL--SDNKLT
A0A2E3R1D0      ALISNTYAEAFAQLTQDQSRSGASASREFLEDQVETQNDRLQETDAAVEQYM--LREGAV
A0A800J826      ALLANVYAEAFVNVAQASSRGGVSAVREFLEEQVADKDERLRSADAAVESYM--NRTGAI
A0A2T2USC0      ALIANLYAQEYINYNERKSKESARSTRKFLEQQSKKFRNRVNRAEQRLEKFM--REENAV
A0A2T2V0F3      ALIANLYSQAYIDYNQRKSQESARSTRKFLEQQASKFKNRVDRAEQELESFM--QEEKAV
A0A2T2S682      ALIADQYAAAYLQRTREKSRESLRAKRDFLDQQSDKFATQVQQADRALAKYM--QKEEAV
A0A840DJZ8      KLLANLFTEAYIDLTKESSRSRVKASRTFLEQRSQELERELETIEQRIQRFQ--QNRNAV
D5H561          RRLANLFTEAYIELTQKSSRERVKASRTFLEQRSQELERELETIEQRIQRFQ--RSEDAV
A0A2H3NWA9      ALLVNLFSEEYVEFSRDRSRQSVQATYDFLKEQSESLRVDMEEAEQNLVDFM--QREEAV
A0A2A8CVB6      ALVANIYADEYIRRTKEKARESLQASRDFLERQAEKLKAEVQAAEGEIENYM--QREGAI
A0A2P6C1S6      SLVANLYAEEYIQRTQERSREDLRASRQFLEEQADTLRQDVQAAEQKIEEYM--QRENAV
A0A2T2UTM4      SLIVNLYAEEYIQRTKEKSREDLKASREFLEEQADTLRQEVQAAEQKIENYM--QEEKAI
R6A0L2          DQVLATLYDTYKEDVVENKNRVALNTAKFIDDRIQIIGRELSSVENQLASFK--KRNQLV
R7LG80          VDVLNTLYNTYKEDVVENKNRVALNTARFIDERLKLIGTELSDVENNLASFK--KRNSVL
A0A7W5UEN4      EDLLNTVYEAYKHDVVDNKNRVASSTANFIDRRVALIGQELTQVENRLASFK--QQNRVI
G5GD56          EDLLNTVYEAYKHDVVDNKNRVASSTANFIDRRVALIGQELTQVENRLASFK--QQNRVI
R5KD55          EDILSAVIDIYNKVWMKNRNEVSAGATKFLDERLAIIERELDNVDNDISRYK--SKNLLP
A0A174QNT3      DAILATILQVYNETIVEDKNRIASNTARFIDDRIVIISHELGEVEDQLTIFK--QEHRIV
A0A4S2FGS1      DAILTSILQVYNETIVEDKNRIASNTARFIDERIVIISRELGDVENKLTTFK--QEHRIV
A0A7K3KG59      DAILTSILQVYNETIVEDKNRIASNTARFIDERIVIISRELGDVENKLTTFK--QEHRIV
R9I0H0          DAILTSILQVYNETIVEDKNRIASNTARFIDERIVIISRELGDVENKLTTFK--QEHRIV
K5BUT9          DAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFK--QRNQIV
A0A174FPA3      DAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFK--QRNQIV
R6S9Y6          DAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFK--QRNQIV
A0A7J4YSB2      DAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFK--QRNQIV
C9KX15          DAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFK--QRNQIV
A0A6H0KRK1      DAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFK--QRNRII
R6DAG6          DAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFK--QRNRII
A0A3L8AAP1      DAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFK--QRNRII
A0A4S2AYX2      DAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFK--QRNRII
A0A7J0A2L4      DAILNALINVYNETIIEDKNRIAVNTAKFIDDRIAVIGKELGDVEEELTDFK--QRNRII
A0A7K3MN31      DAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFK--QRNRII
R6CQ93          EDVLNTLVNVYNEEAVNDKNLVAVNTSKFINERLIIIQRELGGVETELESFK--QSNQLM
A0A3D1NQW3      EDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEKFK--KDNKIY
B0MT10          EDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEKFK--KDNKIY
R7JGW9          EDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEKFK--KDNKIY
A0A3D2BF46      EDVINTLIARYNDESINDKNRIADYTADFIDKRLRIIGSELDAVDRKISTYK--KDNEMY
A0A358R538      EEVIDALVAVYNEDAVEDKRRISVVTSDFIRARLDVIGRELGDVDRGIEELK--RSNRMI
A0A1Y4AAB8      EDVINTLITVYNNDAIADKRRISEETADFIHSRLEIIGSELNDVDRDIENFK--RDNRMV
A0A1Y3WWY9      EDVINTLIDVYEKDAIDDKRRVSVTTAEFIKSRLEVIGRELGDVDRDIENLK--KDNQMV
A0A1Y4U5L4      EDVINTLIDVYEKDAIDDKRRVSVTTAEFIKSRLEVIGRELGDVDRDIENLK--KDNQMV
A0A1Y3VCJ1      EDVLNTLIEVYEQDAINDKRRVSVSTAEFIKSRLEVIGRELGEVDRDIENLK--KDNRMV
A0A1Y3QTW7      EDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIK--KSNQMI
R6XWY7          EDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIK--KSNQMI
A0A4Y1X9Y9      EDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIK--KSNQMI
A0A4Y1WM66      EDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIK--KSNQMI
A0A6N4GYT3      EDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIK--KSNQMI
A0A174AVF1      EDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIK--KSNQMI
A0A1Q6EIY0      EDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIK--KSNKMI
A0A5B5VN71      EDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIK--KSNKMI
E4M8L3          EDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIK--KSNKMI
I3YQ50          EDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIK--KSNKMI
R5UEY8          EDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIK--KSNKMI
A0A1H4D866      EDILNTLISVYNEDAIDDKRRVSVTTAEFIKARLAVIGRELGDVDRDIEDIK--KDNQMV
A0A5B3G4Y7      EDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIK--KDNRMV
A0A374A9J5      EDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIK--KDNRMV
A0A5B3GQN5      EDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIK--KDNRMV
A0A1Q6E9S3      EDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIK--KDNRMV
D4IJ36          EDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIK--KDNRMV
A0A414Q925      EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
A0A415PUS9      EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
A0A108TCU0      EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
A0A413BA42      EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
S3Y344          EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
A0A7J5LEW3      EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
A0A412TGL3      EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
A0A413VJ33      EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
A0A414L0W6      EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
A0A412DP39      EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
A0A413ZSE8      EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
B0NP84          EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
R6AK43          EDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYK--KKNRLT
A0A412N2D9      EDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATVDAEIENYK--KKNKLT
A0A1Y4JYS9      EDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATVDAEIENYK--KKNKLT
R6LHA4          EDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIETDLATVDAEIENYK--KKNKLT
A0A3E5HPT8      ADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIEDLK--RANNGV
C6IJ48          ADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIEDLK--RANNGV
Q8A3U2          ADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIEDLK--RANNGV
A0A3R6S1H6      EDIINTLIVVYNEDAINDKNQVAINTSNFINERLIIIEQELGGVESEIETFK--KENLLT
A0A3R6SD81      EDIINTLIVVYNEDAINDKNQVAINTSNFINERLIIIEQELGGVESEIETFK--KENLLT
A0A354WXN6      DDVLNTLIAVYKEDVINDKNQVAVNTSNFIAERLLIIEKELGSVDANIESFK--RENQLT
A0A7G1HW11      EDVINTLIAKYNEDAIADKNRLAVNTARFIDDRLEIISQELGDVDSQIETFK--KENELT
R5IP14          EDVINTLIAKYNEDAIADKNRLAVNTARFIDDRLEIISQELGDVDSQIETFK--KENELT
A0A316SZX7      EDVINTLIDVYNLDGTNDKKKVAESTANFIDERLLIIGKELGEVDSEIANFK--STNKLT
A0A1Y4AIY1      EDVLNTLIAVYNEDAIEDKNRITVSTSEFIAERLVIIEQELGSVDTDIETFK--REHQLT
A0A0J6CIR2      EDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYK--RENQLT
A0A3D8HG59      EDIVNTLIAIYNEDVINDKNQITVNTSDFINDRLIIIEKELGNVDSHIESFK--RENQLT
A0A3R6S408      EDIVNTLIAIYNEDVINDKNQITVNTSDFINDRLIIIEKELGNVDSHIESFK--RENQLT
F3ZRU7          EDILNTLIDVYNEEAINDKNQMAMNTSEFINERLIIIEKELGGVDTQIETFK--KTEKLT
A0A1C5Q1F3      EDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGVESQIADYK--SQHNLA
R7A239          EDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGVESQIADYK--SQHNLA
A0A3R6HIK7      EDVLNTLIAVYNEDAIEDKNRVTVSTSEFIADRLVIIEQELGSVDANIETFK--RENQLT
K5ZVW7          EDVLNTLIAVYNEDAIEDKNRVTVSTSEFIADRLVIIEQELGSVDANIETFK--RENQLT
A0A1Y4D5Z0      EDVLNTLIAVYNEAAIDDKNKVTISTSDFIADRLVIIEQELGDVDANIEAFK--RENQLT
A0A413VXJ7      EDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFK--RENQLT
I9RSN9          EDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFK--RENQLT
U6RJK5          EDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFK--RENQLT
A0A1Q6GA32      EDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFK--RENQLT
I9RPU6          EDVLNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFK--RENQLT
I8YFS5          EDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFK--RENQLT
A0A7J4XCM0      EDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFK--RENQLT
I8Y597          EDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFK--RENQLT
A0A1Q6GBF5      EDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFK--RENQLT
I8YFZ3          EDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIENFK--RENQLT
A0A7J4XFW0      EDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFK--RENQLT
A0A1Q6GDH2      EDILNMLISVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFK--RENQLT
U6RSB0          EDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFK--RENQLT
I9GXM2          EDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFK--RENQLT
I9SIK1          EDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFK--RENQLT
A0A7J4XIJ5      EDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFK--RENQLT
I9TP59          EDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFK--RENQLT
R5S343          EDVINTLIEAYNEDAVNDKNQIAINTASFINERLKIIDRDLGLVDSSIASFK--SEHRLT
A0A1M6K7I9      EDILNTLISVYNEDAINDKNQIAVNTSNFINERLIIIEKELGTVDADIESYK--RENQLT
A0A5M6A8C8      EDILNTLISVYNEDAINDKNQIAVNTSNFINERLIIIEKELGTVDADIESYK--RENQLT
A0A7J4XCJ1      EDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFK--RENQLT
A0A7J4XNQ7      EDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFK--RENQLT
A0A3R5ZMK1      EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
A0A7K1HMX0      EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGSVDSDIESYK--REHQLT
A0A1Y3ZIA4      EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
K5Y1A4          EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
A0A7K1HDC0      EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
A0A3R6K8X4      EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
A0A6N8D6C8      EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
A0A3R6BKI7      EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
A0A412M2W1      EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
K5ZX55          EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
A0A415BDM7      EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
A0A1Q6I3T6      EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
A0A414XX40      EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
A7AEU7          EDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYK--REHQLT
A0A5F0U645      EDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFK--RENQLT
K5ZBN2          EDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFK--RENQLT
A0A0J6CKW3      EDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFK--RENQLT
A0A0F5IQM7      EDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFK--RENQLT
A0A496CDT3      EDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFK--RENQLT
A0A6G1ZKM3      EDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFK--RENQLT
S0GLB0          EDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFK--RENQLT
A0A3R6NLC1      EDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSVDAEIEVFK--RENQLT
A0A416WYC9      EDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSVDAEIEVFK--RENQLT
A0A7W7AX81      EDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSVDAEIEVFK--RENQLT
A0A0F5IT40      EDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYK--RENQLT
A0A496CX20      EDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYK--RENQLT
A0A5F0UBI0      EDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYK--RENQLT
A0A6G1ZHG0      EDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYK--RENQLT
S0GSI7          EDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYK--RENQLT
K5YB65          EDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYK--RENQLT
A0A0F5IWP9      EDVLNMLIAVYNEDAINDKNQVTVNTSDFINDRLIIIEKELGSVDADIETYK--RENQLT
A0A0F5IZT8      EDVLNMLIAVYNEDAINDKNQVTVNTSDFINDRLIIIEKELGSVDADIETYK--RENQLT
A0A417LKQ2      EDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEKELGSVDADIETYK--RENQLT
A0A416TME1      EDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSVDADIETYK--RENRLT
A0A7W7F3X3      EDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSVDADIETYK--RENRLT
A0A416XPE8      EDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSVDADIETYK--RENRLT
A0A3B0C2S4      ETVINELINKFNQDGIIDRQLISKRTLEFIDERFAYLSGELDSIEVGKEDFK--RLNNLS
A0A5M8NYX7      IDVINTLIGIYNQRSIAEKNYVANHTIDFINDRITTITEELSSSEQKVEEYK--QVQGMT
A0A1M6GR99      EDIINELIQVYSESNLEKKNHLANMTLEYIDEQLDEVSASLNLTENNLQKFM--SQNKLM
A0A7C5M4P4      QALVSAIDTLYYKYSLEEKNRANRNKIEYLESQLIETEKKLDEYEKYFEDVT--ITNKTV
A0A1W2GF52      RNLLQAIDTIYLAFTKNAKNQAVEQKIRFLETQMAKTSKELVEYEDYFEKFT--IKNRTT
A0A2G5L7B8      RSLVQAIDTIYLNYTKAAKNQAVEQKISFLETQMYKSQIELEQFEDYFEKFT--IKNRTT
A0A2D8JJW3      ANIVSCLIDSYVEEEKKHANQKTSDQIIFLKNQILSNSDSLLKMKDEIQKFQ--QAEDIL
A0A6B5PK86      HDVTLAVANTFIDYSVKLKKKSSESILQFIEVQLDSLSTELKRSKDSLMDYQ--REVNLS
A0A2G2F510      KDITLAISNSYISFDEDMQRKGSENILGFIDSQLDSLSNELKSSKDSLMIFQ--RKSNLP
A0A316JZ08      RDLSLAIAEAYQEYDEEINRKSSENVLSFINNQLDSLYFELQSSQDSLADFH--SKSSVV
A0A2W1NDY9      QDMVREVVETFFTYDLEKKSKSSESILSFIDEQLDTVYNSLKFSENSIQSFT--NISKNN
A0A5C8AQR5      NDIVSAITSAFFEYDESLKKQSSDNILQFIESQLDSLALELKLSKDSLTDYQ--RSSNLP
A0A1G0CI31      HDITNAVAEAFFTYDEEVKRKSAENILQFINKQLDSISGELQISKDSLTLFQ--RSAQLN
A0A556N0M0      KDIIQSVATTFFNYDEEMKRKSADNILSFIQLQLDSISGELKDSKDSLTDFQ--RKTRLT
F2IKD6          RDIIKSVSLTFFNYDEEMKRKGADNILAFIQIQLDSISGELKDSKDSLTDFQ--RKSHLT
A0A1I7BM74      QDICNAVGESFFDYDDHLQQESSEKILKFINAQLDSLNKELILSRNALTEFQ--RRENLS
A0A2G2FJ17      QDITKAIGDAFFEYDERYTKESAENILSFISLQLDSLRKELSASKDSIMYFQ--RKENLP
A0A1H4ADG3      IDIMNGLIHVYQLSNIEDNNRITDSTIEFLNNRLFTVGAELDSIEGNIQHFK--QHNELA
A0A5B8VUR8      IDIINGLIHRYQLSNIVDNNRIADSSIEFINNRLVTVGAELDSIEGNIQHFK--QSNDLA
A0A1V5IPN7      MAAVNAIADAVQQQNTQMARLEFTTIREFLGEQLDLISRRLQISEDDLRAFK--NENKLI
A0A7G7G5F9      KDIINKLIEVYNKEAMEDKNSIATNTIQFIDARLKDLTGELSDVERNVEKYK--SQQLLT
A0A2N3U785      IDLVYHLISLYNKDKANDKKASAVNSLSFLDERIKFLSSELTDVEENVERYK--RSNEVT
A0A0D3L8Q3      KDILNKLIEVYNKEAVEDKNVIAANTIEFINERLQFLTEELTDVEKDVEEYK--RERRLT
A0A519U664      KNIINKLMYVYNRESIEDKNLMAVSTLKFLDERLRLITAELSGVEKGVEKFK--SQNALT
A0A519MA34      KNIINTLMHVYNSEAIEDKNLMAVGTLKFLDERLRLITAELSGVEKGVEKYK--SQNALT
A0A519UCX0      KNIINKLMHVYNNEAIEDKNLMAVSTLKFLDERLRLITAELSGVEKGVEKFK--SVNALT
A0A5B6TJH8      KDILNKLVEVYNKESIEDKNVLATNTLAFIDERLKYLTTELTGVEKNVEQYK--SQNEVT
A0A7Y0AA98      KDILNKLMSVYNREAVEDKNLMTDNTLKFLNERLQYLTTDLSGVEKVVEKYK--SVNGLT
A0A0E3ZG78      KDIVNKLIEVYNKEAIEDKNLIASYTIDFIDERLRYLTSELSGVEKDVEQYK--RQHELT
A0A1I6BRK6      KNIVDKLMQVYNDEAIDDKKQLGTSALKFLDERLKFVTTELSTVEKGVASYK--STNSLT
A0A243WAB1      KDILDKLMEVYNDEAVVDKNLMATSTLKFLDERLKYITAELSGVEKGVEKYK--SVNGLT
A0A6G8C8X6      RNIINKLIEVYNKEAIEDKNLMATNTLKFLDDRLKYITAELSGVEKGVEKYK--SIHGLT
A0A4R5DL69      EALLKKLTENYLSTSITDKNRIADSTIAFIDQNLHLVSLELKDIEEKIESFR--RKNHIT
A0A1M4YED3      KDVLNELMNVYTINGLSEKDALAANTLATIEKRLTFVAKDLDSIERTIQQYK--SQKGIV
A0A7T9DAA2      KDFLNSLMATYIKHEQDKQNFKGERTVKFIEKQLDASSAQLDAAKSAMVNAE--TAAGG-
A0A7Y5V8S3      RNYLNKLMETYIEGELYKQQQKGLKTINFIDNQIGTVSDSLRQVESSMESFR--GSSGG-
A0A126PFG0      MDVLNQLMAVYNGAATAAKNKLTANTLHFIDSRLASLRGELSQAEADEAGYR--SQQGLT
A0A7V5VRT5      QKFLQKLLEHAREYERSLRQVQYQKAIEYVDTLLYVVRANLSQAQ--DSLFR--KEQALD
A0A3M1N7Z3      TRFLNALIEQAREHERSIRQLQYTKALGYIDTLVNFFQNQLLVAQ--DTLYR--VETKED
A0A7V1R2A1      ARFLNALIEQAREHERSIRQLQYTKALSYIDTLLNFFKNQLLVAQ--DTLYR--AETKED
A6EBM4          ADILNAILQEYLDYDKLQKTQSATQMIGFINEQLKHLSSAVSGAEKSLETYK--QQSKVM
A0A7X8C760      VDFINKLSETYLEENLKKKNDVASKTIQFINEQLSEVSKSLSVSEDEMTRFR--KDNQII
A0A501VZX6      EDILNTLIYTYNSIAINERNKLAANTLEFVEDRIKLVEEELKDLENKVVKYK--SSEGVV
A0A399SH26      EAILNLLVHNYNQASVVERNILAENTLAFIEDRMQKVEKELDKLESRVQKYK--TSKGIV
A0A501W1A9      EDILNSLIKAYQQAALNERNQAVAQTLAFVESRIQLLEKELQGLEEKIVEFR--STKGAV
A0A0E3ZGV6      EDILNALIHAYQKAAVTEKNSLVSQTLAFVEERIQLIEKELQNLEDKIVKYK--STQGAV
A0A1I2N4S1      EDILNALIDAYLQAAQVDRNALVSQTLAFVEDRIQLIEKELKVLEEQIVKYR--ASNGAV
A0A2T5YE44      EDILNALIDAYLQAAQVDRNALVSQTLAFVEDRIQLIEKELKVLEEQIVKYR--SSNGAV
A0A4Q8RX32      IDFLEQYVVTIIEDNLDRKNYIAHTTIDFIDNQLSQVFDSLNLAEKSLQEFR--TQKQVI
A0A1M6TTV4      KSLLQAIDTIYLNFTKAAKNLAVEQKISFLDRQMKKTQVELEQYEDYFEKFT--IQNRTT
K0X1U5          KDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVEEELHEAERIVERYK--RENDLS
R5EXK3          KDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVKEELHEAERIVERYK--RENDLS
