BYKdb

Dataset for cluster tadcd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

733 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1T5MMH4      ------------------------------------MELAKNNIHHQPLPSEG-------
A0A2W4R1L8      ---------------------------------------METGTFKSGNSIEG-------
A0A2E5CV79      ------------------------------------------------------------
A0A2D4ZVH1      ------------------------MHFNGNSSNGYNSGYSPLENETDSYIEKE-------
A0A0K8QSK7      --------------------------------MEDPRLEIPGLPFFPEFEQSE-------
A0A1V6CN82      --------------------------------MTEYNDTDRTQDSAAQEELPV-------
A0A1M4XZ45      --------------------------------MTQSEINKN-NQINSSSDDDT-------
A0A399D319      --------------------------------MTQMDINKNGHQINQSQDDDS-------
A0A1M6GR99      ------------------------------------------MNQQKLPEQNI-------
A6EBM4          -------------------------------------MTGESRKGQRGPSHRE-------
A0A1M6TTV4      --------------------------MNFSPEHNVLNQTNNQNADSSGSPLDD-------
A0A4Q8RX32      ---------------------------------------------MALYDGQI-------
K0X1U5          ----------------------------------------MEEKYTSERKNDN-------
R5EXK3          ----------------------------------------MEEKYTSERRNDN-------
A0A401UAP7      ------------------------------------------MDKGFTNESET-------
A0A1W2GF52      ---------------------------MNPRNVHIPQDIRSHHNPENDGAFEN-------
A0A2G5L7B8      -----------------------------MRPIHGGQN----HNQSEGDPLSN-------
A0A523GAC0      ----------------------------MTNQTFDIEKDNFVVRGQHSYLGGE-------
L8JW09          -------------------------------------MENKNIYSDTEKPTEG-------
A0A364XUP5      ----------------------------------MMLESNKIGPPVALPNTEG-------
A0A1M5RLA9      -----------------------------------MLETPKNIQPQQSQANEA-------
A0A385SFR9      -----------------------------------MLEIPKNIPPQQSPANEP-------
A0A5M4A9J4      --------------------------------MKEQQPQPQPVFMPFFEQEEK-------
A0A5M4B1C7      ----------------------------------MKEKQPQLVSVPFFEEEEK-------
A0A0D3LFR6      ----------------------------MKEDTTYVEYTDAPDEQPEGGPLQS-------
M7N6D4          ----------------------------MKEETTYVEYTEGQDTK-GWLPIHN-------
A0A4D7K1D4      ------------------------------------------------------------
A0A5C7MX19      ------------------------------------------------------------
A0A1Q3ZMZ7      ------------------------------------------------------------
A0A2D8JJW3      ---------------------------------------------MATQSNKQ-------
A0A2W2AFF7      ---------------------------------MQDKNYTNHIVAAEQQEEGS-------
R7PCR1          ----------------------------------MANNTVSSTVNQAELKEES-------
A0A2N5YXE2      ------------------------------------------MENKIPIFNQK-------
A0A1G9E2A9      ----MV---------EPTEIQHLGRPIDNE---------------EEESFLSV-------
A0A098LL25      ---------------MSLLEDEDKRSLNGSGQRVSFADDSE----EEDDVFGD-------
A0A6C0GJI1      ----MSINNGKGPDVEEPQMISFNRQAEQE---------------EEDTLLGG-------
A0A2T2YJE8      ----MTNK-------ESIVLEELENNYAAAVEV------------EEDSGGSD-------
A0A127B287      ----MSVK-------TGNNLDELDYHTSNADI-------------EEEDSGSS-------
A0A3M9N829      ----MSVK-------AANDLDELDHRLGSDEG-------------EEEDGGAS-------
A0A0P0CSF9      ----MSVK-------TVNDLDELDHRLGSGED-------------EDDDGGTS-------
A0A5M8QQB8      ----MSVK-------TANDLDELDHRLGSGED-------------EEDDGGTS-------
A0A3M9MNC3      ----MSVR-------TVNDLDELDHRLGGVED-------------EEDDGGAN-------
A0A5B6TAX2      ----MSVK-------TVNDLDELDHRLGGVED-------------EEDDGGTS-------
A0A5N1IQ33      ----MAVD-------KDAELEELIRTAGGEEGT-------------EDDAGAG-------
A0A512AYT3      ----MALE-------KFADIDEL-NSRVADTES-------------EEEGGSD-------
A0A5M6CYN7      ----MALE-------KFADIDEL-NSRVTDTDS-------------EEEGGSD-------
A0A369QP10      ----MANK-------ESIVLEELDNS-----------NYASTIEVEEESRGSD-------
A0A126PDF2      ----MAVN-------ENAELEALIRNAIDGGTEPPTAA--TVGAAADDEADGG-------
A0A2Z3GKA1      ----MAVN-------ENAELEALIRNAIDGGTEPPTAA--TVGAAADEEADDG-------
A0A502GZP7      ----MAIN-------ENAELESLIRNAIDGGAEQPAAA--TAGGAADEEGSEG-------
A0A519SBU8      ----MALS-------ENAELEELIRRATGETASQLPPT-GAAAAADEEDLGGG-------
A0A4Q3JNZ3      ----MALS-------ENAELEELIRRATGETAGQLPPTQGPTVGDEPEDLGGG-------
A0A519Q9V3      ----MAVS-------ENAELEELIRKATGDTAGQLPPTSGPVLAAEQDDTGSS-------
A0A0M3RW20      ---------------------------------MNTPE--P----ESETEGSG-------
A0A495VFX4      ----MAKN-------ENTELEDLIRNSLGNQPTVSVPE--P----ESETENSG-------
A0A1S9B3W0      ----MAVN-------ENAELEELIRNATS-GGVNTPAP--PASESDDDNVGGG-------
A0A1W1VRL3      ----MAAK-------EETELEELIRNA---NGIETEDK--E----DE---GDG-------
A0A1M6R305      ----MAVN-------ENAELEELIRNATGSGGASTVSA--ESEVVEE---GGG-------
A0A4Z0PHK3      ----MAVN-------ENAELEELIRNA---GGTETNAA--E----DE---GDG-------
A0A2M9B9H9      ----MAVN-------ENAELEELIRSA---GGAEPNAV--E----DE---GGG-------
A0A4Z0QCY9      ----MAVN-------ENAELEELIRNA---GGAEPNAA--E----DE---DGG-------
A0A418R9X5      ----MAAK-------EDAELEELIRNA---GG--EPEE--E----EE---GGG-------
A0A428JSJ3      ----MAAK-------EDAELEELIRSA---GG--EPEE--E----ED---GGG-------
A0A428KI59      ----MAAK-------EDAELEELIRNA---GA--EPEE--E----EE---GGG-------
W8F1I6          ----MAAK-------EDAELEELIRNA---GA--EPEE--E----EE---GGS-------
A0A246FQC0      ----MATK-------EDAELEELIRNA---GG--EEVE--E----DD---GGG-------
A0A372E5P8      ----MAVK-------EDAELEELIRQA---GGGEPTED--E----DD---GGG-------
A0A1H3EMW1      ----MAAK-------EDAELEELIRNA---GR--ESEE--Q----ED---GGG-------
A0A1H9ZSN3      ----MAAK-------EDAELEELIRNA---GG--EPEE--E----DD---GGG-------
A0A5N1J2M4      ----MMPT-------QSTELDELE-------------VKPAIVDAEEESSGSD-------
A0A519S476      ------------------------------------------------------------
A0A4Q3JRW8      ----MAVS-------ENAELEELIRKATGEAAVQLPPTASSASTPELEDIGGG-------
A0A519M923      ----MALS-------ENAELEELIKRATSDTAGQLPAAQNQPQSAEPEDLGGG-------
A0A4Z0ENW1      ----MAST-------ENAELEELIRRASASGET--TPPTGPSFAEEEAEDGDN-------
A0A519UDB4      ----MAMS-------ENAELEELIRRTTTGADS--SSSISAATSEEEAE--DS-------
A0A3S0QKV1      ----MAVN-------ENAELEELIRNATGGSGA----AAPTASAPEAEEAGSG-------
A0A328BL48      ----MAVN-------ENAELEELIRNATSGGAA----PTAPAAESEDDSVGGG-------
A0A5R8WLY4      ----MAVN-------ENAELEELIRNATSGGAA----PTAPAAESEDDSVGGG-------
A0A1I5WSL8      ----MAIN-------ENTELEELIRNATGGSAA--PPETPASSGADPEDDSAS-------
A0A0U3JVM7      ----MAIN-------ENTELEELIRNATGGTAS--PPEAPSASGGDADDDAPG-------
A0A1G1SSV2      ----MATN-------ENRELEELIRNATGGTAS--LPEAPTVGASEPEDESAS-------
A0A1G1SXV7      ----MATN-------ENRELEELIRNATGGTAF--PSEAPAVGTGETEEESAS-------
A0A6G8CBJ6      ----MAAK-------EETELEEMIRNAGGM-------EAEE-----KEDAGDG-------
A0A0W8EDI5      ----MAVN-------KEAELEELIRASG---------EET------DDVAESS-------
A0A3B7RBP8      ----MAID-------KEAELEELIRSAGST-------EGQ------EEETDTA-------
A0A3R9P8H7      ----MAAN-------EDAELEEMIRNAGGN-------ESD------GEDDGGG-------
A0A238WIA7      ----MAVN-------EEVELEDLVRNAGGE-------A--------DEDDGGG-------
A0A212UCJ7      ----MAVN-------EDIELEELIRGAGGD-------A--------EEDQGGG-------
A0A4Z0MQE1      ----MALN-------EEADLEELVRGAGGE-------A--------DEDQGGG-------
A0A4Z0PCF4      ----MALN-------EEAELEDLVRSAGGE-------A--------DEDQGGG-------
A0A5D6VDG1      ----MAIN-------ENAELEDLIRNSGGT-------PPVE---VQAEEENTG-------
A0A6H1CVS0      ----MAIN-------ENAELEELIRNSGGT-------APVE---VESEEENTG-------
A0A243WHR7      ----MAVN-------ENAELEELIRNAGGN-------EAEV-----EDDEGAG-------
A0A5B8A0P6      ----MALK-------EEAELEELIRNSGGV-------DAEA-----ADEDSEG-------
A0A076HRT9      ----MAVN-------ENAELESLIRNATGG-------VSAVPVESEPADDGGG-------
A0A4Z0PVM7      ----MAVN-------ENAELEELIRSAGGA-------EPTA-----EDEDG-G-------
A0A1M6DHW8      ----MAIN-------ENAELEELIRNAGGG-------DTEA-----EGEEGSG-------
A0A4Q5LC61      ----MAVN-------ENAELEDLIRNAGGG-------DVEA-----EGEDDPG-------
A0A2U1FKU2      --------------------------MPTEEKRITPYGGASRS--ESGEDISF-------
A0A0A2F954      --------------------------MNLNEGSQNTFTRQGRSYISDTEDTAF-------
A0A0A2FW91      --------------------------MNLNEGSQNTFTRQGRSYISDTEDTAF-------
A0A2D2N2N1      --------------------------MNLNEDSKNTFTRQSRSYISDTEDTAF-------
Q7MWZ2          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
T2NDT6          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
W1R7P9          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
A0A1R4AFZ0      --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
A0A1R4DVZ7      --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
A0A2A8CVM9      -----MNDKNLSRFDSGDMTPAPLRNGHASNRMNGSAHHGGGSSGSSSEANAG-------
A0A5M4B212      -----------------------------------MDALNSNSANQMTTIVRQ-------