A0A401UAP7      MDIVNKIVNIYLGFSNEQKNFANKHKIDWVNNELEQIEEKMSQYEDYFKDFT--LKNKTQ
A0A523GAC0      RDLVSAIDTIYLTYTKEEKNKANQQKIDFLDDQLLLTQSKLQDYESYFESFT--IRNKTT
L8JW09          RDLVNAIDTLYLKYSEEEKNLENKQKIEWLNSELRQIETQLEGYEHYFENFT--IKNRTS
A0A364XUP5      RAILQVIDDVYLKYSHEQKNLANKQKIDWLNNELQQIEEKMEGYENYFKHFT--LQNKTN
A0A1M5RLA9      TAILNKIDSIYLHYSYEQKNLANKQKIDWVSNELVNIEHKMEDFENYFENFT--LQNKTN
A0A385SFR9      TAILNKIDSIYLHYSYEQKNLANKQKIDWVSNELVNIEHKMEDFENYFENFT--LQNKTN
A0A5M4A9J4      ISFLNKLMEVYQQQNLDKKNEMATRTIQFISSQLGSVSDSLTASERHREQFQ--SRNNLL
A0A5M4B1C7      IDFINQLMEVYQDQNLEKKNAMATRTIQFISSQLSSVSDSLVKSEQRRESFQ--SKNKLL
A0A0D3LFR6      RVVVDAVSNMYLTYKEEEQIKANNQKIAFLNTLVEDAESKLEGYETYFEDFT--ISQRTT
M7N6D4          KVLVDVLSNMYLGYTEEEKIKSNSKRIAFLDEQVEETEAKLEDFESYFENFT--IDYKTT
A0A5C7MX19      RDITNMMVRVFVEYDMEKKREGFENVISFLNVQIGQFEEGNTAFEDSISALR--VQFGYM
A0A1M5BA90      ENILNTLIQAYYRSAAKEKNVLAANTLSFIEGRISNVAKELDSIENRLQKFR--NQKGVV
A0A512B879      KEILNLLISEYNQAAINDKNLLTSNTLSFVETRIKYVVRELDSIENQLRKFK--TDKGVV
A0A559PPI3      EDILNGIIAAYNQNGIEDKNILAANTMKFIEARIRNIGNELDTLESENEQYR--SSKGVV
A0A1T5CS78      ENILNRLIYQYNQKIIKDQNELALSTMTFIDERIENVEEELDELEYKIQQYK--SNEGVV
A0A0Q9Z8F1      ENILNRLILEYNRKIIKDQNELAASTMTFIDERIENVEAELDELEYNIQEYK--SNQGVV
A0A2N0U0M7      ENILNRLILEYNRKIIKDQNELAASTMTFIDERIENVEADLDELEYKIEEYK--SNQGVV
A0A1Q3ZMZ7      RDVVNVIIDEFFAFDEMLKKQSSENVLNFLNNQLDSLAIELNKSRDSIVFFQ--QKNKLN
A0A7Y3KMD1      SDIVNEMAQEYIKFDLEKRRKSAENVLNFIDEQLNTVYGRIKTSEEQLDTMH--KVKKTD
A0A3C1ITV0      EDVLNTLLDAYNEEWIRYTNKSTDNTAKFIDERLMSIERELGNVDSDIERFK--SSNRLL
R7HN19          EDVLNTLLDAYNEEWIRYTNKSTDNTAKFIDERLMSIERELGNVDSDIERFK--SSNRLL
A0A2W2AFF7      EDALNKLINVYLQANVDDKNKIADSTMRFIDDRVALVGEELTGIEKKIEAFK--KENELT
A0A845PZ37      SDIITMLIRVYNEVTLQDKSRIATNTANFIKDRLAIIESELSAVELNIENLK--IANQGV
A0A077ENE7      ADILTSLITVYNDVYLQDKSKIAENTADFIKDRLAIIEGELGAVESNVENLK--IANQGI
A0A854FRG7      ADIITMLITVYNEVSLEDKNKIAVNTASFIKERLAIIESELGAVESDIENLK--IANKGV
T0NN57          ADIITMLITVYNEVSLEDKNKIAVNTASFIKERLAIIESELGAVESDIENLK--IANKGV
R7PCR1          EVLLSTLLDVYREDIIESKNRVAENTSKFIEERIGLIEQDLIKVEGSLARFK--EKYNIV
A0A2N5YXE2      AEITNTIAEKFIEFDENKKKESANNIITYIDQQMENVFLQLTNTEQNLHDFK--QQNNIR
A0A2U1FKU2      KDFINTLISSYNDDVMNDKKSVAVSTATFIDERLAMIGGELGSVDTEIETFK--KQNNIT
A0A0A2F954      KNFIDALIASYNDDVMNDKKSVAISTASFIDERLAMIGGELGSVDTEIETFK--KRNNIT
A0A0A2FW91      KNFVNTLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGSVDTEIETFK--KSNNIT
A0A2D2N2N1      KNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFK--KRNNIT
Q7MWZ2          KNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFK--KRNNIT
A0A212FSE5      KNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFK--KRNNIT
T2NDT6          KNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFK--KRNNIT
A0A1R4AFZ0      KNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFK--KRNNIT
A0A1R4DVZ7      KNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFK--KRNNIT
A0A1V9FHD0      EDIMNHLLLAYNQLSIDEQRGTAANTLAFIETRLKSVRHELDSIEGKIQTFR--TNQGVV
A0A4V4H170      EDILNKLLVAYNRLSIEEKKGTAANTLEFIETRLGRVEKELDSIEHIIQSFR--TDKGVV
A0A1V9F098      EDVVNKLLVAYNRLSIEEKKGTAANTLEFIETRLAKVEKELDSIEQRIQTFR--TDKGVV
A0A4R2VU64      EDILNKLLVVYNRLSIEEKKGTATNTLEFIENRLFKVERELDSIEQKIQTFR--TEKGVV
A0A0K8QSK7      NDFLNKLVEVYQRDNLNQKNEVANRTINFIHSQLGEISDSLSISETEMLQFQ--SDNRVI
A0A7C0WKI7      AFLTNKIAHGYQVLDRNQSRGEISEVVNFLDKQLSQKSKDLKNSEEALRQFQ--QNTGIV
A0A1T5K9D4      NDILTAIVYRYNEEAVKEKNKVAVNTAEFIDSRIKIIRKELSDVEDMMSGYR--STKKLL
A0A5M4B212      IDFLNKMMQVYQTRNLDKKNVIATKTIFFITSQLASVSDSLSASQKVRERFQ--SHNNLL
A0A3D1KEX9      EAILTVLMDLYKRDIVESKNSVAANTAKFVDQRIDLIGSELNDVENKLAKFK--QNNKIV
A0A358Y7S2      YDITKTLIEQYLFFQEEMNIKNAKKTIDFIDYQLDSLSRVLEISKEDLANFQ--KRERLP
A0A2J6HHN3      TDIVNAITTEFELFEIEEQKQSSESILEFIDGQLGIVEENLTESEDSLYKVSVASPDSL-
A0A1Y3WMT8      QDILDTLIECYNEDAVLNKNLKAQNMLSFIDDRLATVENELHEAERVIEQYK--RENDLS
A0A1Y4GQU1      QDILDTLIECYNEDAVLNKNLKAENMLAFIDDRLITVENELHEAERVIEQYK--RENDLS
A0A6A0R272      KDFVDALVSSYSNVEFELKALAASNTIRFIDERLDQLSSTMNEVEDQITQFK--QDKRII
A0A1V5W8T5      SDLVNTISEDFLTYNIEKKQERAEKVLAFIEEQMSVVYNKLDESEKQLDQFK--KSNNIT
A0A2T8HKA9      TDLIKTLIEVYNEQTVEEKNRVAVSTADFIRERIAIIERDLGTVETDLERIK--MDNKGM
A0A1X7J248      QEIVETVSELYTEYSKEQKNKANQLKIQFLNKQLKQTESELANYETYIEDFT--IENKTI
E4TQD2          QAIVEQVSELYTKYSKEQKNKANQLKIEFLNKQLKQTENELSNYETYIEEFT--IKNKTV
A0A2I0QZ80      KDIITALTKSFFKYDEGLKKESAENVLGFIASQLDSLTRELSISKDSVMRFQ--RNENIT
A0A3E1F1A3      TDMVKSLVSNFFNYDEDLNKESADNILDFINQQLDSLTQELSVSKDSIMYYQ--RRENIT
A0A2U2XBJ3      KEMIQSLTANFFKYDENIKKESADNVLEFIAVQLDSLTRELKMAKDSIMVYQ--RMENIT
A0A4Q4KU94      MEIVQSLTANFFKYDENIKKESADNILDFIAVQLDSLTQELKVAKDSIMAYQ--RQENIT
A0A3B8INU3      QDMVGAITSIYQTYTKDQKKQANQQKIEFLDDQLMQTEERLDRYDKYFENFT--ISNQTT
A0A7V6V2N8      VDFLNTVIQEYKFFDVEQRTMSARSMLEYIDQQLESLEDIIKQQ----------SGNDNI
A0A414ZBF2      EDVLNTLIEAYKNDAIEDKNKVVINTANFIKDRLTIIEADLGVIDTEIEDYK--RENKLT
A0A7X9D3Q8      EDVINTLIEVYKNDAILDKNQVLESTANFIRERLIIIEAELSDVDSKIEQYK--RDHQLT
A0A1Q3Q573      KDIANALATEFIDYDLNKKREGMGNILRFIDGQIDSFSREQQAIQDSVAQFK--INNEIF
A0A662BAY3      IDFLNTLVAVYQAYTLERKNENASRTINFISTQLQTVSDSLGISENAMQAFQ--SKHKLL
A0A4U3L369      EFILNYFIQRYLRSSLEQRNQIADSTLSFINERLGIVTGELGNVEKQIALYK--GNNKII
A0A4S8HY23      EDILNKLLIAYNLLSIEEKEGAAANTLTFIETRLSKVEKELDSIERTVQSFR--TDKGIV
A0A1V9F383      EDILNKLLIAYHLQSIEEKKGMAANTLEFIEARLLKVERELDSIESVVQTFR--TDKGVV
G8TRZ6          EDILNRLLTDYTQQSIDEKQDQATNTLNFIEVRLGKVERELDSIESVVQTFR--TDKGVV
A0A357YNR3      RDFLVKYIQTYNEKGIADQIELADKTSRLIDDQLSKLSGELSDVENQVQIYK--QSQGIT
A0A7X6YKE8      RDFLVKYIQTYNEKGIADQIELADKTSRLIDDQLSKLSGELSDVENQVQIYK--QSQGIT
A0A5E8AX52      RDFVTAIDTLYLKYTTEEKNQAIEQKLSFLDEQLGITERKIEEYEDYFENFT--IENRTT
A0A1V6CN82      VDFLNKLVEVYRIDNVEKKNQYADQTINFIEYLLEGVSDSLAVAEGELLSFQ--SRNRIF
A0A1M4XZ45      VAFLNKLTEVYQLDNLEKKNENANRTIHFISSQLQSISDSLSVSENRMETFQ--SENQVL
A0A399D319      VDFLNKLTEVYQLDNLEKKNENANRTIQFISSQLQSISDSLSISESRMETFQ--SEHQVL
A0A7Y1YS85      EDLINTLIDVYNTADVNDDTKVLRNTIEFIDQRVARLTEELNAVEGDIERFK--SENQII
F4KK08          EDFLSTLILVYTELERSDKVKIAESTQRFVDDRLAIISSELGQVDAEIEDFK--QSQQIA
A0A7V5VE02      AFIVNTLTEAYREKNRLMSQEEVRQVKDFLQEQLDIIQKQLTESENALKEFK--ENEKVV
A0A496LCF9      VDFLTQHAKSFLGDNLDKKNYEADKTIQFINSQLSIISDSLTQSESNLNSFK--IANNMY
A0A5P2G2A9      EDVLDTLIKEYIKSNKDQKNAYADSTISFINDRLGLVSGELTNAESGLADYK--KKNNIA
A0A3C0ZQC7      ALIANTFAEAYYDRNLFSSRSRSRAAREFLDTQLKVRKSSLDESEGTLQKYM--EQKGIV
A0A3N2N6F7      DDFLSALIDIYNEKWVEQKAQMAVATSEFINERLNVIEKELGHVDDNIATFK--GEHLVP
A0A419VXB7      ISYLNELSRVYIQYGLQQKNQISDNTIHFINQQLKDIVDTLKSTSNEFTKYR--SSNKVF
A0A1Q6E6I7      AALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFK--SDNSAV
A0A3B9CNN6      AALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFK--SDNSAV
R5X290          AALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFK--SDNSAV
C3J7R8          EDFLNTLVQIYNENSRMEKVRVAQKTEHFIDGRLAIIGGELGSVDTEIEQFK--QNNRIA
A0A1G8BVM8      EDIINTLVTVYEKNAIDNKNQVLSKTVDFITDKTTILENELRSIDSDIEQYK--KEKNLT
A0A1I1FXP9      HDIMVTIDSVYLEQTLEQKNKVNEQTLAFLNSQLDTTAQKLAMSEKEVERFI--QVNRVI
A0A4P7VVU7      DDFLNTLIDIYNEKWVDDKAK-AKSTSRFIAERLRVIEQELGNVDSDIADFK--GEHLVP
A0A2V1ILM4      DDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADFK--GEHLVP
A0A3N2L0E8      DDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADFK--GEHLVP
A0A3N2LFC5      DDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADFK--GEHLVP
A0A7K3KWJ8      DDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADFK--GEHLVP
A0A3N4H5N3      KDIMSSVINGYNFLNLNQKNEVALKTINFIDERLALAREELNQVERDAEQYK--QRNRIT
A0A2P8EAX2      KQILNSLIEGYNTSNQNQKNEVALKTIKFLDEKLFLAKKELDSLEMYVERFK--QRNRVT
A0A4V2F6N9      KQILNALIDGYNSSNQNQKNEVALKTIKFLDEKLLVAKKELDSLEMYVERFK--QRNRVT
A0A838T9G8      TDIVNAVCEEFIRYDKEKKTESATLILNFIEAQVDSISNDLRNYEDQMTAFK--LANGIA
A0A3B9FXJ0      KDVVNTIADAIVTNGLERKSVSANSIISFIQSQIDSLENELYIQENILKDFK--KDAQLI
A0A848SUJ0      NDIINAITQEFLQHDKERKAESIFNVLDFLNQQIDTFGSKFVEFQDTVKYFR--LETGFV
A0A847ALW2      RTFLNKLIEVYQTDNLQKKNENANRIIQFINTQLQTISDSLIISENKKETFQ--SENQVL
B2RKZ8          KDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFK--KSNNIT
A0A0K2J6Z0      KDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFK--KSNNIT
A0A212GC82      KDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFK--KSNNIT
A0A0E2M2Y7      KDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFK--KSNNIT
A0A829KSZ7      KDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFK--KSNNIT
R5GSU5          EDFLNVLLDVYKEDIIDGKNRIAESTAIFIDSRIKIIGDELNDVEGSLARFK--ERNQIV
A0A7X8I6A2      AEVVNVITDVFQKYEVVKKGESVQNILKFIDKQLDIVYNNLDIVESDMHSFK--KKFNIS
A0A0A2G557      EDFLNTLISQHDATSRSEKLKIAHNTEAFINDRITIISKELGDVDQEIERFK--QNNQIA
A0A1T4PT95      EDFLNTLINEHDTTSRLEKLKIARSTEAFINDRITIISKELGDVDHEIERFK--QNNQIA
A0A6I6JYY3      IHFLNKLTEIYQLDNLGKKNDNANRTIQFINSQLQNISDSLNVSENRMASFQ--SENQVI
A0A651GU15      RDFVMAHAHQYLQYDQESRELSASNIIRFIDNQIEEVYNELRETEFELSMFM--KDNKIS
A1ZKR2          RDIVHVIDTIYLHKTLENKKRANTQQKAYLNRRLGEIEDSMRTYEAKIQSFM--LKFKTN
A0A1Q3GX01      SNIVHVIDTIYLQKTLENKKRANIQQKEYLNRRLNEIEDSMRNYEGKIQAFK--LKLKTN
A0A349DQI4      KHIVHVIDTTYLQKTLENKKRANIQQKKYLNRRLNEIEDSMRNYEAKIQGFK--LKLKTN
A0A4P5TMD1      VDIINTLQEEFIKYNKERKTESSSLIIDFIDTQIGLLNTELQAYENQLKAFK--IEHSLI
A0A3Q9FR88      VAVLKAINTAYSQLSRESKALVYERALTYLFKQIDTTKDSLALQEKKMRAIS--YGKDLS
A0A553GEX3      VAVLKAINTAYSQLSRESKALVYERALTYLFKQIDTTKDSLALQEKKMRAIS--YGKDLS
A0A150ADJ9      IAILQSINLAYSQLSREGKALVYERALDYLYNQADLTRDSLSLQEKKLREIS--YNKDLS
A0A7X9P1P7      IAILHAINLADSQLSREGKALVYERALDYLYTQADLTKDSLSQQEKKLREIS--YNKDLS
A0A7X8SM94      VAILEAINKAYSQLSREGKALVYERALDYLYSQVDITKDSLNKLENQMRALS--YSKDLS
A0A1S1Z228      EAVLEAINKSYGQLSREGKALVYERALGFLYSQIDITKDSLNNLEKTMRELS--FNKDLS
A0A1B1FWQ4      ERVLEAINKAYSQLSREGKALVYERALEFLYSQIDITKDSLNNLETKMREMS--FNKDLS
A0A7X9Y5D2      ERVLEAINKAYSQLSREGKALVYERALEFLYSQIDITKDSLNNLETKMREMS--FNKDLS
A0A7X8ISG0      SIIVNAITREFQKFYLEKEQESYTNILKYIDEQLIFWEEEVHRSEKALDDYK--KENNID
A0A2N3IIZ0      RDVLKSISEVYRVKSVEIKNRANRQKKEYLDAQIEKTEKELNAYEAEMERFI--IQNKTN
A0A7X8Q7Q7      TDIVNQVSKEFSDFEIEYQKNSSINILEFIERQLSEVEKNLNEARDSMNLNKASQIDTSI
A0A2N2WFW8      ADLVNKVAEEFAAFEVEYQKESSNSILDFIDTQLGLVEDNLDQTEDSMRQGKNMSFDSTL
A0A1F3IU95      ADVVNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQTKDSLQQSSAPSVDSSL
A0A3D0VUF6      ADVVNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQTKDSLQQSSAPSVDSSL
A0A7K3WUF2      RDFVVAHSSEYIQFDLENREKSAKSILKFIDSQLDTVYQNLRDSELQLNVYK--KENKIS
A0A497D5Z2      VAFLNKLAEVYEQYNLGKKNENASRTIKFITSQLASISDSLSISEDLMQDFQ--SKNKII
A0A662B170      VAFLNKLAEVYEQYNLGKKNENASRTIKFITSQLASISDSLSISEDLMQDFQ--SKNKII
A0A7X7FWB7      SIIVNTITKEFQNFYLKKEQESYTNILKYIDEQLLYWENEVHRVEKELDDYK--KRNNID
A0A7X8DM61      SIIVNAVVEEFKNFYLEKEKESYTSVLRYIDEQLLYWEEEVRNTEKALDEYK--KEHSID
A0A3M1CDV2      TDIVNTIAEEYLIYDVERKSESSKNILNFINAQLSVVYEELKNSETKLNEFK--KQNNIV
A0A1F3SJM1      HDVTLAISKAFQEFDEESKRQGADNIIRFIDNQLDSLRKELKSSKDSLMFFQ--RSANLP
A0A2G2EB96      RDVVNAVSKSFIEYDEEQKRKSSDNIISFIDDQLDSLSSEVRIAKDSLIRYQ--RKSQLS
A0A2G6PRA9      RDVVQAVSESFIEYDEEQKRQSSENIISFIDAQLDSLSSEVRIAKDSLIEYQ--RRSQLS
A0A7Y7A9N2      RDIVQAVSESFIEYDEEQKRQSSENIISFIDAQLDSLSSEVRIAKDSLIEYQ--RRSQLS
A0A6C1QGZ7      SDIVNIIAEEFGMYDLEKKTESANNILAFIDQQLSLLGSTLTTAEIELENFR--KEHGID
A0A7W1EH85      TDIVNAIIEEYLTFDVERKSESSRNILAFINGQLDNVFTSLKTTESELQAFK--KEKNFN
A0A2E3XZI5      KDICNSLAEIYIDYDLERKQLSSEKIVKFINNRKDSVQKKLILNEKKIRDFK--KLNDFE
A0A6I7QXV0      KEIVETLTKEYINYDLERKQESASQILNFLNNQIDVFSDDLAQFQDTIKKFR--IENRYL
A0A7Y3V126      KDIAETLANEFKLYDVEKRSQSSRKVLEFIEIQLDLAYNRLKLSETNLQQYK--KQNNLS
A0A7Y5C3U1      KDIAETLANEFKLYDVEKRSQSSRKVLEFIEIQLDLAYNRLKLSETNLQQYK--KQNNLS
A0A2M7NLQ9      AIVTNTVVDIYFEKTLENKNKVYRQTINYLEDQVRIVQDSLERIEKRIDNYK--QENGIT
I4AFR0          AIITNTIVDIYFEKTLENKNKVYKQTIDYLDAQTTIVQDSLEQVEKRMDDYK--LENGIT
A0A2N2Y3E5      SEIVNTISEQFLKYDVEKKKESADKILDFIENQSDLIYDELDKIEEQLILFR--KQNNIK
A0A2D9D7T6      RDMTQAIMDVFFLYEEEISKKNTDKILAFVDTQLDSLSTLLQKSKDSITSFQ--KKSKLS
A0A1F3PPL5      SEVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSETERQIHSFK--KENKIS
A0A357QK06      SEVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSETERQIHSFK--KENKIS
A0A7X9JJJ8      TEIVKTIAEEFINFDVEKKVESSKLILKFIEEQSKLIYRTIDSLEEQLLIFK--NSHNIS
A0A522EYA6      TDIVNSMAEQFKEYDREKKGESEQKILSFLEDQLAIAFERLRTAETSIYSFK--KENKVT
A0A662AEA4      SEMVNTIAEEYMKYDIEKKKESAQNILSFIDLQLKSVYKNLDHTEKQLHEFK--KENKLN
A0A0S2HYK8      ADLVNAVAREFQRFEVEKKKESIQNILAFIERQLKNVYKTLDTTESKLQEFK--KENNIP
A0A2N5ZWN6      ADVVNKIAQEFQLFDVEKKKESVKNILDFIERQLKNVYQTLDNTENKLQQFK--KDNNIP
A0A2E0FJ09      KDVLGALIENFDQFDSIKRSESSNRIVEFIAMQKDSVSKKLKESERMLKDFK--DTNKIR
A0A1F3FZ62      ADIANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKTESDLDMFK--RMNKIP
A0A1F3K211      ADIANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKTESDLDMFK--RMNKIP
A0A7Y1UDU0      ADLVNAVATEFIEYDVEKSSEVANRVLEFIDNTINNINDKLSTSENSLADFK--RQNKLM
A0A1V6I2U9      TEITNTIAEKFIEFDEAKKKESATNIIKYIDQQMENVFTQLNATEKDLHNFR--EQNNIL
A0A2H0B957      SEIVNAIAEQFIKYDVEKKKESSQKILDFIEVQNNLIYQQLDSIEQLLIKFS--ITHQIQ
A0A1F3CFW6      SEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQFG--ITHQIR
A0A2M7E2T8      SEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQFG--ITHQIR
A0A2M7NC69      SEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQFG--ITHQIR
A0A1F3KLL5      TDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDENEKKIHDFK--KSNIDS
A0A359D1M1      TDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDENEKKIHDFK--KSNIDS
A0A0F2NS19      SDVITSLANEYILYDIEERSKSSKKIIQFLDDQLDKYYNKVKLSENRIQDFQ--TSKKI-
A0A2A5H8X6      SDIITSLANEYILYDIEERSKSSKKIIQFLDNQLDKYYNKVKLSENRIQDFQ--TSKKI-
A0A2H0GAU8      KDIVTSLANEYILYDLEERSKSSKKVIEFLDDQLDKYYNRVKLSENKIQDFQ--SNNKI-
A0A2M8FTK1      KDIVTSLANEYILYDLEERSKSSKKVIEFLDDQLDKYYNRVKLSENKIQDFQ--SNNKI-
A0A2A5B3B0      KEIITAVANEYIDYDIEERSKSSKKALQFIDQQLDKYYNRVKGAENRIQEFQ--EGTNF-
A0A5C6RXM7      RDMVTAIAEEYIDFDIEERSKSSKKILEFVDIQLDKYYNKLKLSENKIQKFQ--KDNNF-
A0A7W1FWM4      SDIVSTMTDEYNSFDLERKSESSKHVINFIDEQLDAVYERLKLSETSIQNFK--KVYNV-
A0A7T9QP55      RDICQAMADAYITYDLERKSESAENILRFIESQKDTVFEELRASELKLEFFK--RDNRV-
A0A7V9MK11      ADIVNAITEEYLKYEVERKSESAINVLAFIDTQIEGVYGRLKESETSIQVFK--TENKL-
A0A1F3C1M2      SDVVNTISEEFLKYDVEKKKESDQQILAFIEDQESLLLKNIDQTEREIHDFK--QLNNIE
A0A1F3DS87      SDVVNTIAEEFLKYDVEKKKESDQQILAFIEDQESLLLKNIDQTERELHDFK--QVNKIE
A0A7Y5QSG1      RDLAEAMAETYIGYDVERMRESAESILRFIESQKDTVFDKLRESEYRMQAFK--MENKV-
A0A7Y2EX06      YDFVTAHAKEYLEFDEQRKKESAEKIVLFIDNQLDTVEGNLKNTELLLNSFK--RDNKV-
A0A7Y7NV14      SDIVNTISDEFNAYDLEKKAESANKILDFIDGQLEIVYDNLYKSETDLINFK--KSNNI-
A0A6A0R6K9      KDIVSSVIREFKVYNVEKKKQSSKQILEFLNDQIYNVYEKQRVSEKEIQDFK--RENFL-
A0A2E7CT70      QDVCNTISKVYIDYDLKKKALSSINIVQYINAQKDSVDKRLKLSEQEIQIFK--KANNV-
A0A2D5V560      KDICNSIVKNYMDYEIDKKQKSTDNIVSFITRQKDSVRKRLIRNEKDLRIFK--KNNKX-
A0A2D7K5A8      KDVCNSFVKIYMNYEINKKQKSTDKIVAFIKIQKDSVKNRLIKSEKDLRIFK--KNNKF-
A0A2E1XQ82      KDICNSIVEIYMNYEINKKQKSTDKIVAFIETQKDSVKNRLIKSEKDLRIFK--KNNKF-
A0A1F3K695      AEIANVIAEEFLTYDVEKKKESANQILSFIEEQESTFVKNIDETEKALHDFK--KENNIN
A0A353KZR1      AEIANVIAEEFLTYDVEKKKESANQILSFIEEQESTFVKNIDETEKALHDFK--KENNIN
A0A2N2WYB5      ADIVNTIAEEYLKYDVESKKESAESILAFIEERLKLVYQNLDETEKQLHEFK--KENKLN
A0A1F3K4G0      SDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFK--RENKIN
A0A356H8Y3      SDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFK--RENKIN
A0A351HSA6      SDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFK--RENKIN
A0A2A4PYG9      ADIVNSMASEFVEYDVEKKAQSATKILEFIDSQLLQVYDKLRSSENKMQGFK--RENKLS
A0A350JJ90      SAICEQIAQTYLVFDHERKSESANQVLEFINQQIEEVYSKLKISEDLMSEFS--QRTKLT
A0A2A4YXP3      VDIVTAVANEYIIYDIEERSRSSKNALQFIDEQLDRYYNKLRLSEDKIKDFH--QGTNYT
A0A1F3R158      ADILTSLANEYIIYDIEERSKSSKNVIEFLDDQLDKYYNKVKLSENSIEEFQ--KTNKLT
A0A2M8ADX2      ADIITALANEYIVYDIEERSKSSKKVIEFLDDQLDKYYNKVKLSENSIEEFQ--KTNKLS
A0A1J5B2H0      SDIVNTIAEEFVIYDIEKKAESTNKIIEFIDNQINRMYDTLAKSENQLERFK--KTNKID
A0A1V5N756      ADIVDTIISEFNLYDVEKQAMSTDKILKFIDEQLEIFNQKLFETKNDIQEFK--KENKID
A0A4P5U6G4      ADIVNAMNDEFISYDKEKKTESATLILNFIESQINLINAELQAYENQIKAFK--IQNGLI
A0A2E2TFD1      ADLANAISTGFIDYDLTRKIYSSTQVIEFIDSQISEVYGRLKESEVSIQEFK--LSNKVT
A0A2E4ELE6      ADLSNAISGGFIDYDLQRQITSSNQILEFIDHQSSEVFTRLKSSEVSIQEFK--IDNKVS
A0A2A3UE91      SDIVNAITEEYLAFDVERKSESSRNIISFIDSQLGNVYDALKDTEGDLQKFK--KDKNIS
A0A7V9SRJ9      TDIVNAITEEYLNYDVERKSESSRNILSFIDSQLGVVFNDLKDTEGNLQKFK--QEKKFS