A0A3D1KEX9      ----------------------------------MAEQYIEGAQQLQQEENEE-------
A0A358Y7S2      ---------------------------------------MSTGPIKKRVLNKE-------
A0A1X7J248      --------------------------MSNQQTRYQRNLEGNNSHRPQNQETEV-------
E4TQD2          --------------------------MSNQQTRYQRNLEGNTSQKPQNQESEV-------
A0A2J6HHN3      ------------------------------------------MKQKIAKFNDE-------
A0A1Y3WMT8      ----------------------------------------MEENYTSERRNDS-------
A0A1Y4GQU1      ----------------------------------------MEENYTSERRNDS-------
A0A6A0R272      --------------------------------------------MNKNILADK-------
A0A1V5W8T5      ------------------------------------------------MFNDS-------
A0A2T8HKA9      ---------------------------------------MLKDTNIAGAEDKS-------
A0A2I0QZ80      ----------------------------------------MEVNKKKLFVNTT-------
A0A3E1F1A3      ----------------------------------------MINQKGKIFVNTT-------
A0A2U2XBJ3      ----------------------------------------MINQRGKIFVNTT-------
A0A4Q4KU94      ----------------------------------------MNSQKGKIFVNTT-------
A0A3B8INU3      --------------------MAETNQEDYRARIQGGYPGERLEPFGNSSVLDK-------
A0A2W1NDY9      -----------------------------------MNNFHINNENAISSLNKD-------
A0A5C8AQR5      ----------------------------------------MGSSERKIIINKE-------
A0A1G0CI31      ---------------------------------------MNGAQQPSLLINRE-------
A0A556N0M0      ----------------------------------------MNSSNSSIFINKD-------
F2IKD6          ----------------------------------------MNNSNTSIFINKD-------
A0A1I7BM74      ----------------------------------------MNSSKNRFFVNTE-------
A0A2G2FJ17      ----------------------------------------MEKRNNSIYVNTN-------
A0A2E3R1D0      MIDQPYPTAADRGA---------------------PGAPVRGEDPFYYGDRDG-------
A0A2T2USC0      --------------------------------------MNGQVGGMPAPQEDE-------
A0A2T2V0F3      MHDGSAPSGNGHSNRWNSMN---------------PVNGQSQPSGEHGARDDE-------
A0A2T2S682      -----MPRSSSFEYAGDGHPGNGRSAPDDEPSLY-DSAPDGPTGVD--------------
D5H561          --------MAHLQRRDPDQNGQG-----DIVRSW-EGGTNGAAGPSSGRQGIK-------
A0A2H3NWA9      -MASPSLPPNGQNGRHDAAPTPWPAQGQLYDEVY-HPEGNGVS-----------------
A0A2A8CVB6      MSPSSNMSSNGHRP--AGGPVNGIAGASLF---Y-DDNPQRGS-----------------
A0A2P6C1S6      -----MASTNGHPG-----SSQSVSVEDLL---YEDTTSRRSS-----------------
A0A2T2UTM4      -----MASTNGYPSGEEGPGSRSLAVEDLL---Y-DNSDRRSS-----------------
A0A414ZBF2      -------------------------------MRKDKFEDFDFIDFNESRSEES-------
A0A1Q3Q573      ----------------------------MENKLDLTGSGGSAPKGQQTNFAEG-------
A0A662BAY3      --------------------------------MTNNDNSGPVLRNLSSQTSED-------
A0A4U3L369      -----------------------------MEYNLNGNGAASNGSISHTDDADI-------
A0A357YNR3      -----------------------------------MSMYSEVEYEFNKLADKP-------
A0A5E8AX52      -----------------------------MTENSNTSGSGLGADVNESDAFND-------
F4KK08          --------------------------------MEYQTASTQQEPIRSSEEVST-------
A0A6B5PK86      ----------------------------------------MAENQNSFIINKS-------
A0A2G2F510      ------------------------------------------MSNKSFIINKN-------
A0A316JZ08      ------------------------------------------MAKQKLFINTS-------
A0A496LCF9      --------------------------------MKNINSDNHSNPIFDEEDNPS-------
A0A5P2G2A9      -----------------------------------MAENLLSNSGKGENAEEA-------
A0A3C0ZQC7      ----------------------------------MNIGKGDIERIHRDGISQE-------
A0A419VXB7      -----------------------------------MDRKEELLKLLLQKEEQP-------
A0A0B0BTJ4      ----------------------------------MTENNKDIIDGRKEEENKS-------
A0A3B9CNN6      ----------------------------------MTENNKDIIDGRKEEENKS-------
R5X290          ----------------------------------MTENNKDIIDGRKEEENKS-------
A0A1Q6E6I7      ----------------------------------MTENNQDIIDGRKEEENKS-------
C3J7R8          ---------------------------MEYRESETKSIEQELKRPSLVEAASF-------
A0A1G8BVM8      --------------------------------MSKNSEQFDFVDFNDGNSNDN-------
A0A1I1FXP9      ---------------------------MLQNAEAINNALVELEEEEELRAEKG-------
A0A3N4H5N3      -------------------------------------MYMKRVLGNKMGNEEP-------
A0A2P8EAX2      ---------------------------------------MNQNKARNKGAGEP-------
A0A4V2F6N9      ---------------------------------------MSHNRTKNKGAGEP-------
A0A3B9FXJ0      --------------------------------MSNNAKFQAAPQQESTSGSSG-------
R5GSU5          -----------------------------------MANQNYINPPAVQQETED-------
A0A2A3UE91      ------------------------------MFNPQVESANNQLKDITEKFNSG-------
A0A0A2G557      ------------------------------MNNNLYTNPEEGFIENNLSEEQM-------
A0A2N2WFW8      -----------------------------------------MAEYKKSKLNDD-------
A0A1F3IU95      -----------------------------------------MTDSRKIKFNDE-------
A0A3D0VUF6      -----------------------------------------MTDSRKIKFNDE-------
A0A1T4PT95      ----------------------------MNSNPYSNSSDVIMEKHQEIPEENM-------
A0A6I6JYY3      ----------------------------------MTTQRFQNNGIEHNNDEDS-------
A0A2A4PYG9      ----------------------------MYNQTTSGTDNVNAYQDRMSNFSQE-------
A0A1F3K695      -----------------------------------------MEEKKIPLINEK-------
A0A353KZR1      -----------------------------------------MEEKKIPLINEK-------
A0A2N2WYB5      -----------------------------------------MYQGKIPLINDK-------
A0A1F3K4G0      -----------------------------------------MYQGKIPIINDK-------
A0A356H8Y3      -----------------------------------------MYQGKIPIINDK-------
A0A351HSA6      -----------------------------------------MYQGKIPIINDK-------
A0A1F3Q014      ---------------------------MLQEDISKTNDNFERYKERISNFSGE-------
A0A2A4YXP3      -----------------------------MEENTSSNNLNEERARKRSNLNTE-------
A0A2D5KD44      ---------------------------MQEQLSPHELEKLKQSQSSLSSFNTD-------
A0A1F3R158      ---------------------------------MSEEYRDKQNNEAISNFNTE-------
A0A2M8ADX2      ---------------------------------MNDEFNNKENKETVSNFNTE-------
A0A1J5B2H0      -----------------------------------------MQPKKFSIINEE-------
A0A1V5N756      -----------------------------------------MANIKISYLNDE-------
A0A651GU15      ---------------------------MIDENISKVNQSYEGYKERLTNFGSQ-------
A0A3Q9FR88      --------------------------------MTDFDKEWDDLNNEGDNLSNN-------
A0A553GEX3      --------------------------------MTDFDKEWDDHDNDGDNLSNN-------
A0A150ADJ9      --------------------------------MTDFDKEFDDFDREDGNIADS-------
A0A1B1FWQ4      --------------------------------MSDFEKEWEDLENNEESSAND-------
A0A1S1Z228      --------------------------------MSDFEKEWEDLDNNEESSAND-------
A1ZKR2          -------------------------------MTDQSNIPNINTPSEDDDFLNA-------
A0A1Q3GX01      -------------------------------MEEQNHILPNNNSSENDDFFSS-------
A0A349DQI4      -------------------------------MEERNHILPTNNDSENDDFLSN-------
A0A4P5TMD1      -----------------------------------MLEKKIILSPMQKILGED-------
A0A2N3IIZ0      ------------------------MAQYLTEEERFRRLLQTDDIDSGESPLEA-------
A0A1F3SJM1      -----------------------------------------MSNKKSLIINKS-------
A0A2G2EB96      ------------------------------------------MSSKGIIINTS-------
A0A2G6PRA9      ------------------------------------------MNNKGLIINKS-------
A0A497D5Z2      --------------------------------MTPPNQRNNKPVSGKSASNED-------
A0A662B170      --------------------------------MTPPNQRNNKPVSGKSASNED-------
A0A2A5FYT6      --------------------------------METSSFSNNNEHNAFAKQQSD-------
A0A2E6SYP1      -----------------------------------------MEKEKLSILNDE-------
A0A2E5RLE8      -----------------------------------------MEKEKLSILNDE-------
A0A2E7TQF6      -----------------------------------------MEKEKLSILNDE-------
A0A2E6GVY9      -----------------------------------------MEKEKLSILNDE-------
A0A350JJ90      -------------------------------------MTEETNTNNLGVHSSQ-------
A0A3M1CDV2      ------------------------------MLVANTDNEYHSYKQRLENFSNN-------
A0A6C1QGZ7      --------------------------------------MTNPSLKKISTINDE-------
A0A4P5U6G4      ----------------------------------MQEEKKIILSPLQKLIGSD-------
A0A2E2TFD1      ---------------------------MIQDAREEQNESLDLYKERLTKFSQD-------
A0A2E4ELE6      ---------------------------MIHEDTSRNNENLDKYKERLTNFSQE-------
A0A522EYA6      ---------------------------MLADQFSNSSNSFSQYKERVSNLSQE-------
A0A2E3XZI5      ---------------------------MKQENFVQTEENINRYKENITSLTQD-------
A0A6I7QXV0      -----------------------------------MSRGNSILSILQNFLGKD-------
A0A2M7NLQ9      --------------------------MSDFDENPFINPAQAADASNEENFLAD-------
I4AFR0          --------------------------MSDFDENPFINTVPTAETSNEENMLAD-------
A0A2N2Y3E5      -----------------------------------------MEERRIPILNET-------