A0A2E6SYP1      ADIVNSLASAFLISNISKKKESANQMIKFTDDQVVKINKRLEYYRKLLKPYKELGSSETK
A0A2E5RLE8      ADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQPYKEIQENNSE
A0A2E7TQF6      ADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQPYKEIQENNSE
A0A2E6GVY9      ADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQPYKDLQKDNQE
A0A2A5FYT6      KDISEAIAEGFINIDVERKSQSAEKVLNFIDTQIESVYGRLRTSETSMQSFQ--KDNRIT
A0A6N9NIX1      RDFVSGLIKEFQVYDINRRKKSSSRILDFINEQLGAVYQRQQKSERTIQEFK--RDNKVS
A0A1F3Q014      ADIVSKMTEEYSNFDIERKGESSLKVIEFIDHQIDIVYEQLKSSETSIQEFT--KNNNVT
A0A2D5KD44      FDIVNGLIDEFKLYNVEKKKQSSKQILDFLNAQIESVYEKQKVYERQIQRFK--RENGIT
A0A7Y2F301      TDLIMAHAQAFLKYDQSRKEKSSERVIEFIDSQLDTVSENLRNAEFLLNSFK--QEYKIN
A0A0E3V905      EAILNQLIREYNEAAIMDKNKVAASTLKFIEDRLNIVSGELASAERNVEQYK--SHQGIT
A0A553ETH6      RDLVNAIDSLYLNYSKQEKTKENKQKIEWLDNELREIESQLEDYENYFETFT--VENRTS
A0A2D4ZVH1      SSIINMTMDTYSALSTEQNRTMAVSALEFLRTERTKLESELVSTEDSLQNFM--NRTLLI
A0A6P1P355      EDILNKLIQEYNQVAIDKRNDLAAKTLEYVNNRIQLVGKELKALENELVHYK--SSQGVV
A0A3D0MYJ7      SELLG------KSSEVENIKNLGKIELNAVEIQINNLRRKISEISPEVDLYV--NSQA--
A0A4Q5WS95      EDILNNLIHDYNAASIDYKNSVARNTISFVDERMRIVQRELNAVEKQIQSYK--AQKGIV
A0A7V9RTA1      EDILNVLMDKYNNDAIEYKNNLAKNTIAFVDERLRLVSDELNSVEKKIQDFK--TRKGIV
A0A5C8KAD6      EDILNYLINSYNDMAVLDRNELAANTLDFVESRIQLVEKELKDLENEVVHYK--ATNGAV
A0A5N1J695      EAILNNLIYAYDQAALNERNTLAANTMAFIEDRIKLIEKDLENVEEKVQQYK--SSQGVV
L8JI02          ARFLDQLLHIYLQNELHKKNQLGVKTIQFIDSQLSGVSDSLKRVEGWLENFR--AKSNIQ
A0A1Q3PII2      EAILSQLIARYMKASIAEKNKVADNTIAFINQNLQRISSELAEVETSIEHFR--KHHRVI
A0A351BXT2      MLIANLYSKVYQSFSLDLSREELTSLTGYLREEKENKFKDLAVAEGELEDYQ--KNGGLI
A0A2K8Z965      EAVINQLITEYDQAAIMDKNKVAANTLKFIEDRLNIVSGELSSVEKNVQSYK--SHQGIT
A0A418M8U8      EAVLNQLIDEYNQAAIIDKNKVAANTLRFIEDRLAILSGELTTVEKEVERYK--ATQGIT
I2GTA4          EAVLNQLIEEYNQAAIIDKNKVAANTLRFIEDRLAILSGELTAVEKEVERYK--ATQGIT
A0A2K8ZAJ2      EAILNQLISEYNKEAVVDKNNQASSTLNFIEDRLALISGELSNVEKEVESYK--STHGIT
A0A368JPA3      EAILNQMIANYSSASTTEKNRAVANTLSFIQTRLKLVSAELATLEKSIETYK--AVNGIS
A0A5N1JI29      EAILNQMIANYSSASTNEKNRAVANALSFIQTRLKLVSAELATLEKSIETYK--AVNGIS
A0A7K0EGC9      EAILNQMIANYNSAATNEKNRMVAGTLSFIQSRLKLVSGELALLEKSIENYK--ATSGIT
A0A3P1BT12      EAILNQMIANYSSAATDDKNRVVASTLSFIQTRLKLVSGELAGLEKSIETYK--SANRIS
A0A3P1CI15      EAILNQMIVNYNSAATVDKNRVVASTLSFIQARLKLVSGELAALEKSIENYK--SVNRIT
A0A4R8CUK1      EAILNQIIANYHSAAIGDKSRMIANSLVSIQARLKQLSGEQKALEKSIEHYK--SVYRIA
A0A7Y6XX71      AQVADTIAEVYIESYLEAKFNMTSKATTWLNDSLQGLRLKLEASERKLADFY--ETEQLV
A0A2H3NSN0      AAVANTYADAYRAYSRESARAGVAAAREFLETQLDRREEDIEEVENEWQQFA--RRHDVA
A0A800J4N3      ALIANLYAEAYVERTQTSSRASVAASREFLESQADSVRRELAAREEAARSYM--DEQNAV
A0A2P6C324      ALIANSFAQQYRLFSREMARAGVVAAREFLETQLEKRKDDIRAIENEWEAFA--RSNAIV
A0A7V2F6E1      AVIANRYAEEYEKYSRERSRESLAAARAFVENQVEQRRQELEGLERQWETFA--RSRQVV
A0A1M6XHU0      AVIANRYAEEYEKYSRERSRESLAAAREFVEKQVEQRRQELEALERQWEAFA--RSRQVV
G2SF81          AVIANRYAEEYERYSRERSRESLAAAREFVEKQVEQRRQELEELERQWEAFA--RSRQVV
A0A5S9EYW1      AVIANRYAEEYERFSRERSRESLAAAREFVEKQVEQRRQELEELERQWEAFA--RSRQVV
D0MHQ9          AVIANRYAEEYERFSRERSRESLAAAREFVEKQVEQRRQELEELERQWEAFA--RSRQVV
A0A662AH13      RLIANTYADAYEGLSLRYTRQQLTTVVEFLKNQRQVQYNALLDVEEKLKDFQ--VEGGII
A0A5C7QA01      TQVLNAILKAYSVQNIERRTAESAQTLKFLDEQLPELKKQLDNAEREFNKFR--QQYNTV
A0A3D3LS70      RLIANVYAAAYLNYNLEFSRKGVKNVGDYLFEIKNKKLNDLNNSEAALQDFQ--QRGGIV
A0A1G1TM36      IDVLNQLIAAYNNASATEKNKLTANALQFIDSRLGSLRGELNQAESAVTGYR--SQQGLA
A0A1G7ZF38      EAILNQLIERYQKASIQEKNKVADNTIAFINSNLTHISSELTQVETNIEQFR--KRHRVI
C6VS52          EAILKQLIVRYQKASIDEKNKVADNTIAFINHNLERVSAELASVETNIEGLR--KQHKLI
                                                                            

A0A7V5RJC2      --------DLDSQYKRHSEELKEA----EDELETYEEFNAALNNLLKQAKSEAAHA----
A0A7C1LGX3      YIE-----ADAGVSLERKSETEND----VIKLETQISLSALLKNSV--------VG----
A0A1T5MMH4      DLQ-----EDLRKTIESINKIDSQ----RYELSRRLDEINKLMDGL--------------
A0A2W4R1L8      NLD-----EELANTIRLIHEIDSQ----RYQLTTRITGINELLDDM--------------
A0A7L9BFB6      NLN-----DDLKRTIILINKIDSQ----RFETNRRINEVNRVIDGL--------------
A0A5C8A5B4      NTA-----STQDALFQERSRLEDE----RSNILKRRNYCSSVLSKI--------RS----
A0A2E5CV79      SSD-----GEASSVARQISALENDIYNTRSELNMRRERISFLNSKL--------------
A0A2A4G4B1      DLD-----MESGLYLRDNAQSRQE----INTLSTQLELALLMKKSV--------------
A0A0P7X1V8      QLD-----AQAQQLIETLSTLEAE----SQGIQVKLVAANSALEAY--------------
A0A4Y9ITE2      DLV-----ADAQYIFTKKGTIDEA----LVTAETEYEILEMTRELM--------ND----
A0A3N2M1H3      DLI-----ASAQASMEKESNLEQS----ILNIENQLSITTYMKDFL--------DD----
A0A4S2G8T2      DLI-----ASAQASMEKESNLEQS----ILNIENQLSITTYMKDFL--------DD----
A0A212K7W5      DIQ-----AASNMYMARSNENDTK----IQALSTQHTIAKYILSHL--------KD----
F5IU11          DIQ-----AASNLYMVKSNENDTK----IQALNTQYTIAKYILSHL--------KN----
A0A7C1QWC7      DLS-----YQGQQALNQMTQIENE----KSTLKVQERYYNYILDYF--------NT----
A0A7Z8P8P1      GTE-----GNGSQYLAESSRVKGE----TLQMETELSIAQSIKSYL--------MD----
K0XJ09          SID-----AAATQFMSESSKMRDE----LVQLETEYAIARAVERYL--------TD----
R5EUZ0          SID-----AAATQFMSESSKMRDE----LVQLETEYAIARAVERYL--------TD----
W0EQS0          SID-----AAASQFMSENSQMRSE----LVQLEMEYAIAQAVQKAF--------SG----
A0A1Y3WE15      SID-----AAASQFMSENSKMRDE----LVQLETEYAIAQAVQRAF--------AN----
A0A1Y4GUK3      SID-----ASANQFMSENSQMRTE----LVQLETEYAIAQAVHRAF--------TN----
A0A352Z1R7      KLD-----SEAQEVVKNLSETEKL----RAEVIFQKKQVEFALDAL--------NS----
A0A7X7BZF5      DVQ-----AASSMYLSQKTQTDNQ----ILELNNQIYMARYIKTYL--------TT----
A0A0A2F501      DLK-----ETTRIYLDQTSEAEAQ----LLDLSNQLYMARYIRQHL--------GT----
R5B7P0          DVG-----AAATMYMQQSTVLNQQ----LQDVSNQLYMARYIKDYI--------GK----
R5B0L5          NVQ-----QAASMYMTESQVVSTQ----MLELNNQLQMTRYLRNYL--------GS----
A0A6I1TEC0      DVE-----TAAQQYMQKSSDLSKQ----IMDFNSRLSIAQYIRSSL--------VG----
A0A3R5XWG1      DVE-----TAAQQYMQKSSDLSKQ----IMDLNSRLSIAQYIRSSL--------VG----
A0A5P0Y910      DVE-----TAAQQYMQKSSDLSKQ----IMDLNSRLSIAQYIRSSL--------VG----
A0A414YFM3      DVE-----TAAQQYMQKSSDLSKQ----IMDLNSRLSIAQYIRSSL--------VG----
A0A6A7UIA7      DVE-----TAAQQYMQKSSDLSKQ----IMDLNSRLSIAQYIRSSL--------VG----
A0A6A7VPS3      DVE-----TAAQQYMQKSSDLSKQ----IMDFNSRLSIAQYIRSSL--------VG----
A0A374THP7      DVE-----AAAQQYMQKSTEVDKQ----IMDLNSRLAIAQYIRNYL--------TG----
A0A6G1VND1      DVE-----AAAQQYMQKSTEVDKQ----IMDLNSRLAIAQYIRNYL--------TG----
A0A0A2EVS5      DVR-----TASEMYMTQAGEAGTQ----ILALNNQLYMARYIRGHI---------T----
A0A1T4NAJ7      DVR-----TASEMYMTQAGEAGTQ----ILALNNQLYMARYIRGHI---------T----
A0A255T941      DVQ-----AASALYMNQSAESKKA----ILELNSQLTTAQYIRHEL---------T----
A0A4P7VSV0      DVS-----AASSMYMSQNQQISQQ----IMDLKNQLKQTLYIKSYL--------GA----
A0A7J0AX49      DVS-----AASSMYMSQNQQISQQ----IMDLKNQLKQTLYIKSYL--------GA----
A0A3N2KCL3      DVS-----AASSMYMSQNQQISQQ----IMDLKNQLKQTLYIKSYL--------GA----
A0A2V1IJY1      DVS-----AASSMYMSQNQQISQQ----IMDLRNQLKQTLYIKSYL--------GA----
A0A4P7VXK7      DVS-----AASSMYMSQNQQISQQ----IMDLRNQLKQTLYIKSYL--------GA----
A0A1Y4CHN5      DIQ-----AASSMYMSQSQETNAQ----ILELSMQLSMAKYIKSYL--------AA----
A0A7Y5JED7      DVQ-----AASNLYLTQSAENKKE----LLALNNQLSTAQYIRREL---------N----
A0A1M6I2S6      DVQ-----AASSLYLSQSAENKKE----LLALNSQLSTAQYIRREL---------N----
A0A1Y3V692      DVQ-----AASSLYLSQSAENKKE----LLALNSQLSTAQYIRREL---------N----
F3PXM2          DVQ-----AASSLYLMQSAENKKE----LLALNNQLSTARYIRGEL---------N----
A0A174JCE8      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLTTAQYIRREL---------N----
A0A3E4JMC4      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLTTAQYIRREL---------N----
A0A412SND6      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLTTAQYIRREL---------N----
A0A414IEQ9      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLTTAQYIRREL---------N----
A0A7K0HNT3      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLTTAQYIRREL---------N----
A0A0M1W8D8      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLTTAQYIRREL---------N----
A0A3R6GKX5      DVQ-----AASNLYMSQSAENKKE----IQALTNQLTTAQYIRREL---------N----
A7V4S1          DVQ-----AASNLYMSQSAENKKE----IQALTNQLTTAQYIRREL---------N----
B0NU19          DVQ-----AASNLYMSQSAENKKE----IQALTNQLTTAQYIRREL---------N----
D4V601          DVQ-----AASNLYMSQSAENKKE----IQALTNQLTTAQYIRREL---------N----
A0A4Q0U3M9      DVQ-----AASNLYMSQSAENKKE----IQALTNQLTTAQYIRREL---------N----
A0A7J5G2G2      DVQ-----AASNLYMSQSAENKKE----IQALTNQLTTAQYIRREL---------N----
A0A7J5HH13      DVQ-----AASNLYMSQSAENKKE----IQALTNQLTTAQYIRREL---------N----
A0A397WLT5      DVQ-----AASNLYMSQSAENKKE----IQALTNQLTTAQYIRREL---------N----
A0A6N8DDD8      DVQ-----AASNLYMSQSAENKKE----IQALTNQLTTAQYIRREL---------N----
A0A6A2J529      DVQ-----AASNLYMSQSAENKKE----IQALTNQLTTAQYIRREL---------N----
A0A7S9QIA5      DVQ-----AASNLYMSQSAENKKE----IQALTNQLTTAQYIRREL---------N----
A0A015XH67      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLATAQFIRREL---------G----
A0A078RZN2      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLATAQFIRREL---------G----
A6L0K5          DVQ-----AASSLYMSQSAENKKE----IQTLTNQLATAQFIRREL---------G----
A7ACT5          DVQ-----AASSLYMSQSAENKKE----IQTLTNQLATAQFIRREL---------G----
A6KY94          DVQ-----AASSLYMSQSAENKKE----IQTLTNQLATAQFIRREL---------G----
A0A173UQR8      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLATAQFIRREL---------G----
A0A3R6HK75      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLATAQFIRREL---------G----
A0A412B7D1      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLATAQFIRREL---------G----
A0A412VNY9      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLATAQFIRREL---------G----
A0A414LTU9      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLATAQFIRREL---------G----
A0A8B2YHC3      DVQ-----AASSLYMSQSAENKKE----IQTLTNQLATAQFIRREL---------G----
I9Q4U4          DVQ-----AASSLYMSQSAENKKE----IQTLTNQLATAQFIRREL---------G----
A0A373ISF0      DVQ-----AASSLYMAQSAENKKE----LLTLNTQLSTARYILKEL---------K----
U6RF62          DVQ-----AASSLYMAQSAENKKE----LLTLNTQLSTARYILKEL---------K----
A0A662ZZD5      DVQ-----AASSLYLSQSAENKKE----LLALNSQLSTAQYIRKEL---------N----
A0A415NEB6      DVQ-----AASSLYLSQSAENKKE----LLALNSQLSTAQYIRKEL---------N----
A7AJ60          DVQ-----AASSLYLSQSAENKKE----LLALNSQLSTAQYIRKEL---------N----
A0A6A2JF01      DVQ-----AASSLYLSQSAENKKE----LLALNSQLSTAQYIRKEL---------N----
A0A7J5MKN5      DVQ-----AASSLYLSQSAENKKE----LLALNSQLSTAQYIRKEL---------N----
A0A015UXN7      DVQ-----AASSLYLSQSAENKKE----LLALNSQLSTAQYIRKEL---------N----
A0A642KJV3      DVQ-----AASSLYLSQSAENKKE----LLALNSQLSTAQYIRKEL---------N----
A0A6I2NTL0      DVQ-----AASSLYLSQSAENKKE----LLALNSQLSTAQYIRKEL---------N----
A0A6I2Q447      DVQ-----AASSLYLSQSAENKKE----LLALNSQLSTAQYIRKEL---------N----
A0A016E4F9      DVQ-----AASSLYMAQSAENKKE----LLALNSQLSTARYIRKEL---------N----
A0A6N3HG44      DVQ-----AASSLYMAQSAENKKE----LLALNSQLSTARYIRKEL---------N----
A0A7K0HSP7      DVQ-----AASSLYMAQSAENKKE----LLALNSQLSTARYIRKEL---------N----
A0A7K1HEJ5      DVQ-----AASSLYMAQSAENKKE----LLALNSQLSTARYIRKEL---------N----
A0A6H9P0U9      DVQ-----AASSLYMAQSAENNKE----LSTLNNQLSTAQYIRREL---------N----
A0A108TH71      DVQ-----AASSLYMAQSAENNKE----LSTLNNQLSTAQYIRREL---------N----
I8VXH0          DVQ-----AASSLYMAQSAENNKE----LSTLNNQLSTAQYIRREL---------N----
A0A412S0N6      DVQ-----AASSLYMAQSAENNKE----LSTLNNQLSTAQYIRREL---------N----
A0A412IIJ0      DVQ-----AASSLYMAQSAENNKE----LSTLNNQLSTAQYIRREL---------N----
A0A0P0FM97      DVQ-----AASSLYMAQSAENNKE----LSTLNNQLSTAQYIRREL---------N----
R6KTP3          DVQ-----AASSLYMAQSAENNKE----LSTLNNQLSTAQYIRREL---------N----
A0A139LU87      DVQ-----AASSLYMAQSAENNKE----LSTLNNQLSTAQYIRREL---------N----
A0A1C6B3Y5      DVQ-----AASSLYMAQSAENNKE----LSTLNNQLSTAQYIRREL---------N----
A0A6L3KCD1      DVQ-----AASSLYMAQSAENNKE----LSTLNNQLSTAQYIRREL---------N----
E2NMQ4          DVQ-----AASSLYMAQSAENNKE----LSTLNNQLSTAQYIRREL---------N----
A0A412YDB9      DVQ-----AASSLYMAQSAENNKE----LSALNNQLSTAQYIRREL---------N----
R7DY01          DVQ-----AASSLYMAQSAENNKE----LSALNNQLSTAQYIRREL---------N----
A0A414LGK8      DVQ-----AASSLYMAQSAENNKE----LSALNNQLSTAQYIRREL---------N----
A0A415IPQ4      DVQ-----AASSLYMAQSAENKKE----LSALNNQLSTAQYIRREL---------N----
A0A3E5BRW7      DVQ-----AASSLYMTQSAENNKE----LSALNNQLSTAQYIRREL---------N----
K9DXS6          DVQ-----AASSLYMTQSAENNKE----LSALNNQLSTAQYIRREL---------N----
A0A1M6KFV3      DVQ-----AASSLYMAQSAENKKE----LSALNNQLSTAQYIRREL---------N----
A0A1Q6G7L3      DVQ-----AASSLYMAQSAENKKE----LSALNNQLSTAQYIRREL---------N----
A0A413H235      DVQ-----AASSLYMAQSAENKKE----LSALNNQLSTAQYIRREL---------N----
A0A358R8U0      DVQ-----AASSLYMAQSSETNAQ----IMALSNQLYMTRYVRNYL--------SD----
R6WSB6          DVQ-----AASSLYMAQSSETNAQ----IMALSNQLYMTRYVRNYL--------SD----
A0A401LPX7      DVQ-----AAASMYMTQANEANTA----IRELNNQAYMARYIKNYL--------TD----
A0A6G0GNY9      DVQ-----VAANMYMTQANEANAE----IRELNNQVYMARYIKNYL--------TN----
A0A6I1BFM0      DVQ-----VAANMYMTQANEANAE----IRELNNQVYMARYIKNYL--------TN----
A0A3A5Z900      DVQ-----AAANMYMTQANEANAA----IRELNNQTYMARYIKNYL--------TN----
A0A7K0GW19      DVQ-----AAANMYMTQANEANAA----IRELNNQAYMARYIKNYL--------TN----
A0A285TGL6      DVQ-----AAANMYMTQANEANAA----IRELNNQAYMARYIKNYL--------TN----
A0A3A5RFX4      DVQ-----AAANMYMTQANEANAA----IRELNNQAYMARYIKNYL--------TN----
A0A1Q6IUW9      DVQ-----AAANMYMTQANEANAA----IRELNNQAYMARYIKNYL--------TN----
A0A413XDP6      DVQ-----AAANMYMTQANEANAA----IRELNNQAYMARYIKNYL--------TN----
A0A6N8CVT6      DVQ-----AAANMYMTQANEANAA----IRELNNQAYMARYIKNYL--------TN----
K6AP24          DVQ-----AAANMYMTQANEANAA----IRELNNQAYMARYIKNYL--------TN----
A0A6I2NHV3      DVQ-----AAANMYMTQANEANAA----IRELNNQAYMARYIKNYL--------TN----
A0A662ZYI7      DVQ-----AAANMYMTQANEANAA----IRELNNQAYMARYIKNYL--------TN----
A0A078RYI7      DVQ-----AAANMYMTQANEANAA----IRELNNQAYMARYIKNYL--------TN----
C7XEQ8          DVQ-----AAANMYMTQANEANAA----IRELNDQAYMARYIKNYL--------TN----
D7INX6          DVQ-----AAANMYMTQANEANAA----IRELNNQAYMARYIKNYL--------TN----
K5ZG55          DVQ-----AAANMYMTQANEANAA----IRELNNQAYMARYIKNYL--------TN----
A0A7Y5MWI8      DVQ-----AAASMYMEQSSETNAQ----ILALNTQLSMARYIRNYL--------TN----
A0A1M5B2J8      DVQ-----AAANMYMAQASEANAA----IKSLNNQTYMARYIRNYL--------TS----
A0A255RCT5      DVQ-----AAANMYMAQASEANAA----IKSLNNQTYMARYIRNYL--------TS----
A0A1Y4GLF5      DVQ-----AASNMYMMQSSETNSQ----ILALNNQLYMARYIRNYL--------AN----
A0A1H3XSC0      DVQ-----AASSMYMAQSNQTNAL----ILTLNNQLYMTRYIRNYL--------TN----
A6LE40          DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A4Y1VPX5      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A6N2XMM4      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A7U8L0B4      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
B3JI46          DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A3N2N9B8      DVQ-----AASSMYMSENRQIASG----IMDINNQLQMTRFVRNYL--------TA----
A0A3N2NMI0      DIA-----AASSMYMSQNQQIASE----ILAINNQIQMARFVRTYL--------TA----
A0A359I8H7      NLE-----EAAKTQMKQSVEMSNK----MLEVTNQMSMSIYLRDYL--------NN----
A0A3N2KA63      NLE-----EAAKTQMKQSVEMSNK----MLEVTNQMSMSIYLRDYL--------NN----
A0A4Q0IMT7      NLE-----EAAKTQMKQSVEMSNK----MLEVTNQMSMSIYLRDYL--------NN----
A0A7J0B660      NLE-----EAAKTQMKQSVEMSNK----MLEVTNQMSMSIYLRDYL--------NN----
A0A3B9FAU3      SVQ-----AASQMSMQQSQESQKQ----VLALNTQRSMAQYVKGML--------TR----
A0A3C1E5L7      SVQ-----AASQMSMQQSQESQKQ----VLALNTQRSMAQYVKGML--------TR----
A0A4Q0UAV1      DGS-----STANGAMQQRQQSQNA----ILELNNRLSLVKYLRREV--------QN----
A0A354SN68      NIG-----IATGMVMSQENSLDNT----IVSTNNKIHMAYFIKEYL--------SN----
A0A6L5XFL0      DVA-----ANAALNLNKADQTSQQ----LLEFENQLYMAKYIRKQM--------SE----
A0A3N2N595      DVD-----AASTLYMGESQRISQE----IMGLRNQLQMTRYIRNYL--------SA----
A0A7J0ACS3      DVQ-----AAAAIYMNQSQQAQAK----ILEVNNQLSMARYIRSYL--------TS----
A0A0A2DUD9      DVQ-----TASNLFLNQAAQVDNQ----IVELRSREYMARQVRNLL--------KN----
A0A3P1ZBJ5      DVE-----SASKLYMQKTSANDDK----LMELNNQLYMTRYVSQML--------TN----
R5FHS9          DVD-----AVATSYLDQSTAANAK----LLDLNTQRAMAQYVLSYI--------TN----
A0A413TW79      DVE-----TAAQQYMQKSGDVDKQ----ILELNSRLSMARYLRDFL--------TG----
A0A7K0AAG2      DVE-----TAAQQYMQKSGDVDKQ----ILDLNSRLSMARYLRDFL--------TG----
A0A7K0ASF1      DVE-----TAAQQYMQKSGDVDKQ----ILELNSRLSMARYLRNFL--------TG----