A0A2D9D7T6      ---------------------------------------MSSLNQRKLIVNKD-------
A0A1F3PPL5      ------------------------------------------MQKKIPLINET-------
A0A357QK06      ------------------------------------------MQKKIPLINET-------
A0A662AEA4      -----------------------------------------MQQNKIPIINEK-------
A0A0S2HYK8      -----------------------------------------MQNRKIPIINDT-------
A0A2N5ZWN6      -----------------------------------------MQKNKIPIINDT-------
A0A2E0FJ09      ---------------------MIEEEISKRNDSFER------YRERLTNFSSE-------
A0A1F3FZ62      ------------------------------------------MAAKISQINTE-------
A0A1F3K211      ------------------------------------------MAAKISQINTE-------
A0A1V6I2U9      -----------------------------------------MDENKTSLFNQK-------
A0A2H0B957      -----------------------------------------MEQKNIPILNEK-------
A0A1F3CFW6      -----------------------------------------MEQKRIPILNEK-------
A0A2M7E2T8      -----------------------------------------MEQKRIPILNEK-------
A0A2M7NC69      -----------------------------------------MEQKRIPILNEK-------
A0A1F3KLL5      ---------------------------------MKQ------QQRLIPVINDK-------
A0A359D1M1      ---------------------------------MKQ------QQRLIPVINDK-------
A0A0F2NS19      ----------------------------MQEDQFAH------KKEVVSNFNTE-------
A0A2A5H8X6      ----------------------------MQEDQFAH------KKEVVSNFNTE-------
A0A2H0GAU8      ----------------------------MEEEQFSN------KREPISNFNTE-------
A0A2M8FTK1      ----------------------------MEEEQFSN------KREPISNFNTE-------
A0A2A5B3B0      ----------------------------MEENNSSNNINEE-KTRKRSNLNTE-------
A0A5C6RXM7      ----------------------------MESNNQINSNQDVIKNRKHSTFNTE-------
A0A1F3C1M2      -----------------------------------M------SEKKIPLINEK-------
A0A1F3DS87      -----------------------------------M------TEKKIPLINEK-------
A0A6A0R6K9      ---------------------MYNQIEKNEIENVNR------YKDRLSNINKD-------
A0A2E7CT70      ---------------------MIPEEIKNTEDNLLR------YRERIANFSKD-------
A0A2D5V560      ---------------------MESENFKXVEXNFQR------YKENVADLTQE-------
A0A2D7K5A8      -----------MVNHYSNQSIMGAEEFKGAEENIQR------YKENVSDLTQE-------
A0A2E1XQ82      -----------MVNHYSNKSIMGVEDFKGTEDSIQR------YKENVADLTQE-------
A0A5C8A5B4      --------------------------------------------MNVAPSADT-------
A0A4Y9ITE2      --------------------------------------MKEINITSNKGKDKK-------
A0A5M8NYX7      ---------------------------------------METTNMQAEQSGEE-------
A0A3D5KRY6      ------------------------------------------------------------
A0A1V5IPN7      ---------------------------------------MDQNNQPSTVPQPE-------
A0A0E3V905      ----------------------------------MSANTYTYTQHQLVESDGL-------
A0A553ETH6      ----------------------------------------MNSINENNQEYEG-------
A0A640Q161      ------------------------------------MAVNSREELNVGVFENE-------
A0A640QU49      ------------------------------------MAVNSREEFHNGMFENE-------
A0A1Q3PII2      -------------------------------------MLATKIPSTDLALSRD-------
A0A351BXT2      -----------------------------MNKPSLNGKSNHTAVNSPELRESK-------
A0A2K8Z965      ---------------------------------MTNESNYSYTTHQVVESEGL-------
A0A418M8U8      ---------------------------------MNNQFQHSYVPYKMMEPEEL-------
I2GTA4          ---------------------------------MNNQFNHSYVPYKMMEPEEL-------
A0A2K8ZAJ2      ----------------------------------MNMNPNVYTPYQTADVESK-------
A0A368JPA3      ---------------------------------MKSSNMYSYPMYPQGEINSS-------
A0A5N1JI29      ---------------------------------MKSSNMYSYPMYPQGEINSS-------
A0A3P1BT12      ---------------------------------MKSSNMYGYPMYPQGEITSS-------
A0A3P1CI15      ---------------------------------MKSANMYNYPMYPQGEMSSS-------
A0A4R8CUK1      ---------------------------------------MHTNPINLRRKISS-------
A0A3D0MYJ7      ---------------------------------MNKNQDIFIDETKSGTETTI-------
A0A662AH13      ------------------------------------MNSGYNNNNSGFEIEET-------
A0A5C7QA01      -----------------------------------------MNQNQNTHTEDT-------
A0A3D3LS70      -----------------------------------MSDKSNNIPSVLKKDKEI-------
A0A1G1TM36      ------------------------------------------------------------
A0A1G7ZF38      -------------------------------------MLANKTQIAD---FQD-------
C6VS52          -------------------------------------MLTTKGPTNDYPPFQD-------
A0A2A4G4B1      -------------------------------------MISSGSPLKHDDEME--------
A0A0P7X1V8      --------------MTDTNGHNTNGYNGRYRGEEIANQYSGQAGLQREDNDDE-------
A0A5C8KAD6      ------------------------------------------------------------
A0A5N1J695      --------------------------------------MLQVNKDIPNSEES--------
A0A1H4ADG3      ------------------------------------MQTTTLDQLVPVKETK--------
A0A5B8VUR8      ------------------------------------MHTNTLDRLVPIKESK--------
A0A3N2M1H3      ---------------------------------------MDNTKTKPEGISGFSD-----
A0A4S2G8T2      ---------------------------------------MDNTKTKPEGISGFSD-----
A0A1T5K9D4      -----------------------------------------MENGNNQKNSGQ-------
A0A077ENE7      -----------------------------------MNTINQKGYTIGDKKEHS-------
A0A6I5UW06      -----------------------------------MNTINQKGYTIGDKKEHS-------
T0NN57          -----------------------------------MNMASQKINMTKESKEQF-------
X5K347          -------------------------------------MASQKINMTKESKEQF-------
A0A212K7W5      --------------------------------------------MKRNTEEDF-------
F5IU11          --------------------------------------------MKKNTEEDF-------
A0A6I1IYY4      -----------------------------------MEYTQENKEKTAGESGFN-------
K0XJ09          -----------------------------------MELIQETKNDKKNEGG---------
R5EUZ0          -----------------------------------MELIQETKNDKKNEGG---------
W0EQS0          -----------------------------------MELIQETKNEKKNEGG---------
A0A1Y3WE15      -----------------------------------MELIQETKNEKKNEGG---------
A0A1Y4GUK3      -----------------------------------MELIQENKNEKKNEGG---------
A0A352Z1R7      ---------------------------------MTSNVSIPPSQPLLRSGEN--------
A0A3N2N6F7      -----------------MQNNTQ--------QPLSQQMPVYQAAPVVSEEEDS-------
A0A4P7VVU7      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------
A0A2V1ILM4      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------
A0A3N2L0E8      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------
A0A3N2LFC5      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------
A0A0A2F501      ---------------------------------MKQEENSRSAQGALAEQDSF-------
R5B7P0          ------------------------------------MENNINTDNNTRQQEET-------
R5B0L5          -------------------------------------MEEPTEHTPQQLSTTQ-------
A0A6I1TEC0      -------------------------------------------MLRRNQGDDF-------
A0A3R5XWG1      -------------------------------------------MLRRNQGDDF-------
A0A646GTR1      -------------------------------------------MLRRNQGDDF-------
A0A5P0Y910      -------------------------------------------MLRRNQGDDF-------
A0A414YFM3      -------------------------------------------MLRRNQGDDF-------
A0A6A7UIA7      -------------------------------------------MLRRNQGDDF-------
A0A6A7VPS3      -------------------------------------------MLRRNQGDDF-------
A0A374THP7      -------------------------------------------MLRRNQADDF-------
A0A6G1VND1      ---------------------------MIQNTTPANQPAQVNPLLRRNQADDF-------
A0A0A2EVS5      --------------------------------------MDEKVTTYKRNVEEY-------
A0A1T4NAJ7      --------------------------------------MDEKVTTYKRNVEEY-------
A0A255T941      -------------------------------------METNNNNQTNEQNDDF-------
A0A3N2KCL3      -----------------------------------MAETIKSEARKSVNAGSA-------
A0A4P7VSV0      -----------------------------------MAETIKSEARKSVNAGSA-------
A0A2V1IJY1      -----------------------------------MAETIKSEARKSVNAGSA-------
A0A4P7VXK7      -----------------------------------MAETIKSEVRKSVNAGSA-------
A0A1Y4CHN5      ------------------------------------MADNISANNQVKQSEDF-------
A0A1M6I2S6      --------------------------------------MIEKKTAVGKPADDF-------
A0A1Y3V692      --------------------------------------MIEKKTAVGKPADDF-------
F3PXM2          --------------------------------------MIENKNAVGKPADDF-------
A0A3E4ZNL4      --------------------------------------MMEKRINAGKPVDDF-------
A0A174AHH7      --------------------------------------MIKNRTNAGKPADNF-------
A0A174JCE8      --------------------------------------MIKNRTNAGKPADNF-------
A0A3E4JMC4      --------------------------------------MIKNRTNAGKPADNF-------
A0A412SND6      --------------------------------------MIKNRTNAGKPADNF-------