A0A3E5E9M7      DVE-----TAAQQYMQKSGDVDKQ----ILELNSRLSMARYLRDFL--------TG----
A0A3E4SK73      DVE-----TAAQQYMQKSGDVDKQ----ILELNSRLSMARYLRDFL--------TG----
A0A415GGC6      DVE-----TAAQQYMQKSGDVDKQ----ILELNSRLSMARYLRDFL--------TG----
A0A413DBH9      DVE-----TAAQQYMQKSGDVDKQ----ILELNSRLSMARYLRDFL--------TG----
A0A495WI87      DVQ-----AASSMYMAQVNETDAQ----LLALNNQLYMARYIRNYL--------GG----
A0A354M4S6      DVQ-----AASSMYMAQVSETDAQ----LLALNNQLYMARYIRNYL--------GG----
R7DH52          DVQ-----AASSMYMAQVSETDAQ----LLALNNQLYMARYIRNYL--------GG----
A0A7J5IAE7      DVQ-----TASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------TN----
A0A016CWA4      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A4P8LP09      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A0M1W0V2      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A139KA16      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A174VQ92      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A1Q6HCG0      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A1Y4JYM9      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A3A5QW67      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A3A5RQE6      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A3A6BP07      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A3E5E153      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A3Q9IP20      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A412WV15      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A413ICP6      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A414KYB9      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A5B3FWR2      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A7J5QHB9      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
E5WX00          DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
K0X3P3          DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A1C6H117      DVQ-----AASSMYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------SN----
A0A6I1AQV4      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A5C6L2P1      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A3E4WKT5      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A3A5YY33      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A1E9CFZ7      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A373FYU5      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A3A5XBP2      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A3A6MEG9      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A3E4JP35      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A3E4KP40      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A3E4NX82      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A3E4XFU8      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A412RG70      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A412TD37      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A413GAA4      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A414M7I4      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A496BTA0      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A496D2V6      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A5C6KCA6      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A5M5AHM5      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A6I0Y5K7      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A6I1BFB8      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A6I2P5W5      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A6N8DC51      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A7J5HGP0      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A7J5HVL8      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A7J5JHD3      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A8B3EKM1      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
E5UZA2          DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A069SMG6      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
C3RFN5          DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A3A5Z014      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A7J5GD93      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A7K0HGR5      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A078S3Q8      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A069SJV7      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A3E5DXI5      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A3E5EM98      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A6N2YYD4      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
I9T3G6          DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A3E4SYU0      DVQ-----AASSIYMAQSSQTNAQ----ILALNNQLYMTRYIRNYL--------AN----
A6LGY1          DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
K5ZSH4          DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A6A2RTB3      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A7J5PEN4      DVQ-----AASSMYMAQSSAANAQ----ILSLNNQLYMTRYIRNYL--------AN----
A0A1M4YZ07      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------TN----
A0A7J5I238      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A0P0FQW1      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A7K0I229      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A5M5C0W6      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A642NJ89      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A6L3JTQ2      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A7J5FQU6      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A7J4YLH7      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A6N3AEV2      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A6G0G4T5      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A6L3KG29      DVQ-----AASSMYMAQSSATNAQ----ILALNNQLYMTRYIRNYL--------AN----
A0A1Y4PQK7      DVQ-----TASNLYMAQNSQISSQ----ILALNTQLSLVRYIRNYL--------AT----
A0A1Y4IH41      DVQ-----AASNLYMAQSSQTSSQ----ILALSTQLSMVRYIRNYL--------AT----
A0A3A6AAP4      DVQ-----AASNLYMAQSSQTSSQ----ILALSTQLSMVRYIRNYL--------AT----
A0A6I0ZRD2      DVQ-----AASNLYMAQSSQTSSQ----ILALSTQLSMVRYIRNYL--------AT----
A0A1Y4DYA7      DVQ-----AAANMYMTQSNATNSQ----ILVLNTQLAMTRYVRNYL--------TN----
A0A1Y3X4I9      DVQ-----AAASMYMTQSSETSSQ----ILALNTQLAMTRYVRNYL--------TG----
A0A1Y4FNK8      DVQ-----AAASMYMAQSSETNAQ----ILALNTQLSMARYIRNYL--------TN----
A0A355FD59      DVE-----AASGMYMEQSRETSNL----LLSLKSQLSMANYIRNYL--------TG----
A0A359CEZ9      DVE-----AASGMYMEQSRETSNL----LLSLKSQLSMANYIRNYL--------TG----
A0A353Q7B4      DVE-----AASGMYMEQSRETSNL----LLSLKSQLSMANYIRNYL--------TG----
F8X3A5          DVD-----AASSMYMAQSRETSNL----MLDLNTRLSMARYMRNHL--------MT----
A0A1M3KVR9      DVE-----AASSMYMAQSRETSNL----MLDLNTRLSMARYMRNHL--------MT----
A0A4Y9IJS3      DVE-----AASSMYMAQSRETSNL----MLDLNTRLSMARYMRNHL--------MT----
A0A416GA42      D-G-----TQSGLYLQRADQFQNE----AVQLQTELELTRYLKEFL--------LQ----
A0A1T3IYP5      DIA-----TAGGTFLTEKNQYRSE----GAKVETDIRLAEMMRSYL--------SA----
A0A7Z6RZU4      NLS-----SEASLYLNNNNANRQE----IIQLTNQMELVRFIREYL--------ND----
A0A4D7K1D4      DLQ-----KDMAETIQFLNQLDSQ----KRALKIYQIKIDKVQAQL--------------
A0A846MP44      DIG-----NDLGQYVQAIKDLTKE----KTLLEEQLSALRKVEQML---------D----
A0A1G9E2A9      SIS-----STIGQTLEQIKNLRFE----RITYEQQLPALDELEAYV------NRVD----
A0A098LL25      DVK-----QDFGKSGIKIEELEKE----KQVLKSRISMLGELKDLI--------LG----
A0A6J4H627      DVG-----AEVGKYALKIDDLLKS----RSDLAIQLSLLNRLQELI--------NH----
A0A6C0GJI1      DVK-----SDVSKFVTNIEELNKQ----RTELNSQLSLLRNLQNII--------ET----
A0A839GQ17      DVR-----AGLEEAMGQIQQLEQQ----KLDLRFKSSLLLDLQQKI------QKNE----
A0A127B287      DVK-----AGLEGAMTQIQELEKE----KYDLRFRNSLLSDIQQRI------RKGD----
A0A6P1P2P6      DVK-----AGLEGAMSQIQELEKE----KYALRFRNSLLGDIQQRI------RKDD----
A0A2T2YJE8      DVR-----ADVSKSITKLEELNKE----RINLHLQISLLNEVDQLL--------NK----
A0A7L7LEW0      DVR-----ADVSNRMSKLEVLNKR----RIDLRLQISLLNEVEQLL--------NK----
A0A3M9N829      DIR-----SSFQEAITEYRELEQK----KLEQRFLLTLYNTIQSKM------QQDE----
A0A0P0CSF9      DLK-----ANFQEALAQVQELEKE----KLELRFQLSLLNTIQTKV------QRNE----
A0A5M8QQB8      DIK-----ANLQEALSMVQELEKE----KLELRFQLSLLNTIQAKV------QRNE----
A0A3M9MNC3      DIK-----SNLQEALAQVQELEKE----KLELRFQLSLLNTIQSKV------QKNE----
A0A5B6TAX2      DIK-----SNLQEALGQVQELEKE----KLELRFQLSLLNTIQAKV------QRNE----
A0A7L5A132      DVK-----NDMGTIVEQTAEMQKE----REELRLKINALADLTGLI-GQNRVFVRE----
A0A512AYT3      DIK-----AEVGTQLAKLETLNNE----RRELDIQIGLLKDVARLV-SQAGQDEQE----
A0A5M6CYN7      DVK-----ADVSTQISKLEELGKA----RLDLSMRISLLRDVAQLI-N------ND----
A0A369QP10      DVR-----ADVNKQMTKLEDLNKQ----RVDLRMELSLLNEIDQLI--------GR----
A0A7G7G7M4      DVR-----ADVTKQMGKLEELNKE----RVNLRLQISLLNEINQLL--------GR----
A0A126PDF2      DVK-----SEVAALASRGEDLEEQ----RLKLNQNLVLLSEISRMV-QQTHITRNE----
A0A2Z3GKA1      DVR-----SEVAALAAKGESLEEQ----RLKLNQNLVLLSEISRMVQQQTHITRNE----
A0A502GZP7      DVK-----SEVADLAAKSEDLEEQ----RLKLNQNMVLLNDIARVV-QQAHITRNE----
A0A0M3RW20      DVK-----ADVGTLTEKLAEQEKE----RIELQKRLDLLNGVARLI-QRERITRDE----
A0A495VFX4      DVK-----ADVGTLTEKLAEQEKE----KIELQKRLDLLIGVARSV-QREHITRDE----
A0A246FQC0      DVK-----GDVGQITGLLMELEEE----RTKLQQQADMMNDVARLV-EQDRLTVRP----
A0A372E5P8      DVK-----GEVSQLTGLLQTLEEE----RAKLQEQSEMMSDVGQLL-DREQLTTRA----
A0A7Y7PLY0      DVK-----GEVGQLTGLLQTLEEE----RAKLQEQSEMMSDVGQLL-DREQITTRA----
A0A1H3EMW1      DVK-----GEVGTITGLLQELEVE----RAKLQEQGEMMGDVGRLL-QQEQLTTRA----
A0A1H9ZSN3      DVK-----GEVGQITGLMQELEEE----RAKLQEQGEMMNDVGQLL-DREQLTTRA----
A0A7W9SXN1      DVK-----GDVGLITAALEEQEQE----REKLQNQIDMLDELGRLL-NQKRLTERE----
A0A418R9X5      DVK-----SEAGLVTNQLNMLESQ----QEELQEQADMLAELSRLV-EQERLTSRQ----
A0A428JSJ3      DVK-----SEASLINNQLTTQEAE----QEKLQEEADMLADLARLV-EQERLTDRE----
A0A428KI59      DVK-----SEANLVTNQLTAQELE----QEQLQEQADMLAELARLI-EQERLTDRE----
W8F1I6          DVK-----SEASLVTNQLTAQELE----QEQLQEQADMLAELARLI-EQERLTDRE----
A0A1S9B3W0      DAK-----SDLGAITQELSELQKE----REKLLRKATVLTEITRLV-EQERLT-KD----
A0A1W1VRL3      DVR-----ADAATVNGKILAQEEK----RQNLLQKQGLLADLSSLV-EQDQLTANE----
A0A7G6YQJ9      DVK-----GELTTIASAIADQEVE----RQKLLEKVKLLTELRSTV-DNDQIIGRG----
A0A1M6R305      DVK-----ATIGDLTGRLEKQEEE----RLRLVEKIRLLNEVAALA-EQGTITARE----
A0A7G7W8X3      DVK-----ATIGDLTARLEKQEEE----RLKLAEKIRLLNEVAALA-EQGAITARE----
A0A4Z0PHK3      DVK-----SELALITGKLAKQEEE----RLKMVEKARLLGEITRLV-EEDRLTQSE----
A0A2M9B9H9      DVK-----TEVAGITEKLAEQEEV----RLKLVEKARLLGEISRLV-EQDRLTQNE----
A0A4Z0QCY9      DVK-----GEVSAITEKLAKQEEE----RLKIVEKARLLGEITRLV-EQDRLTANE----
A0A7Y0AH93      DAK-----GELATTREKQEELIAQ----RLTLEEGIQLLKEVKQLA-EEARLTIRE----
A0A519SBU8      DIK-----SEVSAIKGQMESLLKE----RLELEQKQRLLAEVRRLM-DSEQLTRND----
A0A4Q3JNZ3      DVK-----GDMATIRGNLEKQQDE----RLKLQDKLRLLAEVGRMM-NRDQLTRTD----
A0A519Q9V3      DVK-----GDMATIKGNLEKQQDA----RQKLQDKLRLLSDISRLM-NRDQLTNND----
A0A5N1J2M4      DIK-----SDVSASRLKIEELMKE----RQALRLKIALLDDVSALL-AKN----------
A0A519S476      DIT-----TEVEGLKTRLEKQQDT----RFELEGKLRLLAEVGRIM-ARDQLTRSD----
A0A4Q3JRW8      DVK-----GDMASIKGNLEKQQEA----RQKLQDKLRSLSDISRLM-NREQLTRND----
A0A519M923      DVK-----GDMTAIKADLEKQQED----RQKLQDKLRLLADVSRLM-NRDQMTRND----
A0A4Z0ENW1      DAK-----GELGIITDKLEKIEED----RLKLEQKLTLLSEVSRLT-SAEYLTPSD----
A0A519UDB4      DAK-----GQLGDISEKLLEIQKG----RSELEQRLGLLTEVGRLA-SQELIMTNE----
A0A3S0QKV1      DAK-----ADVGTLTTQLSDLRKE----RETLQRKASLLTQVSRLV-QQERITSRD----
A0A328BL48      DAK-----GDLATITTQMQELAKQ----REQILRRQGVLQELSRVV-ETERLIGSD----
A0A5R8WLY4      DAK-----GDLTAITTQLQELAKQ----REEIQRRQGVLQELSRVV-EKDRVVGSD----
A0A1I5WSL8      DTR-----AELEAISGKMEKLEAE----RLKLTDKMILLTEIEVMA-RQDRLTRDE----
A0A0U3JVM7      DSK-----GEFSAITEKLEKLEAD----RLKLTDKINMLGEIAQMA-SQGSLTRDE----
A0A1G1SSV2      DSK-----GEFEAISGKLEKFETE----RLKLTDNIAMLAEIANMA-NQDRLTRDE----
A0A1G1SXV7      DSK-----GEFEAISAKLEKFETE----RLKLTDNIALLAAITNMA-NQERLTRDE----
A0A6G8CBJ6      DVR-----RDAATVIDKIAIQEEK----RQELLQRQSLLADLSRLV-EQDQITSNE----
A0A0W8EDI5      DVK-----SDLATITEKMEALEEE----KEQLLRKAGAIGEIAQLV-EQNQVMVQE----
A0A3B7RBP8      DVK-----SDVANIAEKMAALQEE----RVELQRKAGALAEVASLV-QQNRVLTRE----
A0A3R9P8H7      DVK-----GDVGQIMTALKEQETE----REKLQEQVDMLNDVARLI-EQDRLTDRA----
A0A238WIA7      DAE-----SELGTVTSAITTQQEE----RQELQEQINLLRNLSNQI-ESNQFVARE----
A0A212UCJ7      DAE-----TELGSLTTILTTQQEE----RQKLQEQLTLLRSLNSQI-AQNRIVASE----
A0A4Z0MQE1      DAE-----SELGSLTTLLNSQEEE----RQKLQEQLSLLRSLNSQI-EQNRIIAVE----
A0A4Z0PCF4      DAE-----SELGSLTGTLKEQEKE----RQELQEQLTLLRNLNGQI-EQNRFVAVE----
A0A6M6BED0      DAE-----SELGSLTTLLSTQEEE----RQKLQEQLSLLRNLNGQI-EQNRFVAVE----
A0A5D6VDG1      DVR-----SGVQTITDQLDEQEKE----QQALQRRLELLTSVARLT-SRDRIARDE----
A0A243WHR7      DVR-----GDLASISDKLLEQEKE----RLQLQQQIDLLDEIVALV-ESNQLTNSE----
A0A5B8A0P6      DVR-----SDVSTVIAKLAQLEED----RRKLDEKSRLLEEVSRLV-EQERLTTSE----
A0A076HRT9      DVR-----ASIGEITARLEKQEEE----RLKLSEKIRLLNEVADLA-ERGTITSRE----
A0A4Z0PVM7      DVK-----GEVSVITDKLAKQEEE----RLELEEKARLLGEITNLV-EQGRLTESE----
A0A1M6DHW8      DVK-----ADVAAITEKLAAQAEE----QQKLAEKARLLSNVARLV-EQDRLIASD----
A0A4Q5LC61      DVK-----ADVAAISEKLAEQEEE----RLKLTEKARLLGEVTRLV-EQDRLVASE----
A0A060RD97      DFS-----AAANMYMQTSNEIRRD----AAEVENQIAMANYIKDYL--------LD----
A0A350IHV0      DIA-----SISEAYLKESTDYSAK----SFEVNNQLAIAKFIKEYL--------KD----
A0A2A8CVM9      TQG-----IGGERLVAEYTELTAR----RDALRFELEQEEEALRLL--------RDQLAQ
R5RVP0          DIR-----SLSAAYLEESTEYKAK----SFDVNNQLAIAKFIKEYL--------EN----
A0A2L2WX98      DFE-----QSAQMYLTESSAARKQ----RLELETQVAVARYLTQYL--------QN----
A0A2E3R1D0      ALQ-----EETSRLVDQIATLDAR----RDQAQVNLVTKRAELAAL--------QS----
A0A800J826      ALQ-----EETTDLVTNLGALDGQ----IDAVDVEIETKQAEIAAI--------RE----
A0A2T2USC0      ALD-----QETQQIVQQISEMQAR----RDELQIELDMESSALQSL--------KE----
A0A2T2V0F3      ALD-----QETSRIVDQIANLQTR----QDELRIELDMKQSALTSK--------QE----
A0A2T2S682      SLD-----QEASRLVQQLSELEAR----RDELRIELDMAESALNTK--------KK----
A0A840DJZ8      SLD-----QRQGSLTSRIAETESA----LEQARIELRMERSSLESL--------QE----
D5H561          SLD-----QRQGSLTSRIAETESS----LEQARIELRMEQSSLESL--------RE----
A0A2H3NWA9      ALD-----EETSSTVSRITSLESE----RAQLRIELEMTRARFNAQ--------QD----
A0A2A8CVB6      ALD-----QESGRIVSDIAQMEAE----QRQLQIELQLARTSLDEK--------RS----
A0A2P6C1S6      SLD-----QETGRVVQQISELEAQ----RAELRIELDMQQAALETQ--------KE----
A0A2T2UTM4      SLD-----QETGRVVQQISELESK----RARLRIELDMKQATLETR--------KE----
R6A0L2          DFD-----KTPQAMIDESSTARQQ----SLQAETQLNVAKYLDEYL--------HT----
R7LG80          DFE-----TTAQSITQESSLARQK----TLEAETQLNVAQYLYNYL--------DN----
A0A7W5UEN4      DFQ-----QAAGTVTAQSADARQQ----ALQLETQLSVARYLQEFL--------QN----
G5GD56          DFQ-----QAAGTVTAQSADARQQ----ALQLETQLSVARYLQEFL--------QN----
R5KD55          DVE-----KAYSLSMERADKNSAI----LLDLNTKLSVAGYIRDYI--------TN----
A0A174QNT3      DIN-----ANANIYLQEGSKAKEE----SIQLEAQLNVVEFIKKYV--------TD----
A0A4S2FGS1      DIN-----SNANLYLQEGSKAKEE----SIQLEAQLNVVEFVKNYV--------TD----
A0A7K3KG59      DIN-----SNANLYLQEGSKAKEE----SIQLEAQLNVVEFVKNYV--------TD----
R9I0H0          DIN-----SNANLYLQEGSKAKEE----SIQLEAQLNVVEFVKNYV--------TD----
K5BUT9          DMS-----ANATQYLAESSKVKEE----SAQLETELSIARSIKSYL--------AD----
A0A174FPA3      DMS-----ANATQYLAESSKVKEE----SAQLETELSIARSIKTYL--------AD----
R6S9Y6          DMS-----ANATQYLAESSKIKEE----SAQLETELSIARSIKTYL--------AD----
A0A7J4YSB2      DMS-----ANATQYLAESSKVKEE----SAQLETELSIARSIKTYL--------AD----
C9KX15          DMS-----ANATQYLAESSKVKEE----SAQLETELSIARSIKTYL--------AD----
A0A6H0KRK1      GSE-----GNGTQFLAESSRMKTE----TLQMETELSIAQSIKSYL--------LD----
R6DAG6          GSE-----GNGTQFLAESSRMKTE----NLQMETELSIAQSIKSYL--------LD----
A0A3L8AAP1      GSE-----GNGSQFLAESSRMKTE----NLQMETELSIAQSIKSYL--------LD----
A0A4S2AYX2      GSE-----GNGSQFLAESSRMKTE----NLQMETELSIAQSIKSYL--------LD----
A0A7J0A2L4      GSE-----GNGSQFLAESSRMKTE----NLQMETELSIAQSIKSYL--------LD----
A0A7K3MN31      GSE-----GNGSQFLAESSRMKTE----NLQMETELSIAQSIKSYL--------LD----
R6CQ93          DIG-----SLAGRYMGEAQTYSAD----AMEQETQLKLAQFIKEYL--------TD----
A0A3D1NQW3      DIV-----SEAEQTITESAQYKTD----GLSLENQIRMTEFLKEYL--------LD----
B0MT10          DIV-----SEAEQTITESAQYKTD----GLSLENQIRMTEFLKEYL--------LD----
R7JGW9          DIV-----SEAEQTITESAQYKTD----GLSLENQIRMTEFLKEYL--------LD----
A0A3D2BF46      DIT-----AQATQSLTESSQFKTA----GLSVENQISMAQYIRDYL--------LN----
A0A358R538      DLQ-----SEAARNVTESSRYKAE----GLSLENQIAVARFVSDYL--------RD----
A0A1Y4AAB8      DLA-----SEATRNVEESSQFKAE----GLSLENQINVAEFIRSYL--------LD----
A0A1Y3WWY9      DIA-----SEATRSVTESSQYKAE----GLSLDNQINVAQFIRSYL--------SD----
A0A1Y4U5L4      DIA-----SEATRSVTESSQYKAE----GLSLDNQINVAQFIRSYL--------SD----
A0A1Y3VCJ1      DIS-----SEATRSLTESSQYKAE----GLSLDNQINIAEFVRGYL--------AD----
A0A1Y3QTW7      DIT-----SEATRSITESSKFKVE----GLSIENQISVANYIRDYL--------NN----
R6XWY7          DIT-----SEATRSITESSKFKVE----GLSIENQISVANYIRDYL--------NN----
A0A4Y1X9Y9      DIT-----SEATRSITESSKFKVE----GLSIENQISVANYIRDYL--------DD----
A0A4Y1WM66      DIT-----SEATRSITESSKFKVE----GLSIENQISVANYIRDYL--------DD----
A0A6N4GYT3      DIT-----SEATRSITESSKFKVE----GLSIENQISVANYIRDYL--------DD----
A0A174AVF1      DIT-----SEATRSITESSKFKVE----GLSIENQISVANYIRDYL--------DD----
A0A1Q6EIY0      DIT-----SEATRTITESTRYKAE----SLTIENQISVADFIREYL--------ND----
A0A5B5VN71      DIT-----SEATRTITESTRYKAE----SLTIENQISVADFIREYL--------ND----
E4M8L3          DIT-----SEATRTITESTRYKAE----SLTIENQISVADFIREYL--------ND----
I3YQ50          DIT-----SEATRTITESTRYKAE----SLTIENQISVADFIREYL--------ND----
R5UEY8          DIT-----SEATRTITESTRYKAE----SLTIENQISVADFIREYL--------ND----
A0A1H4D866      DIT-----SEAARSVSESSKYKAE----GLSLENQINVAEFIRTYL--------ND----
A0A5B3G4Y7      DIT-----SEAARSVSESSRYKTE----GLSLENQINVAEYIRTYL--------ND----
A0A374A9J5      DIT-----SEAARSVSESSRYKTE----GLSLENQINVAEYIRTYL--------ND----
A0A5B3GQN5      DIT-----SEAARSVSESSRYKTE----GLSLENQINVAEYIRTYL--------ND----
A0A1Q6E9S3      DIT-----SEAARSVSESSRYKTE----GLSLENQINVAEYIRTYL--------ND----
D4IJ36          DIT-----SEAARSVSESSRYKTE----GLSLENQINVAEYIRTYL--------ND----
A0A414Q925      DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
A0A415PUS9      DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
A0A108TCU0      DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
A0A413BA42      DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
S3Y344          DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
A0A7J5LEW3      DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
A0A412TGL3      DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
A0A413VJ33      DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
A0A414L0W6      DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
A0A412DP39      DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
A0A413ZSE8      DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
B0NP84          DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
R6AK43          DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
A0A412N2D9      DIA-----SESALYLKSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
A0A1Y4JYS9      DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
R6LHA4          DIA-----SESALYLQSSSMLDTE----GLSVENQLNMAQYMKEYL--------QD----
A0A3E5HPT8      DIN-----TVAGMYIQDSRQYESS----IKELDTQLQLVSFIKQYL--------QD----
C6IJ48          DIN-----TVAGMYIQDSRQYESS----IKELDTQLQLVSFIKQYL--------QD----
Q8A3U2          DIN-----TVAGMYIQDSRQYESS----IKELDTQLQLVSFIKQYL--------QD----
A0A3R6S1H6      DIV-----SETGIYLQNSNLYQQE----GLGLENQLSLARSIKEYL--------HD----
A0A3R6SD81      DIV-----SETGIYLQNSNLYQQE----GLGLENQLSLARSIKEYL--------HD----
A0A354WXN6      DIT-----SETGMYLQNTSQYNQE----SLSLQSQLQLAKYIKEYL--------ID----
A0A7G1HW11      DIT-----SEAGMSLTMKSGYMSE----GVSLENQISLVNFIKDYL--------SD----
R5IP14          DIT-----SEAGMSLTMKSGYMSE----GVSLENQISLVNFIKDYL--------SD----
A0A316SZX7      DIS-----SEAQSQLQQSSAFKKE----GLSLENQINLALFIKEYL--------SD----
A0A1Y4AIY1      DIT-----SETGMYLQNTSQYRKE----GLSLENQLSVAQYIRDYL--------SD----
A0A0J6CIR2      DIS-----SETGMYLQESSQYSKE----GLGLENQVTLAKYIRDYL--------TD----
A0A3D8HG59      DIV-----SETGMYLKESSEYSRE----GLSLENQLTLARYIRSYL--------VD----
A0A3R6S408      DIV-----SETGMYLKESSEYSRE----GLSLENQLTLARYIRSYL--------VD----
F3ZRU7          NIT-----SDAEMFITETTGLKKE----ELEVLNQLSLGQYIKDYL--------ID----
A0A1C5Q1F3      DIS-----TQTGSFMERSNRYQQE----GVTLENQRTLALYIRDYL--------AD----
R7A239          DIS-----TQTGSFMERSNRYQQE----GVTLENQRTLALYIRDYL--------AD----
A0A3R6HIK7      DIK-----SETGMYLQNTSQYKQE----GLSLENQVAVAKYIRDYL--------SD----
K5ZVW7          DIK-----SETGMYLQNTSQYKQE----GLSLENQVAVAKYIRDYL--------SD----
A0A1Y4D5Z0      DIS-----SETGMYLQNTSKYKQE----GLSLENQLAMAKYVREYL--------SD----
A0A413VXJ7      DIT-----SETGMYLANTSLYRQE----GLSLENQLSIAKYIKDYL--------VD----
I9RSN9          DIT-----SETGMYLANTSLYRQE----GLSLENQLSIAKYIKDYL--------VD----
U6RJK5          DIT-----SETGMYLANTSLYRQE----GLSLENQLSIAKYIKDYL--------VD----
A0A1Q6GA32      DIT-----SETGMYLANTSLYRQE----GLSLENQLSIAKYIKDYL--------VD----
I9RPU6          DIT-----SETGMYLANTSRYQQE----GLSLENQLSIARYIKEYL--------TD----
I8YFS5          DIT-----SETGMYLANTSRYKQE----GLSLENQLSIVKYIKEYL--------VD----
A0A7J4XCM0      DIT-----SETGMYLQNTSRYKQE----GLSLENQLSIVKYIKEYL--------VD----
I8Y597          DIT-----SETGMYLQNTSRYKQE----GLSLENQLSIVKYIKEYL--------VD----
A0A1Q6GBF5      DIT-----SETGMYLANTSRYQQE----GLSLENQLSIARYIKEYL--------TD----
I8YFZ3          DIT-----SETGMYLANTSRYQQE----GLSLENQLSIVRYIKEYL--------TD----
A0A7J4XFW0      DIT-----SETGMYLANTSRYQQE----GLSLENQLSIARYIKEYL--------TD----
A0A1Q6GDH2      DIT-----SETGMYLANTSRYQQE----GLSLENQLSIAKYIKEYL--------TD----
U6RSB0          DIT-----SETGMYLANTSRYQQE----GLSLENQLSIARYIKEYL--------TD----
I9GXM2          DIT-----SETGMYLANTSRYQQE----GLSLENQLSIAKYIKEYL--------TD----
I9SIK1          DIT-----SETGMYLANTSRYQQE----GLSLENQLSIAKYIKEYL--------TD----
A0A7J4XIJ5      DIT-----SETGMYLANTSRYQQE----GLSLENQLSIAKYIKEYL--------TD----
I9TP59          DIT-----SETGMYLANTSRYQQE----GLSLENQLSIAKYIKEYL--------TD----
R5S343          DAG-----LETGVFLQESSLYNQT----GLGLDNQLSLAKYIREYL--------TD----
A0A1M6K7I9      DIT-----SETGMYLQTTTKYKQE----GLSLENQLSLAEYIKQYL--------VD----
A0A5M6A8C8      DIT-----SETGMYLQTTTKYKQE----GLSLENQLSLAEYIKQYL--------VD----
A0A7J4XCJ1      DIT-----SETGMYLQNTSRYKQE----GLSLENQLSISKYIKEYL--------VD----
A0A7J4XNQ7      DIT-----SETGMYLQNTSRYKQE----GLTLENQLSIAKYIKEYL--------ID----
A0A3R5ZMK1      DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
A0A7K1HMX0      DIS-----SETGMYLQTSSRNQQE----GLSLENQLSLAKYIKNYL--------TD----
A0A1Y3ZIA4      DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
K5Y1A4          DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
A0A7K1HDC0      DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
A0A3R6K8X4      DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
A0A6N8D6C8      DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
A0A3R6BKI7      DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
A0A412M2W1      DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
K5ZX55          DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
A0A415BDM7      DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
A0A1Q6I3T6      DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
A0A414XX40      DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
A7AEU7          DIS-----SETGMYLQTSSQYRQE----GLSLENQLSLAKYIKNYL--------TD----
A0A5F0U645      DIH-----SEAGMYLQEGSQYSQE----GLGLENQLTLAKYIREYL--------TD----
K5ZBN2          DIH-----SEAGMYLQEGSQYSQE----GLGLENQLTLAKYIREYL--------TD----
A0A0J6CKW3      DIH-----SEAGMYLQEGSQYSQE----GLGLENQLTLAKYIREYL--------TD----
A0A0F5IQM7      DIH-----SEAGMYLQEGSQYSQE----GLGLENQLTLAKYIREYL--------TD----
A0A496CDT3      DIH-----SEAGMYLQEGSQYSQE----GLGLENQLTLAKYIREYL--------TD----
A0A6G1ZKM3      DIH-----SEAGMYLQEGSQYSQE----GLGLENQLTLAKYIREYL--------TD----
S0GLB0          DIH-----SEAGMYLQEGSQYSQE----GLGLENQLTLAKYIREYL--------TD----
A0A3R6NLC1      DIH-----SEAGLYLQEGSQYSQE----GLGLENQLTLAKYIREYL--------TD----
A0A416WYC9      DIH-----SEAGLYLQEGSQYSQE----GLGLENQLTLAKYIREYL--------TD----
A0A7W7AX81      DIH-----SEAGLYLQEGSQYSQE----GLGLENQLTLAKYIREYL--------TD----
A0A0F5IT40      DIS-----SETGMYLQESSQYSKE----GLGLENQVTLAKYIRDYL--------TD----
A0A496CX20      DIS-----SETGMYLQESSQYSKE----GLGLENQVTLAKYIRDYL--------TD----
A0A5F0UBI0      DIS-----SETGMYLQESSQYSKE----GLGLENQVTLAKYIRDYL--------TD----
A0A6G1ZHG0      DIS-----SETGMYLQESSQYSKE----GLGLENQVTLAKYIRDYL--------TD----
S0GSI7          DIS-----SETGMYLQESSQYSKE----GLGLENQVTLAKYIRDYL--------TD----
K5YB65          DIS-----SETGMYLQESSQYSKE----GLGLENQVTLAKYIRDYL--------TD----
A0A0F5IWP9      DIS-----SETGMYLQESSQYSQE----GLGLENQLTLAKYIRDYL--------ID----
A0A0F5IZT8      DIS-----SETGMYLQESSQYSQE----GLGLENQLTLAKYIRDYL--------ID----
A0A417LKQ2      DIS-----SETGMYLQESSQYSKE----GLGLENQRTLAKYIRDYL--------TD----
A0A416TME1      DIS-----SETGMYLQESSQYSKE----GLGLENQRTLAKYIRDYL--------TD----
A0A7W7F3X3      DIS-----SETGMYLQESSQYSKE----GLGLENQRTLAKYIRDYL--------TD----
A0A416XPE8      DIS-----SETGMYLQESSQYSKE----GLGLENQRTLAKYIRDYL--------TD----
A0A3B0C2S4      YIE-----SDVDFSLQRKAVAQDE----VTNLETQISLAALLKNAV--------LG----
A0A5M8NYX7      DLT-----AEAQLFLTSQSEYSKK----IIELQNQMSVISSVKNYL--------SN----
A0A1M6GR99      NID-----EQSTRLAQQRLDLQNQ----LAELMTQKRYYDYIKEYN--------SD----
A0A7C5M4P4      SLD-----EDIRRTVTQINRLDSQ----RFKLQERLDDLNDLSQQL--------KS----
A0A1W2GF52      DLS-----SDLTKTIALLNELDSQ----RYNLREHLAEVDLVGENF--------RN----
A0A2G5L7B8      DLS-----QDLNYTIRLLNQLDSQ----RFNIRTQIAAVELANKQL--------GE----
A0A2D8JJW3      SSD-----GNANEHVEQFLKLKSE----RVAQQLKLDDLINAKEIY--------EQ----
A0A6B5PK86      DPE-----KEGDLMQTDANKFQEE----LFNLEDELSTLQFINQRM--------NE----
A0A2G2F510      NPE-----EAASNITDNISKLQDQ----LFLIEDELNSLITVHKMI--------GS----
A0A316JZ08      DPE-----LSGGELNEKLNDLELQ----LSDIDKEVASLIAIDNQL--------ER----
A0A2W1NDY9      NPA-----LYKENLLDQIDQLRTE----VLQADLEYDLILGLVEGI--------NS----
A0A5C8AQR5      DPE-----GITSELNGNISKLKDQ----LYTIEDELSTLRMVSGKL--------KA----
A0A1G0CI31      DPE-----TDGLSLTQNMDQFQDQ----LFMLEEERSALKLVSSKL--------RN----
A0A556N0M0      DPE-----NTNGSLTENMDKFQDM----LFELENELATLKTVHSKL--------KL----
F2IKD6          DPE-----GTGGSLSENMDKFQDI----LFDLENELTTLKVVNSKL--------KT----
A0A1I7BM74      DLE-----NIESNLSAKVNTLENE----LEKLKIEHQDLKRIKTEI--------NN----
A0A2G2FJ17      DPE-----NLGESIATKLEKYRFD----KFELQDELNTLEMISLKL--------KQ----
A0A1H4ADG3      DLP-----TQSQSLIANAGENAKE----LAAQQVQLSITNSLIEYM--------HS----
A0A5B8VUR8      DLP-----SQSQSLISNAGANAKD----LATQQVQLSITNSLIGYM---------S----
A0A1V5IPN7      EIS-----ETTRKWIEQTTQVESQYEAALTEQAVKAKTLDVLRKQL--------QD----
A0A7G7G5F9      DVE-----ADARLSISNASDYTKQ----LTDWGIQIDVLTSLENYL--------KK----
A0A2N3U785      NLD-----SDARMYVEKAADYNRQ----ISEWQVQIDVLQTIEDYL--------TK----
A0A0D3L8Q3      NVG-----TEAQLYLQGRTGYDQQ----LSEYELQLEILNSIEDYL--------RR----
A0A519U664      DIS-----SQASGYETQASNYTQQ----LAEWATQIDLLESLESYL--------RK----
A0A519MA34      DIA-----SQASGYETQAASTTQQ----LSEGATQIDLLESLEGYL--------RK----
A0A519UCX0      DIT-----SQASDFQAQNSTTTQQ----LSEWATQIDLLESLESYL--------RK----
A0A5B6TJH8      DVN-----TQASDYLAQASDYNKQ----LSEWAIQIDILRSIEKYL--------SQ----
A0A7Y0AA98      DIS-----AQATEYTAQASNYNTQ----LSGLAIQIEVLESLENYL--------DK----
A0A0E3ZG78      DVN-----IQASNYLNIASGYNKQ----LSDWAIQIEILESIESYL--------NK----
A0A1I6BRK6      DIA-----AQATSYAEQATNYDSQ----IAEWATQSEVLESLENYL--------KN----
A0A243WAB1      DIS-----TQASDYTAQASDYNKQ----LSEWGIQIDVLESIENYL--------KR----
A0A6G8C8X6      DIS-----TQASNYTNQASDYNKQ----LSEWAIQIDVLESIETYL--------RK----
A0A4R5DL69      DMAEQSRLLLANSSLYDKEKLQVN----LE--------LDMISSLQ--------AF----
A0A1M4YED3      DISEQGK-----EFLRTVSDNERQ----ATSINMQVSTLDQIERYV--------TS----
A0A7T9DAA2      ---TGSSDALLTALVGQKADLENR----LN---RINIQIDYLNRIV--------ST----
A0A7Y5V8S3      ---MMSAGTTSDALFQERSRLEDE----RS---AVMQKRQYCLTIL--------GK----
A0A126PFG0      DIASQSK-----VYLENAQANDSR----LNEAQVQLAVVSTIERTL--------RD----
A0A7V5VRT5      MPFAEARRQRTISLFSEIEQKRLL----VSQDAALVSVSDALRRVS--------DS----
A0A3M1N7Z3      ILFMEARKDRALSLYQDLNKLDKS----LSVE-YLNAFSEKLRRVL--------DT----
A0A7V1R2A1      ILFMEARKGRTLSLYEDLNKLDKS----LSVE-YLNAFSEKLQRVL--------DT----
A6EBM4          DIS-----VTSEHTLDKVSDLESQ----QSILRIQLIAIDQLRNTI--------TT----
A0A7X8C760      DIS-----SHGGELMSKANSLDEK----KAELKLKETYLNYLTKYL--------TG----
A0A501VZX6      NLS-----EQGKLYLESVEGRDLK----MSDIDLQLAVLDKVENYV--------IA----
A0A399SH26      DLS-----EQGRTFLQNMSANDSK----VEDINLQLAVLAKIENYI--------IA----
A0A501W1A9      NLN-----EQGRMFLQNVGENDRR----LGEINLQLAVLDNVESYV--------KA----
A0A0E3ZGV6      NLN-----EQGKLFLQSVDNNDRR----LNEINLQLAVLDNVERYV--------VR----
A0A1I2N4S1      NLN-----EQGKLYLQSVDFNDRR----MNEINLQLAVLDNVEKYV--------LS----
A0A2T5YE44      NLN-----EQGKLYLQSVDFNDRR----MNEINLQLAVLDNVEKYV--------LS----
A0A4Q8RX32      DVG-----MKASQIYDNLNALMAE----KEEKESHLQYLEFLNSNF--------NK----
A0A1M6TTV4      DLS-----RDLNNTIQLLNQLDSQ----RFKIRNQITAIELASEQL--------DE----
K0X1U5          DID-----AEAKIILEANSQYRKL----LLEAETQYSIISMVDSFL--------NK----
R5EXK3          DID-----AEAKIILEANSQYRKL----LLEAETQYSIISMVDSFL--------NK----
A0A401UAP7      DLT-----ADMSRTVEQINALDTS----SFTINSRLRLIRKLKEDL--------KD----
A0A523GAC0      DIQ-----TDLSNTIKAITVLDSQ----NVILEKKLTGIHQLQSNV--------GN----
L8JW09          DLN-----EDLKRTIETINALDSQ----RFQLTKRIQAFDQLLADL--------EN----
A0A364XUP5      NLD-----EDLKRTVTAISRLDSQ----RYEFASRMQELNQLSDGL--------RS----
A0A1M5RLA9      NLD-----EDLKKTVSAINRLDSQ----RYELTNRIVEVNTLMDGM--------KA----
A0A385SFR9      NLD-----EDLKKTVSAINRLDSQ----RYELTNKIVEVNTLMEGL--------KT----
A0A5M4A9J4      DLS-----YQSQQLLDQMVSLQEQ----KEQLSTQKSYYTYLLNYL--------KS----
A0A5M4B1C7      DIS-----YQSQQLLDQMVTLEEQ----KEQLTTQQAYYRYLLQYL--------KS----
A0A0D3LFR6      NLN-----KDISNTILLLESVDSQ----RVATRRQLNNLTNLSSRI--------KS----
M7N6D4          NLA-----GDINRTIIMMEAIDSQ----RVQLRKQLSSITSLASRI--------EA----
A0A5C7MX19      DK------NELQTMSSEVSSTNII----IRMLTQDILSIKSFKKIF--------KD----
A0A1M5BA90      DLS-----EQGKLYLQNVGDNDRK----MTDINMQLAMLNEVEKYV--------LS----
A0A512B879      DIS-----EQGRLYLQNVGDNDRK----MTEVNMEMAMLNEVEKYV--------QA----
A0A559PPI3      DLS-----QQSRIYLQDAGHNDQR----IADIRLKLSVLDKVENYI--------LS----
A0A1T5CS78      DLS-----EQGRLYLQDVGENDKQ----ISELELQLAVLNNVENYV--------IS----
A0A0Q9Z8F1      DLS-----EQGRLYLQDVGENDKQ----ISELELQLAVLNNVENYV--------IS----
A0A2N0U0M7      DLS-----EQGRLYLQDIGENDKQ----ISELELQLAVLNNVENYV--------IS----
A0A1Q3ZMZ7      NPD-----NVADQLIQKIDEANEE----SYLANNNLSTLKDLKRRI--------NS----
A0A7Y3KMD1      EQV-----EYAKQNISHLFTLDDQ----VSSAAEEVKLLNYVRKEI--------EN----
A0A3C1ITV0      DMN-----AETAQVTQESSKYSEQ----AFLANNQLAVARFIREYL--------VD----
R7HN19          DMN-----AETAQVTQESSKYSEQ----AFLANNQLAVARFIREYL--------VD----
A0A2W2AFF7      DIG-----EESKILLGSTSDYMKQ----LTQSEVQLSIVESLQKYL--------HE----
A0A845PZ37      DVV-----KSGDIYLSDGRQYKLQ----KTKIETDMQLAEMMRSYL--------------
A0A077ENE7      DVA-----TAGSLYLNEKNQYKSE----GTKIETDIRLAEMMRSYL--------MN----
A0A854FRG7      DVE-----AAGGMYLSESNQYKTE----KTKIETDIRLAEMMRSYL--------VN----
T0NN57          DVE-----AAGGMYLSESNQYKTE----KTKIETDIRLAEMMRSYL--------VN----
R7PCR1          DFQ-----KSAEAFLQQQGTARNL----ALDYETQLSVARYLESYL--------HS----
A0A2N5YXE2      SNTETLLFNKTNLYTTKMSELESK----LLNVDFEIMTLEKVSEKI--------EK----
A0A2U1FKU2      DIT-----TDVGTYLKNSSDLQKD----QLIVERNLSLAKYIQAFL--------RQ----
A0A0A2F954      DIS-----TDVGAYLKSSADLQKD----QLIVERNLSLAKYIQSFL--------RQ----
A0A0A2FW91      DIS-----TDVGAFLKSNADLQKD----QLVVERNLSLAKYIQSFL--------RQ----
A0A2D2N2N1      DIS-----TDVGTYLKSSADLQKD----QLIVERNLSLAKYIQSFL--------RQ----
Q7MWZ2          DIS-----TDVGTYLKSSADLQKD----QLIVERNLSLAKYIQSFL--------RQ----
A0A212FSE5      DIS-----TDVGTYLKSSADLQKD----QLIVERNLSLAKYIQSFL--------RQ----
T2NDT6          DIS-----TDVGTYLKSSADLQKD----QLIVERNLSLAKYIQSFL--------RQ----
A0A1R4AFZ0      DIS-----TDVGTYLKSSADLQKD----QLIVERNLSLAKYIQSFL--------RQ----
A0A1R4DVZ7      DIS-----TDVGTYLKSSADLQKD----QLIVERNLSLAKYIQSFL--------RQ----
A0A1V9FHD0      DLT-----EQGKQYLENVGTNDRK----IADLSMELAALDEMERYA--------NS----
A0A4V4H170      NLG-----EQSRQYLENVGSNDRK----IADLSMQLAALGEMERYV--------NS----
A0A1V9F098      DLS-----AQGRQYLENVGSNDRK----MADLSMQLASLNEMERYV--------NS----
A0A4R2VU64      DLG-----AQGRQYLDNVGSNDRK----MVDISMQLASLNEMERFV--------SS----