A0A414IEQ9      --------------------------------------MIKNRTNAGKPADNF-------
A0A415UKN5      --------------------------------------MIKNRTNAGKPADNF-------
A0A6I0U0V8      --------------------------------------MIKNRTNAGKPADNF-------
A0A6I2PDH7      --------------------------------------MIKNRTNAGKPADNF-------
A0A0M1W8D8      --------------------------------------MIKNRTNAGKPADNF-------
A0A3R6GKX5      --------------------------------------MIKNRTNTGKPTDDF-------
A7V4S1          --------------------------------------MIKNRTNTGKPTDDF-------
B0NU19          --------------------------------------MIKNRTNTGKPTDDF-------
D4V601          --------------------------------------MIKNRTNTGKPTDDF-------
A0A4Q0U3M9      --------------------------------------MIKNRTNTGKPTDDF-------
A0A4R4H1Q2      --------------------------------------MIKNRTNTGKPTDDF-------
A0A6I0GII7      --------------------------------------MIKNRTNTGKPTDDF-------
A0A6I0KYU7      --------------------------------------MIKNRTNTGKPTDDF-------
A0A397WLT5      --------------------------------------MIKNRTNTGKPTDDF-------
A6KY94          --------------------------------------MIENRTSVGKSAEDF-------
A0A173UQR8      --------------------------------------MIENRTSVGKSAEDF-------
A0A3R6HK75      --------------------------------------MIENRTSVGKSAEDF-------
A0A412B7D1      --------------------------------------MIENRTSVGKSAEDF-------
A0A412VNY9      --------------------------------------MIENRTSVGKSAEDF-------
A0A414LTU9      --------------------------------------MIENRTSVGKSAEDF-------
I9Q4U4          --------------------------------------MIENRTSVGKSAEDF-------
A0A6A2J529      --------------------------------------MIKNRTNTGKPTDDF-------
A0A3R6GM96      --------------------------------------MIKNRTNTGKPTDDF-------
A0A015XH67      --------------------------------------MIKNRTNTGKPTDDF-------
A0A078RZN2      --------------------------------------MIKNRTNTGKPTDDF-------
A0A4R4I3T9      --------------------------------------MIKNRTNTGKPTDDF-------
A6L0K5          --------------------------------------MIKNRTNTGKPTDDF-------
A7ACT5          --------------------------------------MIKNRTNTGKPTDDF-------
A0A373ISF0      --------------------------------------MIEKKAAAGKPADDF-------
U6RF62          --------------------------------------MIEKKAAAGKPADDF-------
A0A662ZZD5      --------MDQRRFIPHFVGCANIQVTFRKGITLYFYNMTEKKTTASKPADDF-------
A0A3A5TI83      --------------------------------------MTEKKTTASKPADDF-------
A0A415NEB6      --------------------------------------MTEKKTTASKPADDF-------
A0A6I0I238      --------------------------------------MTEKKTTASKPADDF-------
A7AJ60          --------------------------------------MTEKKTTASKPADDF-------
A0A6A2JF01      --------------------------------------MTEKKTTASKPADDF-------
A0A6I0Y2Y2      --------------------------------------MTEKKTTASKPADDF-------
A0A6I2Q447      --------------------------------------MTEKKTTASKPADDF-------
A0A395YYT3      --------------------------------------MTEKKTTASKPADDF-------
A0A015UXN7      --------------------------------------MTEKKTTASKPADDF-------
A0A5M5W148      --------------------------------------MTEKKTTASKPADDF-------
A0A6I2NTL0      --------------------------------------MTEKKTTASKPADDF-------
A0A016E4F9      --------------------------------------MIEKKTIVGKSTDDF-------
A0A4Q5CFJ7      --------------------------------------MIEKKTIVGKPTDDF-------
A0A6H9P0U9      --------------------------------------MVEKKTPVGKPADDF-------
A0A108TH71      --------------------------------------MVEKKTPVGKPADDF-------
I8VXH0          --------------------------------------MVEKKTPVGKPADDF-------
A0A412S0N6      --------------------------------------MVEKKTPVGKPADDF-------
A0A412IIJ0      --------------------------------------MVEKKTPVGKPADDF-------
A0A0P0FM97      --------------------------------------MVEKKTPVGKPADDF-------
R6KTP3          --------------------------------------MVEKKTPVGKPADDF-------
A0A139LU87      --------------------------------------MVEKKTPVGNPADDF-------
A0A1C6B3Y5      --------------------------------------MVEKKTPVGKPADDF-------
E2NMQ4          --------------------------------------MVEKKTPVGKPADDF-------
A0A412YDB9      --------------------------------------MVEKKTPAGKPADDF-------
R7DY01          --------------------------------------MVEKKTPAGKPADDF-------
A0A414LGK8      --------------------------------------MVEKKTPAGKPADDF-------
A0A415IPQ4      --------------------------------------MVEKKTPAGKPADDF-------
A0A3E5BRW7      --------------------------------------MVEKK----KPADDF-------
K9DXS6          --------------------------------------MVEKK----KPADDF-------
A0A1M6KFV3      --------------------------------------MVEKK----KPADDF-------
A0A1Q6G7L3      --------------------------------------MVEKK----KPADDF-------
A0A413H235      --------------------------------------MVEKK----KPADDF-------
A0A1M5B2J8      -------------------------------------MATIQKKIQVHNTQDF-------
A0A255RCT5      -------------------------------------MATIQKKTQVQNTQDF-------
A0A1Y4GLF5      -------------------------------------MAINKDTTKNKQTDDF-------
A0A1H3XSC0      -------------------------------------MSINQK--RPTQTDDF-------
A6LE40          ------------------------------------MMTINPKNTKPGQQDDF-------
A0A4Y1VPX5      ------------------------------------MMTVNQKNIKPGQQDDF-------
B3JI46          ------------------------------------MMTVNQKNIKPGQQDDF-------
R6NN15          ------------------------------------MSETQQHTRPAAKADDF-------
A0A358R8U0      -------------------------------------MEMTQNTSPAEPMDDS-------
R6WSB6          -------------------------------------MEMTQNTSPAEPMDDS-------
A0A401LPX7      -------------------------------------MATIQNKSTVQNMQDF-------
A0A6I0J0P8      -------------------------------------MATIQNKSTVQNTQDF-------
A0A6I1BFM0      -------------------------------------MATIQNKSTVQNTQDF-------
A0A6G0GNY9      -------------------------------------MATIQNKSTVQNTQDF-------
A0A3A5Z900      -------------------------------------MATIQNKSTVQNTQDF-------
A0A285TGL6      -------------------------------------MATIQNKSTVQNTQDF-------
A0A3A5RFX4      -------------------------------------MATIQNKSTVQNTQDF-------
A0A1Q6IUW9      -------------------------------------MATIQNKSTVQNTQDF-------
A0A3R6NPG7      -------------------------------------MATIQNKSTVQNTQDF-------
A0A413XDP6      -------------------------------------MATIQNKSTVQNTQDF-------
K6AP24          -------------------------------------MATIQNKSTVQNTQDF-------
A0A6I2NHV3      -------------------------------------MATIQNKSTVQNTQDF-------
A0A662ZYI7      -------------------------------------MATIQNKSTVQNTQDF-------
A0A078RYI7      -------------------------------------MATIQNKSTVQNTQDF-------
C7XEQ8          -------------------------------------MATIQNKSTVQNTQDF-------
D7INX6          -------------------------------------MATIQNKSTVQNTQDF-------
K5ZG55          -------------------------------------MATIQNKSTVQNTQDF-------
A0A3N2N9B8      --------------------------MAELLDLSSAPASPSATTRKKTAASNT-------
A0A3N2NMI0      --------------------------------MAENNATAPAQRRKKTPESTP-------
A0A359I8H7      -------------------------------------MSDNINVTQESEAAEE-------
A0A3N2KA63      -------------------------------------MSDNINVTQESEAAEE-------
A0A4Q0IMT7      -------------------------------------MSDNINVTQESEAAEE-------
A0A3B9FAU3      -------------------------------MATNNSLESEKNYSATAENNELENGG---
A0A3C1E5L7      -------------------------------MATNNSLESEKNYSATAENNELENGG---
A0A4Q0UAV1      --------------------------------------MPTKMQAAPKRPADS-------
A0A354SN68      --------------------------------MYTNMDNNENTSLSTEKVEDE-------
A0A3N2N595      ----------------------------------MAEVNKIQSNKKSGAAGA--------
A0A0A2DUD9      --------------------------------MIQNTTTVVEKPAAEGQQENF-------
A0A3P1ZBJ5      -------------------------------------MVENEVNAPQNEQTTG-------
R5FHS9          ---------------------------------MPNNQIQSQQPQQNQQSDDS-------
A0A413TW79      --------------------------------------MQNAPGRRPQQAEDF-------
A0A3E5E9M7      ------------------------------MIQNNQATMQNVLVRRPQQAEDF-------
A0A3E4SK73      ------------------------------MIQNNQATMQNVPGRRPQQAEDF-------
A0A415GGC6      ------------------------------MIQNNQATMQNVPGRRPQQAEDF-------
A0A413DBH9      ------------------------------MIQNNQATMQNVLVRRPQQAEDF-------
A0A1Y4PQK7      --------------------------------------MTIQNNTKPGQADDF-------
A0A1Y4IH41      --------------------------------------MAIQNNTKPGEADDF-------
A0A3A6AAP4      --------------------------------------MAIQNNTKPGQADDF-------