A0A0K8QSK7      DLS-----AQSQQLLQQMSELDNQ----RVVLESQLKYYRYLRNYI--------IQ----
A0A7C0WKI7      ALP-----EETQRMVDQVVEFQTA----YNTADIELKTYQTRLNYL--------KS----
A0A1T5K9D4      DAN-----ADAAEYLSESRSYGSD----ISQVETNLSIAEYLRDYV--------RG----
A0A5M4B212      DVS-----YQSQQLLDQLVKLEDQ----KSLLETQHQYYQYLEEYL--------SK----
A0A3D1KEX9      DFT-----ENARTYLQQSALSQQE----LNKTQAELSVAKYLREYV--------VK----
A0A358Y7S2      NIE-----KIGDNLSENLTNYSKV----ILELEEELSTLYLVQGKL--------TS----
A0A2J6HHN3      --------EDKTGLKSRMRELDRL----ISKTKYEKEVLSAFILSV--------EN----
A0A1Y3WMT8      DID-----TEAKIILEANSEYRKL----LLEAETQYSIISMVDSFM--------NS----
A0A1Y4GQU1      DIN-----SEAKIILEANSQYRKL----LLEAETQYSIISMVDSFL--------NR----
A0A6A0R272      DFE-----SVERIESERLIDLESS----KRIAELRILNFNIVENEL--------NQ----
A0A1V5W8T5      GSIF----DDKAAIQNALMDNSQQ----IKQYDTQLQSLQKVNKQI--------AA----
A0A2T8HKA9      DVN-----EAAGMYITESREYLNA----SRELETQLSLAEMMRDYI--------YD----
A0A1X7J248      NPS-----DDVSRLIAEMVKMDSI----LYGINYQLGEIENIQKQL--------EK----
E4TQD2          NPS-----QDVSRLISEMVSMDSI----LYGINYQLAEINNIQSQL--------DK----
A0A2I0QZ80      NPE-----HLSGSISSKIEFLRTE----ERNIIEEIRVLKVVKEKL--------NS----
A0A3E1F1A3      NPE-----YLTSSVASKMEKLKAE----ENNALEEMRVLETVKKKI--------EG----
A0A2U2XBJ3      NPE-----QIAANTSQKIEKLRTE----IRQGMEELRVLNSVQDKL--------EG----
A0A4Q4KU94      NPE-----FIASTTSQKIEILKLE----ERNGLEELRILNSVESKL--------KG----
A0A3B8INU3      DLS-----SDLQKTIQQIWTLDTL----LGTARSKQKSVNRMFSSV--------ID----
A0A7V6V2N8      ALSTNDTFTSFFSLKQEINKLELE----IERINDEIVILNKSQEIL--------NK----
A0A414ZBF2      DVT-----SESALLLQNSSRLGGE----SLSIENEVVMAEYIKDYL--------QD----
A0A7X9D3Q8      DIR-----SESALYLQSSGRLDTE----VLSLENQLDMAEFMKVYL--------QD----
A0A1Q3Q573      SDD-----NSSQGILTSANALQQA----LIASENQLYLLQNFKMLL--------QK----
A0A662BAY3      NIS-----IQSEQLLDQVNELEKE----KVVLETKNKYYKYLREYI--------IN----
A0A4U3L369      SPD-----VQAQLMASTYDENFKL----GNQLELQLAIIKNLKEYL--------QD----
A0A4S8HY23      DLG-----EQSKQYLENVGSNDRK----MADLSMQLAALEEMERYV--------KS----
A0A1V9F383      DLG-----EQSKMYLENVGDNDRK----IADLSMQKAALDEMENYV--------TS----
G8TRZ6          DLG-----EQGKMYLDNVGDNDRK----IADLSMQIAAVDEMENYV--------NQ----
A0A357YNR3      DIA-----AQANLYNNQMANVGQR----RMDIESQLSIVSNLNDYV--------QN----
A0A7X6YKE8      DIA-----AQANLYNNQMANVGQR----RMDIESQLSIVSNLNDYV--------QN----
A0A5E8AX52      NIQ-----TDLGRTIVLLQSLDSQ----RYDLQNKLTNIQMAQEQM--------DK----
A0A1V6CN82      DIG-----SQSGQLLSEMSELDSK----KQELETQNKYYNYLKTYI--------L-----
A0A1M4XZ45      DIS-----MQSQQLLEQMRDLDQQ----RVALETQNKYYHYLRDYI--------ST----
A0A399D319      DIS-----MQSQQLLEQMRELDEE----LVTLETQNKYYHYLRDYI--------HS----
A0A7Y1YS85      TESAS---ASLGFALNEMRSDLAA----LSSYELENELLLTLEESL--------TE----
F4KK08          DIQ-----AEAQEYIKGSSEVKTR----LVELNNSISIAQFVRGHL--------KD----
A0A7V5VE02      ALS-----HETEELIKKLAEFETL----YNEALTELNSYRKRLEYI--------DD----
A0A496LCF9      GE------NNTTILTSKMDELQQV----GKQIRLRDEYFKYLRNYL--------KS----
A0A5P2G2A9      DLE-----AQAQAVISSSSEYEKQ----LNQAQVQLAIVNTMLDYV--------LN----
A0A3C0ZQC7      SLD-----DEAKKVIDQLATLEAQ----RDAADIELQALSKTLTSY--------QE----
A0A3N2N6F7      DVA-----AASEMYMANANENTKQ----QLGVMTQMEITRFLIDYM--------QS----
A0A419VXB7      DLS-----QEATLVTGKLSNLDTK----RSMAEMQLEYYKNLRGYI--------GE----
A0A1Q6E6I7      DII-----SETKLSLETSRQYEDD----LLKTEIQLEMLSAIGDIL--------NG----
A0A3B9CNN6      DII-----SETKLSLETSRQYEDD----LLKTEIQLEMLSAIGDIL--------NG----
R5X290          DII-----SETKLSLETSRQYEDD----LLKTEIQLEMLSAIGDIL--------NG----
C3J7R8          DIQ-----QEARSYITGTAEFARQ----MTEVNNKLAVANYLKDYL--------KS----
A0A1G8BVM8      DIP-----SVSSMYLDASSRINAE----ALGLENQLSIANYMKNYL--------HD----
A0A1I1FXP9      DVR-----DQVAEMITHVEKLKKD----KIELEIQNSLLMDLRNTI--------IN----
A0A4P7VVU7      DVA-----AASAMYMEDANENTKQ----QMQVSTQIAISKFILDYI--------KN----
A0A2V1ILM4      DVA-----AASAMYMEDANENTKQ----QMQVSTQIAISKFILDYI--------KN----
A0A3N2L0E8      DVA-----AASAMYMEDANENTKQ----QMQVSTQIAISKFILDYI--------KN----
A0A3N2LFC5      DVA-----AASAMYMEDANENTKQ----QMQVSTQIAISKFILDYI--------KN----
A0A7K3KWJ8      DVA-----AASAMYMEDANENTKQ----QMQVSTQIAISKFILDYI--------KN----
A0A3N4H5N3      DIG-----LDSRIFLESTQEMRKE----ISDISSKIEILESLENLI--------NS----
A0A2P8EAX2      DIG-----LDSRIYLESTASTSKE----ISELSNKIEILESIESLI--------AV----
A0A4V2F6N9      DIG-----LDSRIFLESTASTSKE----ISELSNKIEILESLENLI--------AV----
A0A838T9G8      IG------GMEEDLNTTLKDLKLQ----LNEQDLQYSTLEYYRKYF--------LR----
A0A3B9FXJ0      NPS-----IAEQNLMTKFNELDQN----KLDVQLEERSLKWLLDYA--------NN----
A0A848SUJ0      APQ-----KQIDLMVDKLEELETK----KNETVFDLNLTKWLTDYL--------DS----
A0A847ALW2      DLS-----MQSQQLLEQISELDRR----RVDLETRNSYYKYLMNYI--------QD----
B2RKZ8          DIS-----TDVGAFLKSNADLQKD----QLVVERNLSLAKYIQSFL--------RQ----
A0A0K2J6Z0      DIS-----TDVGAFLKSNADLQKD----QLVVERNLSLAKYIQSFL--------RQ----
A0A212GC82      DIS-----TDVGAFLKSNADLQKD----QLVVERNLSLAKYIQSFL--------RQ----
A0A0E2M2Y7      DIS-----TDVGAFLKSNADLQKD----QLVVERNLSLAKYIQSFL--------RQ----
A0A829KSZ7      DIS-----TDVGAFLKSNADLQKD----QLVVERNLSLAKYIQSFL--------RQ----
R5GSU5          DFE-----KSAQSALEEQRTLRLS----MLQAEVQLSVAEYLEDFL--------KN----
A0A7X8I6A2      DKPKSE--SPIPLFVSRATEMENE----ILSVEFELSTLEYIKTEL--------SD----
A0A0A2G557      NIA-----SEAEVYIESSKEITKQ----TIEVNNALAVAGFIKEHL--------TN----
A0A1T4PT95      NIE-----SEAEIYIESSKEITKQ----TIEINNSLAIARFIKEHL--------TN----
A0A6I6JYY3      DIS-----LQSQQLLEQMKELDNE----RVALETQNKYYHYLRDYV--------GN----
A0A651GU15      DLN-----RISEFYLSYFQQYDDR----QMELEYEEKLLGELEKVA--------LA----
A1ZKR2          DVN-----KKLEESVKEIEKLIKE----KIVFNEQLAAIKELDDLV--------NK----
A0A1Q3GX01      DVN-----EKLEKSVQEIEELLKQ----KLALSDELAGIKELENLM--------EQ----
A0A349DQI4      NIN-----EKLDKSVQEIEQLIKK----KLKFTDELAGIKEIENLI--------AE----
A0A4P5TMD1      STD-----SKQQEILTALKEINAN----EEGLNLDEKNLNYYLGYF--------NL----
A0A3Q9FR88      SY------MEAGPIVGNIQELEKS----LSSLKNEKKKYQKLRHFL--------EA----
A0A553GEX3      SY------MEAGPIVGNIQELEKS----LSSLKNEKKKYQKLRHFL--------EA----
A0A150ADJ9      SY------MDAGPIVNNIQELEKS----LNELKGERKKYQKLRHFL--------EA----
A0A7X9P1P7      SY------MDAGPIVSNIQELEKS----LNELKGERKKYQKLRHFL--------EA----
A0A7X8SM94      AY------MEAGPIVDNIQQLEKS----LNELKNEKKKYQKLRGFL--------EA----
A0A1S1Z228      SY------MEAGPIVGNIQELEKS----LNQLKSEKKKYQKLRHFL--------EA----
A0A1B1FWQ4      SY------MEAGPIVGNIQELEKS----LNSLKSEKKKYQKLRTLL--------QA----
A0A7X9Y5D2      SY------MEAGPIVGNIQELEKS----LNSLKSEKKKYQKLRTLL--------QA----
A0A7X8ISG0      QI--ELYLLNIEKIQPELEKAEEE----LAVIEQNERVLNNILTTL--------KK----
A0A2N3IIZ0      NIE-----GKISELVNKIQQLTEE----RYKINAKLQTIIELEIFV--------NQ----
A0A7X8Q7Q7      NK---------GVLHTRIYEIDNL----ISKNEIEIESLEQFDNSF--------TS----
A0A2N2WFW8      DR---------SSLQARLFELDNL----LAANISELESLDRFYNTF--------ES----
A0A1F3IU95      DR---------TALQSRLFELDNL----ISENSSEVESLEIFYKAF--------SS----
A0A3D0VUF6      DR---------TALQSRLFELDNL----ISENSSEVESLEIFYKAF--------SS----
A0A7K3WUF2      NLD-----NLATLYFDYFRQFEDE----MVLVDLETNMLNQVLKAI--------DE----
A0A497D5Z2      NIS-----LQTEQLLDQINDLDKH----RVMLETKDKYYNYLRDYI--------RN----
A0A662B170      NIS-----LQTEQLLDQINDLDKH----RVMLETKDKYYNYLRDYI--------RN----
A0A7X7FWB7      EIEIFL--ENIDKIQPELEKAEEE----LAILEQNEKVLNNILITL--------KK----
A0A7X8DM61      KIEFYF--QNMDKIQPELEKAEEE----LVIIEKNEKVLNNILTTL--------KN----
A0A3M1CDV2      STDNNS--ALSTSQSQIYSSVQEQ----LLQIELNEKLLDEILNNI--------QT----
A0A1F3SJM1      DPE-----SISGTITENISKLNDE----LYRLEEEQLSLDILDQKL--------NA----
A0A2G2EB96      DPE-----NAGISISDNVNKMQDQ----LFELEEEYNGLLNVKQKL--------SK----
A0A2G6PRA9      DPE-----NVGVSINENANKLQDQ----LFELEEEYNGLLNVKRKL--------SK----
A0A7Y7A9N2      DPE-----NVGVSINENANKLQDQ----LFELEEEYNGLLNVKRKL--------SK----
A0A6C1QGZ7      DVTI----TPLPMLQTRIADFENQ----IVMLQLEKSIFSEIEKSL--------QF----
A0A7W1EH85      DKD-----VLLNSELIRYTSVEDQ----LLKVEMEEKIIAEIQTNI--------SR----
A0A2E3XZI5      NKT-----TLIENQTKRIEEIEKE----LTVINSNINLLNQFDLMF--------DE----
A0A6I7QXV0      NPT-----DEVQMVMGRLNRVENM----MLELSFNLQAIEWLENYI--------SG----
A0A7Y3V126      DVD-----QFASLYLDKLNRFENE----IIDLDLQLNVLKEIETKI--------NS----
A0A7Y5C3U1      DVD-----QFASLYLDKLNRFENE----IIDLDLQLNVLKEIEAKI--------NS----
A0A2M7NLQ9      SQKPEEYQALVQNILNDIRELQEK----RVEMDNELKLYREISTLL--------ED----
I4AFR0          SQNPQEYQSLVQNILNDIRDLQAK----RLDIDNELKLYKEISTLL--------EN----
A0A2N2Y3E5      TDDEKDL-ATYRSVIERITRVESD----LEGIKVEVDTYNNLLDYL--------KK----
A0A2D9D7T6      NPD-----NTTVELSSRINSFKTR----QLENEEELVTLYLIKSKI--------TP----
A0A1F3PPL5      PNSDLNL-SAFPIYTSKIHEFDEE----IMNIEFELVTLNRIKSEV--------AE----
A0A357QK06      PNSDLNL-SAFPIYTSKIHEFDEE----IMNIEFELVTLNRIKSEV--------AE----
A0A7X9JJJ8      FSTEDEKGGALSKYEQLTDKIQQE----IEDVELELFSYNKLISKL--------EQ----
A0A522EYA6      EVK-----NMPDAGSARLNSLEDE----LISLELRANVLVELEKSI--------EG----
A0A662AEA4      YNILSNQ-NSAPIFTTKITEFQNE----ILNIDFQLVTLNRIQKQI--------VK----
A0A0S2HYK8      SEALER--TPFPIFTAKIEEFEEQ----ITTLDFELITLKNVKTQL--------ET----
A0A2N5ZWN6      SDAFER--SPFPIFTSKIEEFSEQ----ITQLDFEIFTLENVNDQL--------KK----
A0A2E0FJ09      QVE-----GMTDSYLSRIEEMESE----LVKLDVDEEILNEIATVI--------TD----
A0A1F3FZ62      DRL-TDM-KSPPTYFSRVNDLQSQ----LLNIEVEEKMLEELEKNF--------SS----
A0A1F3K211      DRL-TDM-KSPPTYFSRVNDLQSQ----LLNIEVEEKMLEELEKNF--------SS----
A0A7Y1UDU0      DPT-----SAGSSYISKINVLRDE----LYEYEFDLSVLEKIASEV--------NS----
A0A1V6I2U9      NIKDEYLFNKSNIYSSQISDIESK----ILNVDFEIMTLEKMLDKL--------KS----
A0A2H0B957      GDKESST-SNVNRYANLLTKIEED----IDITDIEISSLKQILDEI--------SK----
A0A1F3CFW6      NDNDSKE-TGTERYSILLSKIEEE----LDNVEIDISNLKQILDEI--------SK----
A0A2M7E2T8      NDKDSKE-TGPERYSILLSKIEEE----LDNVEIDISNLKQILDEI--------SK----
A0A2M7NC69      NDKDSKE-TGPERYSILLSKIEEE----LDNVEIDISNLKQILDEI--------SK----
A0A1F3KLL5      ALQ-NKL-SPLPLFTAKINELQSE----ILKTDFELATLKRIEKQL--------SA----
A0A359D1M1      ALQ-NKL-SPLPLFTAKINELQSE----ILKTDFELATLKRIEKQL--------SA----
A0A0F2NS19      --G-NPN-EVSSIYLDKINRFENQ----LIDIDFQTSVLKEISKSV--------TG----
A0A2A5H8X6      --G-NPN-EVSSIYLDKINRFENQ----LIDIDFQTSVLKEISKSV--------TG----
A0A2H0GAU8      --G-NPQ-EFSSIYLDRLNRFENQ----LIDIDFQRNVLTEISKSV--------SG----
A0A2M8FTK1      --G-NPQ-EFSSIYLDRLNRFENQ----LIDIDFQRNVLTEISKSV--------SG----
A0A2A5B3B0      --S-TLD-R-SSIYFDRSSKLEND----LFNIDLQKKILEEIKTSI--------SS----
A0A5C6RXM7      --K-GAD-A-TQKYFDRSTKLEDQ----LIDIELQKNVLVEISSSI--------ES----
A0A7W1FWM4      --D-ENK-DITLTNVARLNTLEDQ----IIALELEGNVLDKIESNI--------NS----
A0A7T9QP55      --A-DMD-QLTPLLLQRSDEYEDE----MLKLRMEDNLLKEIEHAA--------KQ----
A0A7V9MK11      --A-NDK-DFISLNIEKFSSIESE----ILELELNENMLKTIEKRI--------SE----
A0A1F3C1M2      LTNQDNV-KPISIYLTKFTEIETE----ILNIEFEYSTLKRINEYV--------NK----
A0A1F3DS87      LTNQDNV-KPISIYLTKFTEIETE----VLNIEFEYSTLKRINEYV--------NK----
A0A7Y5QSG1      --S-DMS-ELTPIYLNRVREYEDR----ILEVRVELDLLAAIEQST--------DK----
A0A7Y2EX06      --S-DLT-NISAIYLSRYTEFEDG----ILKIELEQNILNEVEKVT--------KE----
A0A7Y7NV14      --DSNDI-KPLPTVYSRINDFGNQ----IVKLELEDNILSEIDNTI--------KK----
A0A6A0R6K9      --P-DVD-DYSRIMIDRISQLNEA----QVDLEVQISLLEEVKKEI--------DK----
A0A2E7CT70      --N-SSL-MANKTQLSKISEVENK----LVQNQVDITLLNQFQEMF--------QS----
A0A2D5V560      --N-XXL-LNISGIKENXEKIEIE----IAKXQIDIDLXNQFSDMF--------EN----
A0A2D7K5A8      --K-NEL-IGITGLKDKAEKIEKE----IVKIQLDIDLMDQFSNMF--------EN----
A0A2E1XQ82      --K-NEL-ININGFQDKAEEIEKE----IVKIQLDIDLMDQFSNMF--------EN----
A0A1F3K695      ISESELNTLSLNLYASKIEEIETE----ILNLDFELITLKRIQEQI--------NS----
A0A353KZR1      ISESELNTLSLNLYASKIEEIETE----ILNLDFELITLKRIQEQI--------NS----
A0A2N2WYB5      LDKYPINGSPFPIFTAKISEFEDE----LINIEFELVTLQRISTQV--------NV----
A0A1F3K4G0      TDQFKAEGSPFPLFTTKISELEDE----LINIDFELVALQRINQQV--------AN----
A0A356H8Y3      TDQFKAEGSPFPLFTTKISELEDE----LINIDFELVALQRINQQV--------AN----
A0A351HSA6      TDQFKAEGSPFPLFTTKISELEDE----LINIDFELVALQRINQQV--------AN----
A0A2A4PYG9      QQ--GDFI---TVYVXKLDNIENE----LMDLELETSMLDEVADMI--------KK----
A0A350JJ90      KK--KGIA---ATYITRVNVLEQK----KVELELKISLLSELRGGI--------QI----
A0A2A4YXP3      SM--DRSS---SYF-DRSNRLENE----LIDVDLQQSVLKEVKKSI--------SL----
A0A1F3R158      DI--DKFS---SLYVDRVNKLENQ----LVDIDLQKNVLEEINNSV--------KG----
A0A2M8ADX2      DI--DKFS---SLYIERVNKLENQ----LVDIDLQKSVLEEINNSV--------KG----
A0A1J5B2H0      TIKLDVVP---TLF-SRQNELENQ----FSKLELEENMLNEVEITF--------NA----
A0A1V5N756      LI-FQPLP---EVY-SIIKEFNSE----ILKLEIEIAKLKRVEEFV--------NQ----
A0A4P5U6G4      ST--ESKI---SEILTALNNIKQK----QIMLNIKDNMLYSYQDYF--------NR----
A0A2E2TFD1      GS--SELT---GIYLDRLGNLEEE----LIKQELEQEILIQVKQAA--------TS----
A0A2E4ELE6      KT--ENFT---EMYIDRLALLEEE----LIKLELEKDILDELKAAS--------DG----
A0A2A3UE91      EK--DKII---TTELMRYSTIEDQ----MLQAQMEETLITEIQANI--------AK----
A0A7V9SRJ9      EK--DILI---NSELIRYSSIEDQ----LLKVEMEERIIDEIQKNI--------NK----
A0A2E6SYP1      DD--FDYN---QLTRDLKGKDENE----KIELQASLSDFTQFQLKL--------SE----
A0A2E5RLE8      YG--TDYG---KLALDLAAKDQIE----KTKTESTLNDFRNFYSAI--------SN----
A0A2E7TQF6      YG--TDYG---KLALDLAAKDQIE----KTKTESTLNDFRNFYSAI--------SN----
A0A2E6GVY9      IK--TDYG---KLALDLASKDQIE----KTKLETTLIDFKNFYSSI--------SN----
A0A2A5FYT6      GN--DGFT---GIYLERLNLLENE----VINLELEESVLKEIEKKI--------TA----
A0A6N9NIX1      GA--KEFS---SIFIERLNQLDNA----IVESTIQKNILEEIYNQI--------NV----
A0A1F3Q014      NT--DIEN---TAKTTRLNALDDQ----IISLELEENVLNKIET-T--------LS----
A0A2D5KD44      EI--DQFS---KVYIERMNQIDQA----QVELEIEIATLEEIKKQI--------KE----
A0A7Y2F301      DL--NMVS---DVYLDRLNTVEQQ----LFDLKIADNLLNEISK-I--------QD----
A0A0E3V905      DLS-----VQAQTFLQTVQQNDAL----MNQVQIQLATLNDLQKYI--------EG----
A0A553ETH6      DLN-----EDLKNLILIINDIDSQ----RLSIKNKSKDIKIFLKNL--------EA----
A0A2D4ZVH1      AVD-----PQTEEIISTIANLEVE----KQKLEVGLVAVMSGIAQY--------EN----
A0A6P1P355      NLS-----EQGKMYLSSVGESDRN----LSDINLQLAILSEVEQYV--------VL----
A0A3D0MYJ7      --------------------NQSK----FTTISNEIASLEVKRDIE--------LS----
A0A4Q5WS95      DLS-----EQGKLYLKNVGEIDQK----LAEVNMKMAVLGQVEQYV--------SA----
A0A7V9RTA1      DLS-----EQGKLYLRNVSESDQK----LADVNTRLGVLNQVENYV--------TA----
A0A5C8KAD6      DLN-----EQGKLYLRNIGDNDRR----ISEISNHLSVLDQIEKFV--------VS----
A0A5N1J695      NLG-----EQSKLYLQSVGENDRK----IADINIQLAVLQKVENYV--------IS----
L8JI02          DIS-----YTAENLSKNLDRLESE----KADLQVKLKYYTYISESL--------AE----
A0A1Q3PII2      DAT-----EDGRQILERFHANASE----EKELAVRMKIVELLAAHL--------RA----
A0A351BXT2      LLD-----AQVKNVVENISVLEAQ----QNAARIELNSKQEEYNSL--------KS----
A0A2K8Z965      DLS-----VQAQSFLETVQQNDAS----LIQVNVQLAALNDLQKYV--------ET----
A0A418M8U8      DLS-----TQAASFLQAIQQNDGL----LNQVNIQLSALSDLQRYI--------NN----
I2GTA4          DLS-----TQSASFLQAIQQNDGL----LNQVNIQLTTLSDLQRYI--------NN----
A0A2K8ZAJ2      DLS-----VQAEKFLTTVKDNDLQ----LNDVNMRLGALADVERYV--------QS----
A0A368JPA3      GIG-----SGAQSLLSSLQSNDAQ----LNRVAIQLSTLGDVEKYV--------RS----
A0A5N1JI29      GIG-----SGPQSLLSSLQSNDAQ----LNRVAIQLSTLGDVEKYV--------RS----
A0A7K0EGC9      DIG-----AGAQALLNGLQSNDAQ----LNQVAIQLSALGDVERYI--------RS----
A0A3P1BT12      GIG-----SDAQALLSTLQNNDAQ----LNQVAIQLSTLGDVEKYI--------RA----
A0A3P1CI15      GMG-----SSAQALLSNLQSNDAQ----LNQVAIQLSSLGDVEKYI--------RS----
A0A4R8CUK1      GMG-----PGAQWLLDTLQKNDAQ----LSQLAVQLSALGDVEQYI--------RE----
A0A7Y6XX71      DLD-----GVVGLASEELQGLSEQ----LLVAENRLKNSEIIYQQV--------QN----
A0A2H3NSN0      IDG-----QDGNRVATDYVEMMGQ----RDQLEFQLQEEQRTLDML--------VN----
A0A800J4N3      RLD-----EEASNIVSQLAGLEAE----RDQARVEAGMLAARIRQL--------ES----
A0A2P6C324      TEG-----LDGQNVAAEYAELQSQ----RDALTFQLEQEKRTLSIL--------ED----
A0A7V2F6E1      RLG-----PQGERLVAEVAQLEAQ----RDAARFQLEQERSALQFI--------ER----
A0A1M6XHU0      RLG-----PQGERLVAEVAQLEAQ----RDAARFQLEQEKSALQFI--------EQ----
G2SF81          RLG-----PQGERLVAEVAQLEAQ----RDAARFQLEQEKSALQFI--------EQ----
A0A5S9EYW1      RLG-----PQGERLVAEVAQLEAQ----RDAARFQLEQEKSALQFI--------EQ----
D0MHQ9          RLG-----PQGERLVAEVAQLEAQ----RDAARFQLEQEKSALQFI--------EQ----
A0A662AH13      ALD-----DQAKALIDILSTFEAQ----RDATFIEMVATERTINVY--------KA----
A0A5C7QA01      DVS-----KESELYLSQSITLETK----K-------------------------------
A0A3D3LS70      FLD-----DQAKSIVEQIATLEAQ----KNASEVELITSRRTYDAL--------KS----
A0A1G1TM36      DVA-----SQSQIVLENTQANDTR----LNTAQVQL----AVVESI--------ER----
A0A1G7ZF38      DMA-----EDGRQALQQYHSNASD----EKQLAMHL----KIVGLL--------EA----
C6VS52          DIA-----EDTRQALQKLAANTSE----EREWATHL----KIVQLL--------ED----
                                                                            

A0A7V5RJC2      ----------DEGGGQISDEQRTIYNQILGLKIFEDNVSASLLRTRIAKLEEDYDK----
A0A7C1LGX3      -----------------QAAFELL-PVDVGLE-----NSGL--NSMVDRYNDQVLQ----
A0A1T5MMH4      -----------------QTGNFSVNPSIRQAL-----PEYM--FKDIDEVQSLLLQ----
A0A2W4R1L8      -----------------SNGVYLVNPVHRLYF-----PQAI--NDNLDKLSELQMS----
A0A7L9BFB6      -----------------AGNEFYVSPSQRTLF-----SESV--NKNIEKLQELYLD----
A0A5C8A5B4      -----------------SSDLRNV-PAPSSSG-----IDDPVLNNLVIEITKLSAD----
A0A2E5CV79      ----------S------AEEKNFATKISTDIN-----AQMIVLRKEINQLESQSIQ----
A0A2A4G4B1      ----------L------EGGIQLL-PTNIGLD-----HSGV--KETIDNFNQLILE----
A0A0P7X1V8      ----------Q------QELDRLT-PGLSEQL-----TASI--APRINQLQVFLADRET-
A0A4Y9ITE2      ----------P------NHRYDLI-PTPYGAE-----AA----VDAIAEYNKLILE----
A0A3N2M1H3      ----------S------ANKFNII-PANTG-L-----DNPSI-EKDIATYNTILLA----
A0A4S2G8T2      ----------S------ANKFNII-PANTG-L-----DNPSI-EKDIATYNTILLA----
A0A212K7W5      ----------S------RTKDMLL-PANLG-I-----EGTNI-DRQINEYNTLLLK----
F5IU11          ----------P------RTKDILL-PANLG-I-----EGANI-EGQINEYNTLLLK----
A0A7C1QWC7      ----------N------KDIAGLA-PPSAANV-----VDPIM-NTLVLELLDLNAQ----
A0A7Z8P8P1      ----------V------TRNNQLI-PNVSG-V-----GDASV-QNQITAYNELMLQ----
K0XJ09          ----------N------ENGKQLI-PNVSG-V-----GDSGL-QNQITTYNEILLQ----
R5EUZ0          ----------N------EHSKQLI-PNVSG-V-----GDSGL-QNQITTYNEILLQ----
W0EQS0          ----------K------ENNKQLI-PNVSG-V-----GDAGL-QSQIEAYNAMILQ----
A0A1Y3WE15      ----------E------KGDKQLI-PNVSG-V-----GDAGL-QKQIESYNEMLLQ----
A0A1Y4GUK3      ----------D------KDNKQLI-PNVSG-V-----GDAGL-QSQIEAYNEMLLQ----
A0A352Z1R7      ----------T------LRKGNIY-SPAIM-R-----DDPLV-AGLATKLSELEIQ----
A0A7X7BZF5      ----------V------GNETQLL-PANSG-I-----GSGSI-DDQISDYNDKLLR----
A0A0A2F501      ----------D------TNATQLI-PAISG-I-----GNKLI-DQQIGEYNQKMLE----
R5B7P0          ----------E------DNRNQPL-PANMG-L-----SSQTI-ENGISEYNSKILQ----
R5B0L5          ----------E------SSRNQPL-PVNVG-S-----GSPAI-ESQIAQYNDAMLE----
A0A6I1TEC0      ----------R------VSKNQVL-PSNTG-I-----DSPGI-EQQIAEYNKTLLE----
A0A3R5XWG1      ----------R------VSKNQVL-PSNTG-I-----DSPGI-EQQIAEYNKTLLE----
A0A5P0Y910      ----------R------VSKNQVL-PSNTG-I-----DSPGI-EQQIAEYNKTLLE----
A0A414YFM3      ----------R------VSKNQVL-PSNTG-I-----DSPGI-EQQIAEYNKTLLE----
A0A6A7UIA7      ----------R------VSKNQVL-PSNTG-I-----DSPGI-EQQIAEYNKTLLE----
A0A6A7VPS3      ----------R------VSKNQVL-PSNTG-I-----DSPGI-EQQIAEYNKTLLE----
A0A374THP7      ----------K------VGKNQLL-PSNTG-I-----ESPGI-EQQIAEYNKSQLE----
A0A6G1VND1      ----------K------VGKNQLL-PSNTG-I-----ESPGI-EQQIAEYNKSQLE----
A0A0A2EVS5      ----------G------GQGRELL-PVNSG-I-----NSPVI-EREISEYNETLLQ----
A0A1T4NAJ7      ----------G------GQGRELL-PVNSG-I-----NSPVI-EREISEYNETLLQ----
A0A255T941      ----------S------KSIDQTL-PTNSG-I-----ANANI-ETQINNYNNMVLD----
A0A4P7VSV0      ----------A------SDNEKML-PMNSG-V-----ANVDI-QSQITDYNNLVLQ----
A0A7J0AX49      ----------A------NDNEKML-PMNSG-V-----ANVDI-QSQITDYNNLVLQ----
A0A3N2KCL3      ----------A------SDNEKML-PMNSG-V-----ANVDI-QSQITDYNNLVLQ----
A0A2V1IJY1      ----------A------SDNEKML-PMNSG-V-----ANVDI-QSQITDYNNLVLQ----
A0A4P7VXK7      ----------A------SDNEKML-PMNSG-V-----ANVDI-QSQITDYNNLVLQ----
A0A1Y4CHN5      ----------G------ESQNQLL-PANSG-I-----SGGNI-ENQISEYNTAQLQ----
A0A7Y5JED7      ----------N------KQMDQPL-PTNSG-I-----GSTNI-ESQISEYNQMVLD----
A0A1M6I2S6      ----------N------KELSQLL-PTNSG-I-----ANVNI-ESQIGEYNTMVLD----
A0A1Y3V692      ----------N------KELSQLL-PTNSG-I-----ANVNI-ESQIGEYNTMVLD----
F3PXM2          ----------G------KGLTQLL-PANSD-I-----GNSHI-ESLIGEYNAQVLE----
A0A174JCE8      ----------S------KDMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A3E4JMC4      ----------S------KDMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A412SND6      ----------S------KDMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A414IEQ9      ----------S------KDMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A7K0HNT3      ----------S------KDMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A0M1W8D8      ----------S------KDMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A3R6GKX5      ----------S------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKIVLD----
A7V4S1          ----------S------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKIVLD----
B0NU19          ----------S------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKIVLD----
D4V601          ----------S------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKIVLD----
A0A4Q0U3M9      ----------S------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKIVLD----
A0A7J5G2G2      ----------S------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKIVLD----
A0A7J5HH13      ----------S------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKIVLD----
A0A397WLT5      ----------S------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKIVLD----
A0A6N8DDD8      ----------S------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKIVLD----
A0A6A2J529      ----------S------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKIVLD----
A0A7S9QIA5      ----------S------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKIVLD----
A0A015XH67      ----------G------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A078RZN2      ----------G------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A6L0K5          ----------G------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A7ACT5          ----------G------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A6KY94          ----------G------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A173UQR8      ----------G------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A3R6HK75      ----------G------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A412B7D1      ----------G------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A412VNY9      ----------G------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A414LTU9      ----------G------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A8B2YHC3      ----------G------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
I9Q4U4          ----------G------KEMNQPL-PTNSG-I-----ANVNI-ESQIGEYNKMVLD----
A0A373ISF0      ----------E------KSLSQPL-PTNSG-I-----ANSNI-ESQISEYNNMVLN----
U6RF62          ----------E------KSLSQPL-PTNSG-I-----ANSNI-ENQISEYNNMVLN----
A0A662ZZD5      ----------N------KKLSQLL-PTNSG-I-----ANVNI-ESQIGEYNTIVLE----
A0A415NEB6      ----------N------KKLSQLL-PTNSG-I-----ANVNI-ESQIGEYNTIVLE----
A7AJ60          ----------N------KKLSQLL-PTNSG-I-----ANVNI-ESQIGEYNTIVLE----
A0A6A2JF01      ----------N------KKLSQLL-PTNSG-I-----ANVNI-ESQIGEYNTIVLE----
A0A7J5MKN5      ----------N------KKLSQLL-PTNSG-I-----ANVNI-ESQIGEYNTIVLE----
A0A015UXN7      ----------N------KKLSQLL-PTNSG-I-----ANVNI-ESQIGEYNTIVLE----
A0A642KJV3      ----------N------KKLSQLL-PTNSG-I-----ANVNI-ESQIGEYNTIVLE----
A0A6I2NTL0      ----------N------KKLSQLL-PTNSG-I-----ANVNI-ESQIGEYNTIVLE----
A0A6I2Q447      ----------N------KKLSQLL-PTNSG-I-----ANVNI-ESQIGEYNTIVLE----
A0A016E4F9      ----------N------KELDQLL-PTNSG-I-----ANVNI-ESQIGEYNTMVLD----
A0A6N3HG44      ----------N------KELGQLL-PTNSG-I-----ANVNI-ESQIGEYNTMVLD----
A0A7K0HSP7      ----------N------KELGQLL-PTNSG-I-----ANVNI-ESQIGEYNTMVLD----
A0A7K1HEJ5      ----------N------KELGQLL-PTNSG-I-----ANVNI-ESQIGEYNTMVLD----
A0A6H9P0U9      ----------T------KQLDQTL-PANSG-I-----VSANI-ETQISEYNNLVLD----
A0A108TH71      ----------T------KQLDQTL-PANSG-I-----VSANI-ETQISEYNNLVLD----
I8VXH0          ----------T------KQLDQTL-PANSG-I-----VSANI-ETQISEYNNLVLD----
A0A412S0N6      ----------T------KQLDQTL-PANSG-I-----VSANI-ETQISEYNNLVLD----
A0A412IIJ0      ----------T------KQLDQTL-PANSG-I-----VSANI-ETQISEYNNLVLD----
A0A0P0FM97      ----------T------KQLDQTL-PANSG-I-----VSANI-ETQISEYNNLVLD----
R6KTP3          ----------T------KQLDQTL-PANSG-I-----VSANI-ETQISEYNNLVLD----
A0A139LU87      ----------T------KQLDQTL-PANSG-I-----VSANI-ETQISEYNNLVLD----
A0A1C6B3Y5      ----------T------KQLDQTL-PANSG-I-----VSANI-ETQISEYNNLVLD----
A0A6L3KCD1      ----------T------KQLDQTL-PANSG-I-----VSANI-ETQISEYNNLVLD----
E2NMQ4          ----------T------KQLDQTL-PANSG-I-----VSANI-ETQISEYNNLVLD----
A0A412YDB9      ----------T------KQLNQTL-PTNSG-I-----VSANI-ETQISEYNNLVLD----
R7DY01          ----------T------KQLNQTL-PTNSG-I-----VSANI-ETQISEYNNLVLD----
A0A414LGK8      ----------T------KQLNQTL-PTNSG-I-----VSANI-ETQISEYNNLVLD----
A0A415IPQ4      ----------A------KQPDQPL-PTNSG-I-----VNANI-ETLISEYNNLVLD----
A0A3E5BRW7      ----------A------KLLDQPL-PANSG-I-----VNANI-ETLIGEYNNLVLD----
K9DXS6          ----------A------KLLDQPL-PANSG-I-----VNANI-ETLIGEYNNLVLD----
A0A1M6KFV3      ----------S------KQLNQPL-PANSG-I-----VNANI-ETLISEYNNLVLD----
A0A1Q6G7L3      ----------S------KQLNQPL-PANSG-I-----VNANI-ETLISEYNNLVLD----
A0A413H235      ----------S------KQLNQPL-PANSG-I-----VNANI-ETLISEYNNLVLD----
A0A358R8U0      ----------E------NNRTQLL-PANSG-I-----ESTNI-ESQISEYNTKLLQ----
R6WSB6          ----------E------NNRTQLL-PANSG-I-----ESTNI-ESQISEYNTKLLQ----
A0A401LPX7      ----------E------NNKYQLL-PANSG-I-----ENASL-STQLNEYNTKLLE----
A0A6G0GNY9      ----------E------NNKHQLL-PANSS-I-----ENASL-ATQLNEYNTKLLE----
A0A6I1BFM0      ----------E------NNKHQLL-PANSS-I-----ENASL-ATQLNEYNTKLLE----
A0A3A5Z900      ----------E------NNKHQLL-PANSG-I-----ENANL-ATQLNEYNTKLLE----
A0A7K0GW19      ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
A0A285TGL6      ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
A0A3A5RFX4      ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
A0A1Q6IUW9      ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
A0A413XDP6      ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
A0A6N8CVT6      ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
K6AP24          ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
A0A6I2NHV3      ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
A0A662ZYI7      ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
A0A078RYI7      ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
C7XEQ8          ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
D7INX6          ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
K5ZG55          ----------E------NNKHQLL-PANSG-I-----ENASL-ATQLNEYNTKLLE----
A0A7Y5MWI8      ----------S------TSKNQLL-PANSG-I-----ESPGI-EQQIANYNTAQLR----
A0A1M5B2J8      ----------E------TNRFQLL-PANSG-I-----DNPNI-ASQINEYNNQLLE----
A0A255RCT5      ----------E------TNRFQLL-PANSG-I-----DNANI-GSQITEYNNQLLE----
A0A1Y4GLF5      ----------D------ANKSQLL-PANSG-I-----DNGNI-ESQISEYNRQLLQ----
A0A1H3XSC0      ----------D------ANKNQLL-PANSG-I-----ESANI-ESQIAEYNRQLLQ----
A6LE40          ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A4Y1VPX5      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A6N2XMM4      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A7U8L0B4      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
B3JI46          ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3N2N9B8      ----------E------SSRNQLL-PANSG-L------VGDI-ASQVGEYNDLLLQ----
A0A3N2NMI0      ----------E------DSRNQLL-PANSG-L------VGDI-AKQVSEYNEMLLQ----
A0A359I8H7      ----------P------GNAKSVI-PVNTG-I-----GSPTL-EAQISNYNNLLLT----
A0A3N2KA63      ----------P------GNAKSVI-PVNTG-I-----GSPTL-EAQISNYNNLLLT----
A0A4Q0IMT7      ----------P------GNAKSVI-PVNTG-I-----GSPTL-EAQISNYNNLLLT----
A0A7J0B660      ----------P------GNAKSVI-PVNTG-I-----GSPTL-EAQISNYNNLLLT----
A0A3B9FAU3      ----------G------AKSRKLL-PTNAG-L-----ESTGI-EQQIAEYNTLLLQ----
A0A3C1E5L7      ----------G------AKSRKLL-PTNAG-L-----ESTGI-EQQIAEYNTLLLQ----
A0A4Q0UAV1      -----------------ASLDQPL-PNPAG-I-----EGTTV-ESQIAEYNTIVRE----
A0A354SN68      ----------V------KNRNQLL-PVNSG-I-----GNEGI-EGLINDYNAQILQ----
A0A6L5XFL0      ----------G------AYK--IL-PANTG-I-----DNTVL-SQQIGSYNEKVLQ----
A0A3N2N595      ----------D------NDNTKLL-PIPSE-V-----ENVDV-KSQLTNYNDLILQ----
A0A7J0ACS3      ----------E------GNRDQLL-PANTG-L-----QSSNI-QSLIGEYNDKLLQ----
A0A0A2DUD9      -----------------LDKSRLL-PVNSF-V-----NNPSL-EQQIGEFNDLLLK----
A0A3P1ZBJ5      ----------E------KNKFDLL-PANSG-I-----NSSSV-EALIGDYNGNILQ----
R5FHS9          ----------P------KQRNHVL-PANFG-L-----TDQNI-EQQIESYNKDLIE----
A0A413TW79      ----------K------VGKNQLL-PANIG-I-----DSPGI-EQQITEYNKQQLE----
A0A7K0AAG2      ----------K------VGKNQLL-PANIG-I-----ESPGI-EQQITEYNKQQLE----
A0A7K0ASF1      ----------K------VGKNQLL-PANIG-I-----DSPGI-EQQITEYNKQQLE----
A0A3E5E9M7      ----------K------VGKNQLL-PANIG-I-----DSPGI-EQQITEYNKQQLE----
A0A3E4SK73      ----------K------VGKNQLL-PANIG-I-----DSPGI-EQQITEYNKQQLE----
A0A415GGC6      ----------K------VGKNQLL-PANIG-I-----DSPGI-EQQITEYNKQQLE----
A0A413DBH9      ----------K------VGKNQLL-PANIG-I-----DSPGI-EQQITEYNKQQLE----
A0A495WI87      ----------E------SNKYQLL-PANSG-I-----ENSNL-GDQITEYNNKLLQ----
A0A354M4S6      ----------E------SNKYQLL-PANSG-I-----ENSNL-GDQITEYNNKLLQ----
R7DH52          ----------E------SNKYQLL-PANSG-I-----ENSNL-GDQITEYNNKLLQ----
A0A7J5IAE7      ----------D------ANRTQLL-PANSG-I-----ENANI-ESQITEYNKQLLQ----
A0A016CWA4      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A4P8LP09      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A0M1W0V2      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A139KA16      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A174VQ92      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A1Q6HCG0      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A1Y4JYM9      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3A5QW67      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3A5RQE6      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3A6BP07      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3E5E153      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3Q9IP20      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A412WV15      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A413ICP6      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A414KYB9      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A5B3FWR2      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A7J5QHB9      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
E5WX00          ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
K0X3P3          ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A1C6H117      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A6I1AQV4      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A5C6L2P1      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3E4WKT5      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3A5YY33      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A1E9CFZ7      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A373FYU5      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3A5XBP2      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3A6MEG9      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3E4JP35      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3E4KP40      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3E4NX82      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3E4XFU8      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A412RG70      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A412TD37      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A413GAA4      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A414M7I4      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A496BTA0      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A496D2V6      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A5C6KCA6      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A5M5AHM5      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A6I0Y5K7      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A6I1BFB8      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A6I2P5W5      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A6N8DC51      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A7J5HGP0      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A7J5HVL8      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A7J5JHD3      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A8B3EKM1      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