A0A6I0ZRD2      --------------------------------------MAIQNNTKPGQADDF-------
A0A1Y4DYA7      --------------------------------------MNENNTKSDLFLQES-------
A0A1Y3X4I9      -------------------------------------MSTLSDKETELFLDELEKSSSSG
A0A1Y4FNK8      -------------------------------------MATQNNPARPKQADDL-------
A0A355FD59      ------------------------------------MALSQNNNVKQKQPEDF-------
A0A359CEZ9      ------------------------------------MALSQNNNVKQKQPEDF-------
A0A353Q7B4      ------------------------------------MALSQNNNVKQKQPEDF-------
F8X3A5          ------------------------------------MTSVQHNKTERKQTEDL-------
A0A1M3KVR9      ------------------------------------MTPVQHNKTEQKQTEDL-------
A0A4Y9IJS3      ------------------------------------MTSVQHNKTEQKQTEDL-------
A0A495WI87      -------------------------------------MAAVQNNPKSKQSEEF-------
A0A354M4S6      -------------------------------------MAAVQNNPKSKQSEEF-------
R7DH52          -------------------------------------MAAVQNNPKSKQSEEF-------
A0A4Q5E7L5      -------------------------------------MTINQKNTKPGQQNDF-------
A0A4P8LP09      -------------------------------------MAVNQKNTRPGQADDF-------
A0A4R4GZU7      -------------------------------------MAVNQKNTRPGQADDF-------
A0A016CWA4      -------------------------------------MAVNQKNTRPGQADDF-------
A0A1C6H117      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A0M1W0V2      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A139KA16      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A174VQ92      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A1Q6HCG0      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A1Y4JYM9      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A3A5QW67      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A3A5RQE6      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A3A6BP07      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A3E5E153      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A3Q9IP20      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A412WV15      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A413ICP6      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A414KYB9      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A5B3FWR2      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A6I0WNS4      -------------------------------------MAVNQKNTKPGQPDDF-------
E5WX00          -------------------------------------MAVNQKNTKPGQPDDF-------
K0X3P3          -------------------------------------MAVNQKNTKPGQPDDF-------
A0A415TAH7      -------------------------------------MAVNQKNTKPGQPDDF-------
A0A078T2W6      -------------------------------------MAINQKNIKPGQQDDF-------
A0A6I1AQV4      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A5C6L2P1      -------------------------------------MTVNQKNIKPGQQDAF-------
A0A412MJT7      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3E4WKT5      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3A5YY33      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A078TAH2      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A1E9CFZ7      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A373FYU5      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3A5TZ72      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3A5XBP2      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3A6MEG9      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3E4JP35      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3E4KP40      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3E4NX82      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A3E4XFU8      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A412RG70      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A412TD37      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A413GAA4      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A414M7I4      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A496BTA0      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A496D2V6      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A4Q5G1P5      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A5C6KCA6      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A5M5AHM5      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A6I0KZV6      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A6I0Y5K7      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A6I1BFB8      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A6I2P5W5      -------------------------------------MTVNQKNIKPGQQDDF-------
E5UZA2          -------------------------------------MTVNQKNIKPGQQDDF-------
A0A069SMG6      -------------------------------------MTVNQKNIKPGQQDDF-------
C3RFN5          -------------------------------------MAINQKNIKPGQQDDF-------
A0A3A5Z014      -------------------------------------MTINQKNIKPGQQDDF-------
A0A6I0ING7      -------------------------------------MAINQKNIKPGQQDDF-------
A0A6I2P894      -------------------------------------MAINQKNIKPGQQDDF-------
A0A078S3Q8      -------------------------------------MAINQKNIKPGQQDDF-------
A0A069SJV7      -------------------------------------MAINQKNIKPGQQDDF-------
A0A3E5DXI5      -------------------------------------MAINQKNIKPGQQDDF-------
A0A3E5EM98      -------------------------------------MAINQKNIKPGQQDDF-------
A0A3E5F453      -------------------------------------MAINQKNIKPGQQDDF-------
I9T3G6          -------------------------------------MAINQKNIKPGQQDDF-------
A0A3E4SYU0      -------------------------------------MAINQKNTKPGQPDDF-------
A6LGY1          -------------------------------------MAINQKNIKPGQQDDF-------
K5ZSH4          -------------------------------------MAINQKNIKPGQQDDF-------
A0A6A2RTB3      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A6I0VY00      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A1M4YZ07      -------------------------------------MSINQKNTKPGQPDDF-------
A0A4Q5E5M7      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A0P0FQW1      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A5M5C0W6      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A6I0H151      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A6I0HI59      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A642LZ22      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A6I0IP89      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A642NJ89      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A6I0HI52      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A6I0YVB5      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A6G0G4T5      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A6I0HFG9      -------------------------------------MTVNQKNIKPGQQDDF-------
A0A416GA42      ------------------------------------MEQQNKQNVS-GSGLE--------
A0A1T3IYP5      ----------------------------------MDTIKQKNYIIENKKEQS--------
A0A3P1Z8V4      ---------------------------------MIQSSSSHPDYPHLPSDSD--------
A0A060RD97      --------------------------------------MVENKINNEQDPKS--------
A0A3C1ITV0      --------------------------------MKEDYNSIGAAETE-DQKNE--------
R7HN19          --------------------------------MKEDYNSIGAAETE-DQKNE--------
A0A350IHV0      ---------------------------MALENNNIDNRPALRNANGEEDGDI--------
R5RVP0          ------------------------------MPIDNNLDNRPSQVRNEEENDL--------
R6A0L2          ------------------------------------METKSINPQE-QQDEE--------
R7LG80          -------------------------------------MNNVPDTFK-RDEEE--------
A0A2L2WX98      --------------------------------------MENTNNAT-IEKEE--------
A0A285T4L1      ---------------------------------------MQNNTLSNKNEQS--------
G5GD56          ---------------------------------------MSGSVQNKNKEED--------
R5KD55          ------------------------------------METNPVTQQTEETTEE--------
A0A174QNT3      ----------------------------------METNKTTDLKRTEN---V--------
A0A4S2FGS1      ----------------------------------METKKTTTSSPKEN---V--------
R9I0H0          ----------------------------------METKKTTTSSPKEN---V--------
K5BUT9          ----------------------------------MEYIQENERTLKKDEG-G--------
A0A174FPA3      ----------------------------------MEYIQENERTPKKDEG-G--------
R6S9Y6          ----------------------------------MEYIQENERTPKKDEG-G--------
A0A642LIH6      ----------------------------------MEYIQENERTPKKDEG-G--------
C9KX15          ----------------------------------MEYIQENERTPKKDEG-G--------
A0A6H0KRK1      ----------------------------------MEYTQENNEKTVKESGFN--------