E5UZA2          ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A069SMG6      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
C3RFN5          ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3A5Z014      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A7J5GD93      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A7K0HGR5      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A078S3Q8      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A069SJV7      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3E5DXI5      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3E5EM98      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A6N2YYD4      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
I9T3G6          ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A3E4SYU0      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A6LGY1          ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
K5ZSH4          ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A6A2RTB3      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A7J5PEN4      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A1M4YZ07      ----------D------ANRTQLL-PANSG-I-----ESANI-ESQIAEYNKQLLQ----
A0A7J5I238      ----------D------ANRTQLL-PANSG-I-----ESVNI-ESQIAEYNKQLLQ----
A0A0P0FQW1      ----------D------ANRTQLL-PANSG-I-----ESVNI-ESQIAEYNKQLLQ----
A0A7K0I229      ----------D------ANRTQLL-PANSG-I-----ESVNI-ESQIAEYNKQLLQ----
A0A5M5C0W6      ----------D------ANRTQLL-PANSG-I-----ESVNI-ESQIAEYNKQLLQ----
A0A642NJ89      ----------D------ANRTQLL-PANSG-I-----ESVNI-ESQIAEYNKQLLQ----
A0A6L3JTQ2      ----------D------ANRTQLL-PANSG-I-----ESVNI-ESQIAEYNKQLLQ----
A0A7J5FQU6      ----------D------ANRTQLL-PANSG-I-----ESVNI-ESQIAEYNKQLLQ----
A0A7J4YLH7      ----------D------ANRTQLL-PANSG-I-----ESVNI-ESQIAEYNKQLLQ----
A0A6N3AEV2      ----------D------ANRTQLL-PANSG-I-----ESVNI-ESQIAEYNKQLLQ----
A0A6G0G4T5      ----------D------ANRTQLL-PANSG-I-----ESVNI-ESQIAEYNKQLLQ----
A0A6L3KG29      ----------D------ANRTQLL-PANSG-I-----ESVNI-ESQIAEYNKQLLQ----
A0A1Y4PQK7      ----------T------AGQNQLL-PANSG-L-----ENVGI-EKQISEYNTLQLQ----
A0A1Y4IH41      ----------T------AEQNQLL-PANSG-L-----ENVGI-EKQISEYNTLQLQ----
A0A3A6AAP4      ----------T------AEQNQLL-PANSG-L-----ENVGI-EKQISEYNTLQLQ----
A0A6I0ZRD2      ----------T------AEQNQLL-PANSG-L-----ENVGI-EKQISEYNTLQLQ----
A0A1Y4DYA7      ----------N------NNKNQLL-PANSG-I-----ESSGI-ENQILDYNTLQLQ----
A0A1Y3X4I9      ----------G------NSRNQLL-PANSG-I-----ESSGI-EKQIADYNALQLQ----
A0A1Y4FNK8      ----------A------TSKNQLL-PANSG-I-----ESPGI-EQQIANYNTAQLR----
A0A355FD59      ----------P------AYTNQLL-PANSG-I-----ENSGI-ESQISEYNTLQLQ----
A0A359CEZ9      ----------P------AYTNQLL-PANSG-I-----ENSGI-ESQISEYNTLQLQ----
A0A353Q7B4      ----------P------AYTNQLL-PANSG-I-----ENSGI-ESQISEYNTLQLQ----
F8X3A5          ----------S------TNNNQLI-PANSG-I-----ESASV-ENQITEYNTIQLQ----
A0A1M3KVR9      ----------S------TNNNQLI-PANSG-I-----ESASV-ENQITEYNTIQLQ----
A0A4Y9IJS3      ----------S------TNNNQLI-PANSG-I-----ESASV-ENQITEYNTIQLQ----
A0A416GA42      ----------P------KNDKSLI-PVNIGV------SETNL-VNQIAEYNKMRLQ----
A0A1T3IYP5      ----------K------GKQNNLI-PNNTGL------VDASV-ENQIAEYNTTLLK----
A0A7Z6RZU4      ----------P------TKQSELL-PANSGI------LDTGV-EGLINQYNENMLL----
A0A4D7K1D4      ----------G------NNEQLEF-GSLTLEN-----FPESI-TELIEEINVLETE----
A0A846MP44      ----------D------TTSRPYI-FFFAAI------EDDFI-TQSLIKINELKQQ----
A0A1G9E2A9      ----------S------TLEVEFI-PSTRAI------RDEQL-LSLVNQLNTKRIE----
A0A098LL25      ----------D------QEVNSFI-PALSQV------ENPQL-SAAINSLNTLQEE----
A0A6J4H627      ----------K------DDLSSFI-PSVPLL------PDPQL-QTYTNDINRLQQE----
A0A6C0GJI1      ----------E------GDLASFI-PSIPLL------TDQQL-GELTQNINKLQQE----
A0A839GQ17      ----------D------LSLVISG-MQLQQQ------QDPQL-LEQVTTLNELQAR----
A0A127B287      ----------D------LSLVISS-LQLQEQ------QDPQL-AQLLTELNDLQAQ----
A0A6P1P2P6      ----------D------LTAVISS-LQLQEQ------QDPQL-AQLLTELNDLQAQ----
A0A2T2YJE8      ----------S------SNLDQMI-PSLKEL------DDAQL-LKQIAQLSDLQLD----
A0A7L7LEW0      ----------N------SNLDQMI-PSLKEL------DDAQL-LKQISQLSDLQLD----
A0A3M9N829      ----------D------LGLIVAG-LQGQPN------QDPQL-SELLTELSQLQAR----
A0A0P0CSF9      ----------D------LGMIASS-IQGQEN------QDPQL-AEQLTELSDLQAQ----
A0A5M8QQB8      ----------D------LGMVVSG-LQGQEG------QDPQL-TEQLTELSDLQAR----
A0A3M9MNC3      ----------D------LGMIAST-IQGQEN------QDPQL-AEQLTELSDLQAQ----
A0A5B6TAX2      ----------D------LGMVVSG-LQGQGN------QDPEL-AEQLTELSDLQAR----
A0A7L5A132      ----------G------QSLEQSI-PAIGAL------ENPQI-AEQISILNEQQGD----
A0A512AYT3      ----------S------D-LEQVI-PSLKAV------EDQEL-SSRISELSNLQLY----
A0A5M6CYN7      ----------S------E-LDQVI-PSLKAV------EDQEL-SQRIAELSDMQLY----
A0A369QP10      ----------N------TSLDQMI-PSLKEL------DDEQL-SNRISQLSNLQLD----
A0A7G7G7M4      ----------N------TSLDQMV-PSLKEL------NDEQL-TARITQLSNLQLD----
A0A126PDF2      ----------D------ETIEQSI-PGLGDI------NDPIL-SQLLSQLNGMQWE----
A0A2Z3GKA1      ----------N------ETIEQSI-PGLGDI------NDPVL-SQLLSQLNGMQWD----
A0A502GZP7      ----------N------ETIEQSI-PGLGDI------NDPLL-SQLLSQLNGMQWD----
A0A0M3RW20      ----------N------VSVEQSV-PGLVTL------EDPIL-TQQITELNLAQQD----
A0A495VFX4      ----------N------TSVEQSV-PGLVTL------EDPVL-TQQITELNLSQQD----
A0A246FQC0      ----------D------GDVMQSI-PALAEV------KDGQL-VQRITELSDAQLD----
A0A372E5P8      ----------D------GDVMQSI-PALADV------KDGQL-IQRITELSDAQLD----
A0A7Y7PLY0      ----------D------GDVMQSI-PALADV------KDGQL-VQRITELSDAQLD----
A0A1H3EMW1      ----------D------GDVMQSI-PALAEV------KDGQL-VQRITELSDAQLD----
A0A1H9ZSN3      ----------D------GDVMQSI-PALAEV------KDAQL-VQRITELSDAQLD----
A0A7W9SXN1      ----------D------GDIFQTI-PALSEI------KDQQL-AQRITELSDLQLD----
A0A418R9X5      ----------D------GDVMQTI-PALSTI------EDAQL-TKRITELSDLQLD----
A0A428JSJ3      ----------D------GDVFQTI-PALSTI------KDGQL-LQRITELSNLQLD----
A0A428KI59      ----------D------GDVFQTI-PALSTI------KDGQL-TQRIIELSDLQLD----
W8F1I6          ----------D------GDVFQTI-PALSTI------KDGQL-TQRIIELSDLQLD----
A0A1S9B3W0      ----------D------ETVEQSI-PGLAAL------EDPVL-SQQIGFLNEQQRE----
A0A1W1VRL3      ----------D------STVAQSI-PGLAEL------EDGRL-TQEIEALNDQQWD----
A0A7G6YQJ9      ----------D------VDVAQAI-PALGDL------GDSQL-PQLLQQFNDQQLE----
A0A1M6R305      ----------D------LTVEESI-PALATI------ENPQL-SQQLTEVNSLQWN----
A0A7G7W8X3      ----------D------MTVEQSI-PALATI------DNPQL-AQQLTELNGLQWN----
A0A4Z0PHK3      ----------D------ATLEQSI-PGIAAF------EDGQL-TGQLAELNNLQWN----
A0A2M9B9H9      ----------D------ATLEQSI-PGIAAV------EDAQL-TQQLSELNALQWN----
A0A4Z0QCY9      ----------D------ATLEQSI-PGIAAI------EDNQL-TSQLTELNSLQWN----
A0A7Y0AH93      ----------D------QTVSQNI-PALADL------HDPVL-VQLLEQLNAQQLN----
A0A519SBU8      ----------D------ETVADNI-PGLAEI------EDPIL-EKLLDQLDNEQRE----
A0A4Q3JNZ3      ----------D------ETVADNL-PGLIEL------ADPVL-TGMLEQLDAQQRS----
A0A519Q9V3      ----------D------ETVTDNL-PGLAEL------EDQVL-TGLLEQLDGQQRS----
A0A5N1J2M4      -----------------THVDQII-PTLGSL------QDQQL-SEKIKELGTLQTR----
A0A519S476      ----------D------ETVAENL-PGLSEI------EDESL-VSLLEELDTRQRR----
A0A4Q3JRW8      ----------D------ETVADNL-PGLAEL------DDPTL-VALLDQLDGQQRQ----
A0A519M923      ----------D------ETVAETL-PGLVEL------DDPVL-MGMLDQLDGQQRS----
A0A4Z0ENW1      ----------E------VTVDQTI-PGLALL------EDPAL-SQQLNNLNILQQN----
A0A519UDB4      ----------N------STLAESI-PGLAIL------NDGPI-TQQLNDLHILQQN----
A0A3S0QKV1      ----------D------ETVEQSI-PGLALL------EDPQL-TQLMSVLNEQQRD----
A0A328BL48      ----------E------LTVEESI-PGLAVL------QDPQI-SQQLTVLNEQQRE----
A0A5R8WLY4      ----------E------LTVEESI-PGLAVL------QDPQI-SQQLTALNEQQRE----
A0A1I5WSL8      ----------T------QTVEQSM-PAIVGI------EDAQL-LQQLNELNNLQWN----
A0A0U3JVM7      ----------T------QTVEQSI-PALAGI------EDPQL-AQQLNELNDLQWQ----
A0A1G1SSV2      ----------T------QTVEQSL-PALAGI------EDAQL-GQELNQLNSLQWR----
A0A1G1SXV7      ----------T------QTVEQSL-PALAGI------EDAQL-GQELNQLNSLQWR----
A0A6G8CBJ6      ----------D------STVAQSI-PGLAEL------EDNRL-IQEIEALNSQQWD----
A0A0W8EDI5      ----------G------DDIEQSI-PALAIL------EDAQL-TQQIGVLNDQQAD----
A0A3B7RBP8      ----------G------ETIEQSI-PALTVL------EDAQL-SQQIALLNDQQAD----
A0A3R9P8H7      ----------D------GDVLQSI-PALTDA------KDGQL-VARIQELSDAQLD----
A0A238WIA7      ----------D------VSAEQSI-PALAEI------KAPEL-TERIGELYGLQLD----
A0A212UCJ7      ----------E------RSAEQSI-PALAEL------KAPEL-AARIGELYDLQLQ----
A0A4Z0MQE1      ----------G------RSAEQSI-PALAEV------KAPEL-TERISELYGLQLE----
A0A4Z0PCF4      ----------G------VSAEQSI-PALAEL------KSPEL-TERVSELYGLQLD----
A0A6M6BED0      ----------G------VSAEQSI-PALAEI------KAPEL-SERVSELYDLQLQ----
A0A5D6VDG1      ----------N------ASIDQSV-PGLSQL------EDPVL-TQQITELNAAQQD----
A0A243WHR7      ----------E------ASISESI-PGLKQL------GDEQV-TQQINRLNDLQWN----
A0A5B8A0P6      ----------D------LTVEKSI-PGLALL------EDPGL-TEQLTELNNQQYN----
A0A076HRT9      ----------D------LTVEQSI-PALATL------ENSQL-SQQLGELNDLQWN----
A0A4Z0PVM7      ----------D------ATLEQSI-PGISAI------EDNQL-TSQLTELNSLQWN----
A0A1M6DHW8      ----------E------ATLEEGI-PGIALL------DDSPL-TQQLSELNDLQRN----
A0A4Q5LC61      ----------E------ATLEESI-PGLATL------EDSPL-TQQLEELNQLQQN----
A0A060RD97      ----------P------INANALI-PRVSGA------QNLGV-DSQIDSYNELRLK----
A0A350IHV0      ----------P------QHDGALI-PSNLGL------DSKTV-DSQITEYNQMVLT----
A0A2A8CVM9      FEPGLRETVQQ------EQEASGL-RSEISV------LERKI-GEMRAEAAQYYVA----
R5RVP0          ----------P------AHSGALI-PANSGL------TSTTV-EAQIKEYNSLVLN----
A0A2L2WX98      ----------S------SKRNETV-PVLSL-------PEASF-TPLIGEYNNQMLE----
A0A2E3R1D0      ----------E------LSRLES--QLGTRL-------SSNL-DSELAAARERIQQ----
A0A800J826      ----------Q------ITEAES--RQRDRV-------VTTS-PDQLAAARTELAQ----
A0A2T2USC0      ----------E------LANIRP--NLAERI-------ASGL-GEELSQVQKEKAE----
A0A2T2V0F3      ----------E------LANIRP--NLAERI-------SSGL-EEELSQVQREKAQ----
A0A2T2S682      ----------E------LKRIRP--RLAERL-------SSGI-QTELKQVQQEKAN----
A0A840DJZ8      ----------E------LESIQPG-QLSERL-------ASTV-DEEIASLQSEIAK----
D5H561          ----------E------LESIQPG-QLSDQL-------ASTV-DQEISSLQSEIAK----
A0A2H3NWA9      ----------N------IESIEP--QLAERL-------ASNI-DSELARVQEERAE----
A0A2A8CVB6      ----------E------LEKIEP--QISDRL-------SSTT-GDVLESVQEEKAR----
A0A2P6C1S6      ----------E------LGTIEP--KLAERL-------SSSL-GQRLSSLQTEQAE----
A0A2T2UTM4      ----------E------LRQIEP--KLAERL-------SSDL-GEKLSTFQTEKAE----
R6A0L2          ----------H------SNSHDLI-PALNV-------GDASF-NTQIAAYNDQMNK----
R7LG80          ----------Q------TNDRDLI-PALSL-------KDASF-NTTIDKYNQLQMQ----
A0A7W5UEN4      ----------N------SNEHQII-PA-INL------EKATF-NGQIDTYNQLMNE----
G5GD56          ----------N------SNEHQII-PA-INL------ERATF-NGQIDTYNQLMNE----
R5KD55          ----------R------ANTNQLL-PANMGL------DDGKT-DGLIDKYNALQLE----
A0A174QNT3      ----------K------SKSADLI-PNVSGV------GDAGV-QTQIEDYNEMMLQ----
A0A4S2FGS1      ----------K------TRSSDLI-PNVSGV------GDVGV-QSQIESYNEMMLQ----
A0A7K3KG59      ----------K------TRSSDLI-PNVSGV------GDVGV-QSQIESYNEMMLQ----
R9I0H0          ----------K------TRSSDLI-PNVSGV------GDVGV-QSQIESYNEMMLQ----
K5BUT9          ----------V------TRKDQLI-PNVTGV------GDVSM-QSQITAYNELMLQ----
A0A174FPA3      ----------V------TRKDQLI-PNVTGV------GDVSM-QSQITAYNELMLQ----
R6S9Y6          ----------V------TRKDQLI-PNVTGV------GDVSM-QSQITAYNELMLQ----
A0A7J4YSB2      ----------V------TRKDQLI-PNVTGV------GDVSM-QSQITAYNELMLQ----
C9KX15          ----------V------TRKDQLI-PNVTGV------GDVSM-QSQITAYNELMLQ----
A0A6H0KRK1      ----------A------TRNNQLI-PNVSGV------GDASV-QSQITAYNELMLQ----
R6DAG6          ----------A------TRNNQLI-PNVSGV------GDASV-QSQITAYNELMLQ----
A0A3L8AAP1      ----------A------TRNNQLI-PNVSGV------GDASV-QSQITAYNELMLQ----
A0A4S2AYX2      ----------A------TRNNQLI-PNVSGV------GDASV-QSQITAYNELMLQ----
A0A7J0A2L4      ----------A------TRNNQLI-PNVSGV------GDASV-QSQITAYNELMLQ----
A0A7K3MN31      ----------A------TRNNQLI-PNVSGV------GDASV-QSQITAYNELMLQ----
R6CQ93          ----------P------TKSRDLI-PSGTGI------SDASV-EGQINQYNSLKLK----
A0A3D1NQW3      ----------P------TKTNELI-PGTLSI------NSPAI-NSQIEGYNTELQR----
B0MT10          ----------P------TKTNELI-PGTLSI------NSPAI-NSQIEGYNTELQR----
R7JGW9          ----------P------TKTNELI-PGTLSI------NSPAI-NSQIEGYNTELQR----
A0A3D2BF46      ----------D------TKLRDLI-PANVAI------TNVSI-SDQIKNYNELMLR----
A0A358R538      ----------P------AHAGELI-PMAASV------ASETV-AAQIDRYNEAILT----
A0A1Y4AAB8      ----------R------EHAGDLI-PAMAAI------ANSGI-TEQISAYNEGILR----
A0A1Y3WWY9      ----------P------SKAGELI-PAMASV------TNAAV-SAQIDEYNTSILQ----
A0A1Y4U5L4      ----------P------SKAGELI-PAMASV------TNAAV-SAQIDEYNTAILQ----
A0A1Y3VCJ1      ----------P------AKSGELI-PAMAAI------SNGAV-TAQIDEYNATILQ----
A0A1Y3QTW7      ----------P------THAGELI-PMVASL------TNNGI-VAQITEYNDAILR----
R6XWY7          ----------P------THAGELI-PMVASL------TNNGI-VAQITEYNDAILR----
A0A4Y1X9Y9      ----------P------SHAGDLI-PMVASL------TNNGI-VAQITEYNDAILR----
A0A4Y1WM66      ----------P------SHAGDLI-PMVASL------TNNGI-VAQITEYNDAILR----
A0A6N4GYT3      ----------P------SHAGDLI-PMVASL------TNNGI-VAQITEYNDAILR----
A0A174AVF1      ----------P------SHAGDLI-PMVASL------TNNGI-VAQITEYNDAILR----
A0A1Q6EIY0      ----------P------SHAGDLI-PMVASM------TNNGI-VAQISEYNEAILR----
A0A5B5VN71      ----------P------SHAGDLI-PMVASM------TNNGI-VAQISEYNEAILR----
E4M8L3          ----------P------SHAGDLI-PMVASM------TNNGI-VAQISEYNEAILR----
I3YQ50          ----------P------SHAGDLI-PMVASM------TNNGI-VAQISEYNEAILR----
R5UEY8          ----------P------SHAGDLI-PMVASM------TNNGI-VAQISEYNEAILR----
A0A1H4D866      ----------P------KNAGELI-PMMASV------TNQGI-SSQIADYNNAILR----
A0A5B3G4Y7      ----------P------KNVGELI-PAMAAAG-----TNTAI-AKQIEDYNSAILR----
A0A374A9J5      ----------P------KNVGELI-PAMAAAG-----TNTAI-AKQIEDYNSAILR----
A0A5B3GQN5      ----------P------KNVGELI-PAMAAAG-----TNTAI-AKQIEDYNSAILR----
A0A1Q6E9S3      ----------P------KNVGELI-PAMAAAG-----TNTAI-AKQIEDYNSAILR----
D4IJ36          ----------P------KNVGELI-PAMAAAG-----TNTAI-AKQIEDYNSAILR----
A0A414Q925      ----------N------SKTTELV-PASIGI------DDMGV-QNLIMEYNTVLTR----
A0A415PUS9      ----------N------SKTTELV-PASIGI------DDMGV-QNLIMEYNTVLTR----
A0A108TCU0      ----------N------SKTTEPV-PASIGI------DDMGV-QNLIMEYNTVLTR----
A0A413BA42      ----------N------SKTTEPV-PASIGI------DDMGV-QNLIMEYNTVLTR----
S3Y344          ----------N------SKTTEPV-PASIGI------DDMGV-QNLIMEYNTVLTR----
A0A7J5LEW3      ----------N------SKTTEPV-PASIGI------DDMGV-QNLIMEYNTVLTR----
A0A412TGL3      ----------N------SKTTEPV-PASIGI------DDMGV-QNLIMEYNTVLTR----
A0A413VJ33      ----------N------SKTTEPV-PASIGI------DDMGV-QNLIMEYNTVLTR----
A0A414L0W6      ----------N------SKTTEPV-PASIGI------DDMGV-QNLIMEYNTVLTR----
A0A412DP39      ----------N------SKTTEPV-PASIGI------DDMGV-QNLIMEYNTVLTR----
A0A413ZSE8      ----------N------SKTTEPV-PASIGI------DDMGV-QNLIMEYNTVLTR----
B0NP84          ----------N------SKTTEPV-PASIGI------DDMGV-QNLIMEYNTVLTR----
R6AK43          ----------N------SKTTEPV-PASIGI------DDMGV-QNLIMEYNTVLTR----
A0A412N2D9      ----------N------SKTTDPI-PASIGI------DDMGV-QNLIMEYNTVLTR----
A0A1Y4JYS9      ----------N------SKTTDPI-PASIGI------DDMGV-QNLIMEYNTVLTR----
R6LHA4          ----------N------SKTTDPI-PASIGI------DDMGV-QNLIMEYNTVLTR----
A0A3E5HPT8      ----------S------NKDDELI-PSNIGL------SDLSI-ESQISRYNETLLR----
C6IJ48          ----------S------NKDDELI-PSNIGL------SDLSI-ESQISRYNETLLR----
Q8A3U2          ----------S------NKDDELI-PSNIGL------SDLSI-ESQISRYNETLLR----
A0A3R6S1H6      ----------P------QHERDLI-PSNTGI------PDVNI-EQSIGKYNEMLLK----
A0A3R6SD81      ----------P------QHERDLI-PSNTGI------PDVNI