R6DAG6          ----------------------------------MEYTQENNEKTVKESGFN--------
A0A3L8AAP1      ----------------------------------MEYTQENNEKTVKESGLN--------
A0A4S2AYX2      ----------------------------------MEYTQENNEKTVKESGLN--------
A0A4Y9H477      ----------------------------------MEYTQENNEKTVKESGLN--------
A0A0E2M2Y7      -------------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------
A0A0K2J6Z0      -------------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------
B2RKZ8          -------------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------
A0A212GC82      -------------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------
A0A254MU12      -------------------------MNLIEDSKNTLAESRSRIYTK-EETSF--------
R6CQ93          ---------------------------------------MQNNNLSGKNEQS--------
A0A3D1NQW3      -----------------------------MTPNNINPNSANSDTKQ-EEHIT--------
B0MT10          -----------------------------MTPNNINPNSANSDTKQ-EEHIT--------
R7JGW9          -----------------------------MTPNNINPNSANSDTKQ-EEHIT--------
A0A3D2BF46      ------------------------------MEE-NRNVNNVPAEGN-EDSIN--------
A0A358R538      ------------------------------MTE-RTINPQ---PAE-ETTGN--------
A0A1Y4AAB8      ------------------------------MIEQTPNTQHAPQNET-SEAGM--------
A0A1Y3WWY9      ------------------------------MIEQQPNNIPQQAFND-DQAGT--------
A0A1Y4U5L4      ------------------------------MIEQQPNNIPQQAFND-DQAGA--------
A0A1Y3VCJ1      ------------------------------MAE-IQFNTQTRDKIH-DQTPA--------
A0A1Y3QTW7      ------------------------------MTEYNNQQQHLQNDEN-ENGSG--------
R6XWY7          ------------------------------MTEYNNQQQHLQNDEN-ENGSG--------
A0A4Y1X9Y9      ------------------------------MTEYNNQQQHLQNDEN-ENGSG--------
A0A4Y1WM66      ------------------------------MTEYNNQQQHLQNDEN-ENGSG--------
A0A174AVF1      ------------------------------MTEYNNQQQHLQNDEN-ENGSG--------
A0A656Q4F4      ------------------------------MTEYNNQQQHLQNDEN-ENGSG--------
A0A1Q6EIY0      ------------------------------MTE-QNINPHLLNGES-ENTNG--------
A0A5B5VN71      ------------------------------MTE-QNINPHLLNEES-ENTNG--------
E4M8L3          ------------------------------MTE-QNINPHLLNEES-ENTNG--------
I3YQ50          ------------------------------MTE-QNINPHLLNEES-ENTNG--------
R5UEY8          ------------------------------MTE-QNINPHLLNEES-ENTNG--------
A0A1H4D866      ------------------------------MTE-QQINSPQQQGND-EMTGA--------
A0A5B3G4Y7      ------------------------------MAE-QQINSQIQTNNE-ELTNT--------
A0A374A9J5      ------------------------------MAE-QQINSQIQTNNE-ELTNT--------
A0A5B3GQN5      ------------------------------MAE-QQINSQIQTNNE-ELTNT--------
A0A1Q6E9S3      ------------------------------MAE-QQINSQIQTNNE-ELTNT--------
D4IJ36          ------------------------------MAE-QQINSQIQTNNE-ELTNT--------
A0A414Q925      ----------------------------MGKDRFEDLDFIDFNDSR-RQEGT--------
A0A415PUS9      ----------------------------MGKDRFEDLDFIDFNDSR-RQEGT--------
A0A108TCU0      ----------------------------MGKDRFEDLDFIDFNDNR-RQEGT--------
A0A413BA42      ----------------------------MGKDRFEDLDFIDFNDSR-RQEGT--------
S3Y344          ----------------------------MRKDRFEDLDFIDFNDSR-RQEGT--------
A0A4Q5G8Y8      ----------------------------MGKDRFEDLDFIDFNDSR-RQEGT--------
A0A412TGL3      ----------------------------MGKDRFEDLDFIDFNDSR-RQEGT--------
A0A413VJ33      ----------------------------MGKDRFEDLDFIDFNDSR-RQEGT--------
A0A414L0W6      ----------------------------MGKDRFEDLDFIDFNDSR-RQEGT--------
A0A412DP39      ----------------------------MGKDRFEDLDFIDFNDSR-RQEGT--------
A0A413ZSE8      ----------------------------MGKDRFEDLDFIDFNDSR-RQEGT--------
B0NP84          ----------------------------MGKDRFEDLDFIDFNDSR-RQEGT--------
R6AK43          ----------------------------MGKDRFEDLDFIDFNDSR-RQEGT--------
A0A412N2D9      ----------------------------MGKDRFEDLDFIDFNDSR-QQEST--------
A0A1Y4JYS9      ----------------------------MGKDRFEDLDFIDFNDSR-QQEST--------
R6LHA4          ----------------------------MGKDRFEDLDFIDFNDSR-QQEST--------
A0A3E5HPT8      ------------------------------------------MALT-EEEKS--------
C6IJ48          ------------------------------------------MALT-EEEKS--------
Q8A3U2          ------------------------------------------MALT-EEEKS--------
A0A3R6S1H6      --------------------------------------MKNEELIE-DGTNA--------
A0A3R6SD81      --------------------------------------MKNEELIE-DGTNA--------
A0A354WXN6      --------MVVCSIRLGGCSLLNCHIIQQITQSTVMEQQENNKNIE-QEEQE--------
R5IP14          --------------------------------MAKEQQEIYGQQVEESTDNG--------
A0A316SZX7      ----------------------------------MSEQNINQPQQNAPAEEE--------
A0A1Y4AIY1      ----------------------------------MKVENPSNGPRWNEANSG--------
A0A0J6CIR2      ------------------------------------------MNLR-REENE--------
A0A3D8HG59      ----------------------------------MEPNQELENLQQ-QEENE--------
A0A3R6S408      ----------------------------------MEPNQELENLQQ-QEENE--------
F3ZRU7          ----------------------------------MEQQNLDNKIQQEHTEQE--------
A0A1C5Q1F3      ---------------------MDLRDFGFNFNCHLNIGCEMTNRKNTQSDHT--------
R7A239          ---------------------MDLRDFGFNFNCHLNIGCEMTNRKNTQSDHT--------
A0A3R6HIK7      ----------------------------------MSTEYNPENNIRIEEESV--------
K5ZVW7          ----------------------------------MSTEYNPENNIRTEEEST--------
A0A1Y4D5Z0      --------------------------------MIDNRENTQRDYAQ-ENENT--------
A0A413VXJ7      ----------------------------MSTEQNINKESKT-SKNS-KQEEE--------
I9RSN9          ----------------------------MSTEQKINKESKA-SKSS-EKEEE--------
U6RJK5          ----------------------------MSTEQKINKESKA-SKSS-EKEEE--------
A0A1Q6GA32      ----------------------------MSTEQKINKESKA-SKSS-EKEEE--------
I9RPU6          ----------------------------------MNTEYKN-NDVR-KQEPE--------
I8YFS5          ----------------------------------MSIESQN-SELR-EKESE--------
A0A6H9LTF8      ----------------------------------MSIESQN-SELR-EKESE--------
I8Y597          ----------------------------------MSIESQN-SELR-EKESE--------
A0A1Q6GBF5      ----------------------------------MNTEQKN-NNNP-GQESE--------
I8YFZ3          ----------------------------------MSAEYKN-NDIR-KQESE--------
A0A6H9M1J1      ----------------------------------MNTEYKN-NDAR-KQESE--------
A0A1Q6GDH2      ----------------------------------MNTEYKN-TDVR-KQEPE--------
U6RSB0          ----------------------------------MNTEYKN-NDVR-KQEPE--------
I9GXM2          ----------------------------------MNTEYKN-NDVR-KQESE--------
I9SIK1          ----------------------------------MNTEYKN-NDVR-KQESE--------
A0A6H9LZ74      ----------------------------------MNTEYKN-NDVR-KQESE--------
I9TP59          ----------------------------------MNTEYKN-NDAR-KQESE--------
R5S343          ---------------------------------MKNTEQDL-FEFE-EEKSG--------
A0A1M6K7I9      ----------------------------------MNEEQKVQSNMT-AQEEQ--------
A0A5M6A8C8      ----------------------------MKSEQQMNEEQKVQTNMA-VQEEQ--------
A0A6H9LT84      ----------------------------------MNTESQNNNDIR-EQDLE--------
A0A6H9LUV5      ----------------------------------MNTEPQNNNEIR-DQESE--------
A0A3R5ZMK1      ----------------------------------MNTEQET-N-TR-VEESE--------
A0A3E4ZTK7      ----------------------------------MNTEQET-N-TR-VEENE--------
A0A1Y3ZIA4      ----------------------------------MNTEQET-N-TR-VEESE--------
K5Y1A4          ----------------------------------MNTEQET-N-TR-VEESE--------
A0A4Q5CIT0      ----------------------------------MNTEQET-N-IR-MEENE--------
A0A3R6K8X4      ----------------------------------MNIEQET-N-IR-MEENE--------
A0A414GI87      ----------------------------------MNTEQET-N-IR-MEENE--------
A0A415BDM7      ----------------------------------MNTEQET-N-IR-MEENE--------
A0A412DM15      ----------------------------------MNTEQET-N-IR-MEENE--------
A7AEU7          ----------------------------------MNTEQET-N-IR-MEENE--------
A0A1Q6I3T6      ----------------------------------MNTEQET-N-IR-MEENE--------
A0A414XX40      ----------------------------------MNTEQET-N-IR-MEENE--------
A0A3R6BKI7      ----------------------------------MNTEQET-N-TR-VEESE--------
A0A414LPI6      ----------------------------------MNTEQET-N-TR-VEESE--------
A0A412M2W1      ----------------------------------MNTEQET-N-TR-VEESE--------
K5ZX55          ----------------------------------MNTEQET-N-TR-VEESE--------
A0A5F0U645      ----------------------------------MNPEQET-NMLR-EEENE--------
K5ZBN2          ----------------------------------MNPEQET-NMLR-EEENE--------
A0A0J6CKW3      ----------------------------------MNPEQET-NMLR-EEENE--------
A0A0F5IQM7      ----------------------------------MNPEQET-NMLR-EEENE--------
A0A496CDT3      ----------------------------------MNPEQET-NMLR-EEENE--------
A0A6G1ZKM3      ----------------------------------MNPEQET-NMLR-EEENE--------
S0GLB0          ----------------------------------MNPEQET-NMLR-EEENE--------
A0A3R6NLC1      ----------------------------------MNPEQET-NMLR-AEENE--------
A0A416WYC9      ----------------------------------MNPEQET-NMLR-AEENE--------
A0A0F5IT40      ----------------------------------MNSEQET-INLR-REENE--------
A0A496CX20      ----------------------------------MNSEQET-INLR-REENE--------
A0A5F0UBI0      ----------------------------------MNSEQET-INLR-REENE--------
A0A6G1ZHG0      ----------------------------------MNSEQET-INLR-REENE--------
S0GSI7          ----------------------------------MNSEQET-INLR-REENE--------
K5YB65          ----------------------------------MNSEQET-INLR-REENE--------
A0A0F5IWP9      ----------------------------------MNSEQET-TYLR-GEENE--------
A0A0F5IZT8      ----------------------------------MNSEQET-TYLR-GEENE--------
A0A417LKQ2      ----------------------------------MNSEQET-TYLR-EEENE--------
A0A416TME1      ----------------------------------MNSEQET-TYLR-EKENE--------
A0A416XPE8      ----------------------------------MNSEQET-TYLR-EKENE--------
A0A3B0C2S4      --------MPILGCLFKIVSVFLPHIFNLKKRMAESPFSLDYDETEES------------
L8JI02          --------------------------------------------MNDK------------
A0A4Q5WS95      --------------------------------------MINRPDQKST------------
A0A501VZX6      ------------------------------------------MPSSEN------------
A0A399SH26      -----------------------------------MSSSINNAPNNEE------------
A0A501W1A9      --------------------------------------MDKNKSTKED------------
A0A0E3ZGV6      --------------------------------------MDKNKVNAED------------
A0A1I2N4S1      --------------------------------------MDKNKTNSED------------
A0A2T5YE44      --------------------------------------MDKNKTNSED------------
A0A1V9FHD0      -------------------------------------MQTHKKTGNEM------------
A0A4V4H170      -------------------------------------MQTNKKTGNEM------------
A0A1V9F098      -------------------------------------MQTNKKTGNEM------------
A0A4R2VU64      -------------------------------------MQTNKKTGSEM------------
A0A4S8HY23      -------------------------------------MITNKKTGNEM------------
A0A1V9F383      -----------------------------------MQPNIN--TKNEK------------
G8TRZ6          -----------------------------------MQTNINSKSKSEK------------
A0A543WA52      ------------------------------------------MSTEDE------------
A0A1M5BA90      -----------------------------------MEPKRHAT-EKEK------------
A0A512B879      -----------------------------------MEAKRPIILKKEK------------
A0A559PPI3      -------------------------------------MSYNNKSAKNE------------
A0A1T5CS78      -------------------------------------MKYNSNTGKED------------
A0A0Q9Z8F1      -------------------------------------MKYNSKTGKED------------
A0A2N0U0M7      -------------------------------------MKYNSKTGKED------------
A0A2N3U785      --------------------------------MNKKDIFL---AEPEN------------
A0A0D3L8Q3      --------------------------------MTDQDNLLL--EDSEQ------------
A0A0E3ZG78      --------------------------------MMDKELFPLSSERAGE------------
A0A1I6BRK6      --------------------------------MDSQELFSSDLSQAKA------------
A0A243WAB1      --------------------------------MNTRELFPLNSEQVEE------------
A0A6G8C8X6      --------------------------------MENKELFPLSSEQTEA------------
A0A5B6TJH8      ----------------------------MQRLAGTEELFPLKAEKKDN------------
A0A519U664      --------------------------------MDNKELFPLSSEQPES------------
A0A519UDD1      --------------------------------MANDDLFPVSREQPGT------------
A0A519MA34      -------------------------------MDNNKELFPLSSEQPES------------
A0A519UCX0      -------------------------------MDNNKELFPLASEQPES------------
A0A4R5DL69      ---------------MASYLENITSIESGS--------TVNHTLTQTI------------
A0A1M4YED3      ------------------------------------MSAPKHTQEPQE------------
A0A2H3NSN0      ---------------MNTNDQNALDIRRKKVEQIGLSRSDNSDTESNA------------
A0A2P6C324      ---------------MNDTSQNLTPYRKQA-EKIGLQSSNSGS-DDNT------------
A0A1M6XHU0      ---------------MAHYRHHSLIVARGG-QRGGLPPASSETRDEGR------------
A0A5S9C8G0      ---------------MAHYRHHSLIVARGG-QRGGLPPASGETRDEGR------------
G2SF81          ---------------MAHYRHHSLIVARGG-QRGGLPPASGETRDEGR------------
A0A5S9EYW1      ---------------MAHYRHHSLIVARGG-QRGGLPPASDEKRDEGR------------
D0MHQ9          ---------------MAHYRHHSLIVARGG-QRGGLPPASDEKRDEGR------------
A0A126PFG0      ----------------------------MEPFNGQVSTFYTAATASQP------------
A0A3M1N7Z3      ------------------------------------------MPIQQE------------
                                                                            

A0A1T5MMH4      IDFNKLKV----I----VRNNLVWIALIFLVIN-LTAYLI-IRYTQDRYESFSEIKLDVK
A0A2W4R1L8      IDFSKLRT----I----IRNNRLWILAIFVVIN-LLTYLLFIRYSPDLYESHSEIKLDIR
A0A2E5CV79      ---MELMG----I----LRFHYKLILTITLFGI-MIFTYR-TYTIHPVYRSTSSIIIKEK
A0A2D4ZVH1      IDLIKVFN----I----LLLHKWALIGITVLFT-VVAIIF-AQLQTPIFQSTGTLIVSES
A0A0K8QSK7      SMIKPFLL----K----LLGKWYWFVLSVVLFL-AAAWLL-TRYSMPVYQSSSSLLILER
A0A1V6CN82      FNYKRLVS----E----LISHWYLFVLFMGIGL-AGAWLY-NRYTTTMYSARASIMILEE
A0A1M4XZ45      IDLKKIIF----K----LLHNWYWFVLSIIVAL-SLAFLY-NRYTTPVYEIKASMLVEEG
A0A399D319      IDLKKIIF----R----FLRNWYWFAFVVAITL-GMAFLY-NRYTTPIYEISSSLLVEEE
A0A1M6GR99      LNIQDIFK----L----FFKNIWIVISCIIVAL-GIAYFY-NWYSIPTFKVSATLLLKDN
A6EBM4          VDLLKITM----V----LFSRWYIIASTTLICL-IAAYAY-LWYTPKTYATTAILKFEEQ
A0A1M6TTV4      LDFDKIKQ----V----FVKNVIWMLLILLLIN-ASTVLY-VRYTKPIYSSESILKLDIK
A0A4Q8RX32      DDFNVIFR----K----LAKYWKVFPISILFFV-SLGVIY-NKLAEPIYEIGAKVVVHER
K0X1U5          IDIVALWR----A----ACRKWYLFAGSVVVCV-ALVVCY-LKIAKPVYEVSADILVNED
R5EXK3          IDIVALWR----A----ACRKWYLFVGSIVVCV-ALVVCY-LKIAKPVYEVSADILVNED
A0A401UAP7      IDFSKLKS----I----LLKNTVWILLLFILCN-LSAYLY-IRYTKNVYEAEAEIKLEVN
A0A1W2GF52      FDFEKFRQ----V----FASGWPWVLGILITTM-SLSFLY-MRYTKPIYSAESILKLDIK
A0A2G5L7B8      IDFDKLNQ----V----FIKNLPWIILILILFN-AGTFLY-LRYTKPIYSSESILKLDIK
A0A523GAC0      IDIEKLHT----V----LGKSWLWIMLIVLSTN-LTAYLV-IRWTKPLFESYSDIKLNVK
L8JW09          IDLDKALT----V----LRKSIPWILLIFIVTN-LSAYLY-IRWTKPLYESESELKLDVK
A0A364XUP5      IDINKLRV----T----IWDNILWILLIFVVTN-TAAYLV-IRYSKDIYQSVSELKLDIK
A0A1M5RLA9      LDLNKLKT----T----LKRNWLWLIILFLVIN-SVAYLK-VRYTKNLYESSSELKLDIK
A0A385SFR9      LDLNKLKI----I----FKRNWLWLVVLFLVIN-SIAYLK-VRYTKNVYESSSELKLDIK
A0A5M4A9J4      IDFKKYFF----L----FLSNWYWFVLAVFFTI-GAAWVY-HRFTNPLYAVSASLLINED
A0A5M4B1C7      IDFRKYFS----I----YRSYWYVFALTAGIAL-ITAWFY-HKLTNPQYAVSASLLVNES
A0A0D3LFR6      IDFDKLFS----V----LKKSLPIIVVIFLVCN-MGAYLY-IRYTKPLFQSNSELQLTEN
M7N6D4          IDFDKLYN----V----MKKSLPIIIVIFLVCN-LSAYLY-LRYTKPLYRSDSELQLGVN
A0A4D7K1D4      MDWEKLAS----I----SRKSIPFIILIFALTI-SAAIFY-VRYIPPLFESSSELKLDVK
A0A5C7MX19      ----------------------LWIIVLTIITI-IISLVY-LRYAPKIYESNATMLFSTE
A0A1Q3ZMZ7      -----------------------------------MGYIY-LRYTKSVYESSAIIQIQDN
A0A2D8JJW3      FSIYDFLY----F----LKRNYIYILIITLFCF-LVGCFL-TLRIKPIYSSYAEIEIVKD
A0A2W2AFF7      LNVHKLIG----I----VMSHWVWFAVSLFLTL-ILSFVL-LRYSTPAYKINATVLINDD
R7PCR1          INFQQIIGICIVI----LQKHWMWFLTSVVLFV-VLAFVY-SRTQPQVYQRTAVLEIEDN
A0A2N5YXE2      FDPRTFFT----I----FKKNFWLILIIFVVSL-AAGYAY-FRYTRPVYKTTTVLQIKNE
A0A1G9E2A9      IDWPKLLS----I----VNRSIVWVLLFVALGV-LAAWIS-LRYIKPVYESASLLKLEVK
A0A098LL25      FDFAKLLV----I----ANKSLVWVILLVVLSI-TGAFLY-VRYTKPVYESSSILKLDLK
A0A6C0GJI1      LDLIRLYH----I----LKRNIFWLILIPMISL-LGGYLY-LRYTKPLYESSSSIKLEVK
A0A2T2YJE8      IDFIMLLS----I----IRKSLIWVSLLIVLGL-IGAFLF-LRYTKPLFKSSSTLKIDEQ
A0A127B287      IDLVTLWH----V----VRRSIPWVILLVLLGL-TGSYLF-LRYTKKVYESSSVIKLEEQ
A0A3M9N829      IDFVTLLD----V----VKRSILWVVLLILLGG-AGAYLY-LRYTKKVYESSSTIKLDEQ
A0A0P0CSF9      IDFVTLLH----V----AKRSIPWIILLVLLGI-GGSYLY-LRYTKKVYESSSTIKLDEQ
A0A5M8QQB8      IDFVTLLH----V----VKRSIPWVLLLILLGA-GGSYLY-LRYTKKVYESSSTLKLDEQ
A0A3M9MNC3      IDFVTLLH----V----VRRSIPWVLLLVLLGV-SASYVY-LRYTKKVYESSSTIKLDEQ
A0A5B6TAX2      IDFVTLLH----V----VRRSIPWVLLLVLLGG-SASYLY-LRYTKKVYESSSTIKLDEQ
A0A5N1IQ33      LDLATLLM----V----TRRSLPWMVFLILLGV-TAAWLY-LRYTPPIYQSSSTLKIDQK
A0A512AYT3      VDFVILLA----V----ARKSLIWVVLLIMLGL-AASYLF-LRYTKPVYKSSSIIKIDEQ
A0A5M6CYN7      VDFVTLLA----V----ARKSLVWVILLILLGL-TASYLF-LRYTKPIYKSSSIIKIDEQ
A0A369QP10      IDFIMLLS----L----VRKSLIWVALLIVLGL-IGSFLF-LRYTKPLYKSSSTLKIDEQ
A0A126PDF2      LDLSTLAL----V----ARRSLLWLLLLLALGG-SAAWLY-LRYTKPVYKSTSLLKIDQR
A0A2Z3GKA1      LDLSTLAL----V----ARRSLLWLLLLLALGG-SAAWLY-LRYTKPVYKSTSLLKIDQR
A0A502GZP7      LDLSTLAL----V----ARRSLLWVLLLLVLGG-SASWLY-LRYTKPVYKSTSLLKIDQR
A0A519SBU8      FDIGTLVM----V----ARRSLVWVALLLALGF-TASWLF-LRYTKPVYKSASLLKLDEH
A0A4Q3JNZ3      LDLNTLVM----V----ARRSLVWVALLLALGF-TSSWLF-LRYTKPVYKAASLLKLDEH
A0A519Q9V3      LDLNTLVL----V----ARQSLVWVVLLLALGF-TGAWLF-LRYTKPIYKAASILKLDER
A0A0M3RW20      LDLSTLVM----V----VRKSLPWMLLFILLGL-LTSWTY-LRYTKPVYKSSSILKIDEK
A0A495VFX4      LDVSTLVM----V----VRKSLPWMILFILLGL-LTSWTY-LRYTRPLYKSSSILKIDEK
A0A1S9B3W0      LDLPLLLS----V----TRRSLPWMILLILLGL-GASWTY-LRYTKPIYQSSSTIKIDEK
A0A1W1VRL3      LDITTLLQ----V----ARKSLPWIALLIALGL-TSSWLF-LRYTKPVYQSSSVLKIDEK
A0A1M6R305      LDFDTLLM----V----VRRSLIWLLLLIGLGI-TGSWLF-LRYTKPVYKSSSLLKIDEK
A0A4Z0PHK3      IDITTLLL----V----ARRSLLWIVLLIALGL-SASWLL-LRYTKPVYKSSSLLKIDEK
A0A2M9B9H9      LDLTTLLL----V----ARRSILWIILLIALGL-SASWLL-LRYTKPVYKSSSLLKIDEK
A0A4Z0QCY9      LDIATLLL----V----ARRSLLWIVLLIALGL-SASWLL-LRYTKPVYKSSSLLKIDEK
A0A418R9X5      LDLTTLLM----V----ARRSLPWMVLLIMIGL-TASWLF-LRYTPPVYRASSTLKIDEK
A0A428JSJ3      LDLSTLLM----V----ARKSLPWMLLLIALGV-TASWLF-LRYTPPLYKASSTLKIDEK
A0A428KI59      LDLTTLLM----V----ARKSLPWMLLLIALGV-TASWLF-LRYTPPLYKASSTLKIDEK
W8F1I6          LDLTTLLM----V----ARKSLPWMLLLIVLGV-TASWLF-LRYTPPLYKAASTLKIDEK
A0A246FQC0      LDLTTLLM----V----VRKSLPWMVLLIALGL-TASWLF-LRYTPPLYKSTSALKIDEK
A0A372E5P8      LDLTTLLT----V----ARRSLPWIILLVALGL-TAAWLF-LRYTPPLYKSSSTLKIDEK
A0A1H3EMW1      LDLTTLLA----V----ARKSLPWMVLLIGLGL-TAAWLF-LRYTPPLYKSTSTLKIDEK
A0A1H9ZSN3      LDLTTLLT----V----ARRSLPWMVLLVVLGL-TASWLF-LRYTPPLYKSTSTLKIDEK
A0A5N1J2M4      FDLVTLVQ----V----TRKSLVWVLLLIMLGL-FGAYMV-IRYTPKLYDSTSLIKIDEK
A0A519S476      -------M----V----ARRSLIWVVLLLALGF-TSSWLF-LRYTKPVYQSASLLKLDEK
A0A4Q3JRW8      LDLNTLVM----V----ARRSLVWMLLLLALGF-TASWLI-LRYTKPIYKAASVIKLDER
A0A519M923      LDLNTLVL----V----ARRSLVWVVLLLALGF-TASWLF-LRYTKPVYRAASLLKLDER
A0A4Z0ENW1      FDLSTLVL----V----ARRSLLWVIVLLALGI-TASWLY-LRYTKPIYEATSILKIDDR
A0A519UDB4      FDISTLVL----A----VRRSLPWAALLILLGL-TSSWLY-LRYTKPIYRASSILKIDER
A0A3S0QKV1      LDLPLLLS----V----TRRSLPWMLLLLLLGL-AASWTY-LRYTKPVYQSSSTIKIDEK
A0A328BL48      LDLPLLLS----V----ARRSLPWMILLVLIGL-AASWSY-LRYTKPLYRSSSTIKIDEK
A0A5R8WLY4      LDLPLLLS----V----ARRSLPWMILLVLIGL-AASWSY-LRYTKPLYRSSSTIKIDEK
A0A1I5WSL8      LDISTLVL----V----ARRSLLWLILLIALGL-TASWLY-LRYTKPVYKSQSLLKIDER
A0A0U3JVM7      LDIATLVL----V----ARRSLLWMLLLVGLGV-TASWLY-LRYTKPVYKSASLLKIDER
A0A1G1SSV2      LDITTLVL----V----ARRSLLWMLLLIMLGT-TASWLY-LRYTKPVYKSASLLKIDER
A0A1G1SXV7      LDITTLVL----V----ARRSLLWMLLLITLGL-TASWLY-LRYTKPVYKSASLLKIDER
A0A6G8CBJ6      LDLTTLLQ----V----ARKSLPWIALLIALGL-TGAWLF-LRYTKPVYQSSSVIKIDER
A0A0W8EDI5      FDVATLLM----V----TRRSLPWMVLLIALGL-TAAWLY-LRYTQPVYQSASTLKIDQK
A0A3B7RBP8      FDISTLLM----V----VRRSLPWMILLVLLGV-TAAWLY-LRYTQPIYQSSSTLKIDQK
A0A3R9P8H7      IDFTTLLT----V----ARKSLPWMLLLIALGL-TAAWLF-LRYTPPLYQSSSTLKIDEK
A0A238WIA7      LDLTTLIM----V----ARKSLPWVLLLVMLGL-LTSWLF-LRYTRPVYQSSSVLKIDEK
A0A212UCJ7      LDLTTLLM----V----ARKSLPWVLLLISLGL-LASWLF-LRYTSPVYQSSSTLKIDEK
A0A4Z0MQE1      LDLTTLVM----V----ARKSLPWVLLLVILGL-LSSWLF-LRYTSPVYQSTSLLKIDEK
A0A4Z0PCF4      LDLTTLVM----V----ARKSLPWVLLLVILGL-LSSWLF-LRYTSPVYQSSSVLKIDEK
A0A5D6VDG1      IDTTTLLM----V----ARRSLPWMMLLILLGL-AAAWTF-LRYTKPLYKSSSTLKIDEK
A0A6H1CVS0      IDTTTLLM----V----ARRSLPWMVLLILLGI-TAAWTF-LRYTKPLYKSSSTLKIDEK
A0A243WHR7      LDLVTLLL----V----ARRSLIWVVLLIVLGL-TGSWLY-LRYTKPVYQSLSILKIDEK
A0A5B8A0P6      FDITTLLT----V----ARKSLPWIVLLIALGL-TGSWLF-LRYTKPVYKSSSLLKIDER
A0A076HRT9      LDFDTLLM----V----VRRSLLWLLLLIGLGL-TGSWLF-LRYTKPVYKSSSLLKIDEK
A0A4Z0PVM7      LDIATLLL----V----ARRSLLWIILLIALGL-SASWLM-LRYTKPVFKSSSLLKIDEK
A0A1M6DHW8      LDIATLLL----V----ARRSLIWIVLLIALGL-TASWLF-LRYTKPIYKSTSLLKIDEK
A0A4Q5LC61      FDIATLLL----V----ARRSLIWIVLLIALGL-TASWLF-LRYTKPVYKSTSLLKIDEK
A0A2U1FKU2      FSVEEFLF----S----LLSSWKWIVGSVVACA-LIAYIY-VQNQSPVYHAQATVLIKSA
A0A0A2F954      FSLEEFFL----G----LLTSWKWIVASVLACL-LIAYIY-IQRQSPIYHAQATVLIKSA
A0A0A2FW91      FSLEEFFL----G----LLTSWKWIVASVLACL-LIAYIY-IQRQSPIYHAQATVLIKSA
A0A2D2N2N1      FSLEEFFL----S----LLTSWKWIVASVLACL-LIAYIY-IQRQSPIYHAQATVLIKSA
Q7MWZ2          FSLEEFFL----S----LLTSWKWIVASVLACL-LIAYIY-IQRQSPIYHAQATVLIKSA
T2NDT6          FSLEEFFL----S----LLTSWKWIVASVLACL-LIAYIY-IQRQSPIYHAQATVLIKSA
W1R7P9          FSLEEFFL----S----LLTSWKWIVASVLACL-LIAYIY-IQRQSPIYHAQATVLIKSA
A0A1R4AFZ0      FSLEEFFL----S----LLTSWKWIVASVLACL-LIAYIY-IQRQSPIYHAQATVLIKSA
A0A1R4DVZ7      FSLEEFFL----S----LLTSWKWIVASVLACL-LIAYIY-IQRQSPIYHAQATVLIKSA
A0A2A8CVM9      IDVAEILD----M----LRRGKWIIAATTIVVV-ALVGAY-TYTVDPVYEAKSIVKIDLG
A0A5M4B212      RNYRKYLF----L----LLSHWYWFAIAIVLTS-IGTWLY-YRYAHPTYAVSATMLIHEQ
A0A3D1KEX9      MDIFSILRICVAV----FLRNWKWFLLSVVACL-LFALLF-VKKQPRVYSRQSTLLIENN
A0A358Y7S2      FNPLILEE----I----LKRHWRAPIFYSTIFL-IFAYLY-IRYSVPIYQTKALVQVVEE
A0A1X7J248      VDFFKLKT----I----LKKNLPWAILLIIIAV-FVAFLY-VRYTNVKFQSYAELKLNKR
E4TQD2          VDFYKLKT----I----LKKNLPWAILLIAIAV-FVAFIY-VRYTNVKFQSYAELKLNKR
A0A2J6HHN3      FDFKLFLY----I----AKRNLKRIILFFIVLF-LFLFLY-LRYTQPIYESSTIVQLNSD
A0A1Y3WMT8      VDVLALWR----A----ARKRWYLFAGSVFICV-VLVACY-LKIAKPQYAISADILVNED
A0A1Y4GQU1      VDVVALWR----A----ICRKWYLFVGSVVVCV-ALVACY-LKIAKPQYEVLADILVNED
A0A6A0R272      LELANFIN----Q----VKLKLPWLLLFLFIGL-SSGYLV-SKYKKQVFSAKATIKIDDK
A0A1V5W8T5      FDVSKLIH----I----LRQNFIFYIIFGLIAG-ISAFTY-LRYTPPIFDAYTVIQINEE
A0A2T8HKA9      INVLDLLK----Y----LFVHWKWFLLSVLFFG-GYYYYQ-YSKTPFVYSKAAILMIKTP
A0A2I0QZ80      FDTNILKI----V----IKRNWYWCVLIFSLFI-VLGFLY-LRYTKPVYESRMLIQINSE
A0A3E1F1A3      LDFKVLKI----V----IKRNWYWCVLISLILG-ILAFSY-VRYTKPIYESKMLIQINSE
A0A2U2XBJ3      FDLKVLKI----V----IKRNWYWCALISILLV-VSAFIY-VRYTKPVYESSMLIQLNSE
A0A4Q4KU94      FDLKVLKI----V----IKRNWYWCAIISILFF-VFAFIY-VRYTKPVYESKMLIQLNSE
A0A3B8INU3      IDTEKIAS----V----LRRSIVWVVLIIVGAV-ASAYLV-VRYTKPLYESVSDIKLNFK
A0A2W1NDY9      IDIDILKT----V----FKKNWIWLLLCVIIGV-SIAFVY-LRYTKPIYESRAIIQRSLK
A0A5C8AQR5      YNPHILSS----V----LRRNWYWPLAFIFLFF-CFAFLY-LRYTKAIYSSNTLIQIENK
A0A1G0CI31      YNPLIAAT----I----VKRYWWWTLLFVTCFT-AIAFVY-LRYTKPIYDSSMVIQLGEK
A0A556N0M0      YNPIIVNV----V----LRRYWWWVLLLILFFL-GVAFFY-LRYTKPVYDSTMVIQLVEK
F2IKD6          YNPIIAQV----I----LRRYWWWVLLLIIFFM-SVAFFY-LRYTKPVYDSTTLIQLVEK
A0A1I7BM74      FDLDIIRN----V----LKKNFLFALLIIAFFG-ALSFLY-LRYTKPVYQSQMVIQIDNE
A0A2G2FJ17      FDTDILRI----V----IRKNWIWLMLIATILL-SSAFLY-LRYTKPVYESKMLIQISNE
A0A2E3R1D0      IDLRALLD----I----LLRGKWIILGAVLALT-IPVMVY-SMLSPSKYRSYAILLVDKT
A0A2T2USC0      ITLQEIIG----M----LWGGKWVILATFVVVV-ALGAAY-TFTQTPIYESSNLVLVEKQ
A0A2T2V0F3      ITLQELVG----M----LWGGKWVILATFAVVL-ALGAAY-TFSQTPIYETSSLVLVEKQ
A0A2T2S682      -RLRALLS----T----LWGGKWILLTVFVLVV-GTVAVY-TYTRTPQYKTSTLLLVDLG
D5H561          GQIEELLD----L----LRRRKWLIVLVCLATV-AGAALY-TYTQVPVYRTSSLVLVEKG
A0A2H3NWA9      -QLREMAG----L----LWAHKWIILGVFVVVM-AAAGVY-TYTLPNQYQTSSLLLIKPD
A0A2A8CVB6      -QLHELLG----T----LWRGKWIILGVLIVVL-AAGTAY-TLSIPTTYRTSSLLLVDKQ
A0A2P6C1S6      -QLHDLIQ----T----LWEGKWIILGVVTAVV-LAAAAY-MYTIPTTYRTSSLLLVDRN
A0A2T2UTM4      -QLHDLIQ----M----LWDRKWIILGIVAVAV-LSAAVY-TYTIPATYRTSSLLLVDRE
A0A414ZBF2      TVMADMIG----V----LAHHRKWFILSVAVCL-LVGFIY-VRSTPKTFSRTATILVKDE
A0A1Q3Q573      FNLGLLIY----I----LNKSILWIILIVAITV-FASFIY-LRYTPRIYEATTKMILQLE
A0A662BAY3      YEIKKILK----R----LLSYWYWFLICIILAV-SIAYVY-NRYATPIYEITSSLLLEVG
A0A4U3L369      FDIKKVIG----N----IIANWYYFVLGLVLML-VLAFLY-VRYTEPVYQVNAGIMVEDQ
A0A357YNR3      VDVLSILM----K----YLIHWKWFLVSIFICI-FLAVVY-VYFTLPKYMIQTSILFNDD
A0A5E8AX52      LDVEKLLQ----V----VRSSILYVVAIFAVAG-TASYAF-LRYTKPVYESESQLKLNIQ
F4KK08          FSLRDILM----I----LKANWLFILLSFLVCL-ALGFLY-IKSSSHQYSRSASLLIKSE
A0A6B5PK86      YDSLLFRT----V----LRRFWWLVPIFMAFFF-FVAIIY-LRYTKPVYESQLILQIENE
A0A2G2F510      YDPLILRT----I----LKRYWWWPLTFILLFS-ALAFTY-LRYTKPVYESAMILQLSEK
A0A316JZ08      YDPLILRT----I----VRRYWLWVLGFVGIFV-VLAYFY-LRYTKPVYESSLMLQISNQ
A0A496LCF9      FNILEWIM----R----FIKYWYLFVISVLIFM-AVAYYQ-NRSFVPTYNSTLRMLLKQE
A0A5P2G2A9      IDFEKILA----D----IIDHWKWFVIGVVLMI-ILGLLY-IQHSAPRYNVNATVMVDDD
A0A3C0ZQC7      PTFQDYVQ----I----VLRGKWMILASFLLVL-AGTAVF-TFTTSPVYESTATVLVDTK
A0A419VXB7      QNIKDFLF----K----LLYHWKWFVLTVVVGV-GIAFVF-NRYTPATYRVKSLLFIKDK
A0A0B0BTJ4      ITLRDIFD----F----IVFNWYWFALSAIAFA-GIGIVY-ALSRPDVYRSSAMVLIDEQ
A0A3B9CNN6      ITLRDIFD----F----IVFNWYWFALSAIAFA-GIGIVY-ALSRPDVYRSSAMVLIDEQ
R5X290          ITLRDIFD----F----IVFNWYWFALSAIAFA-GIGIVY-ALSRPDVYRSSAMVLIDEQ
A0A1Q6E6I7      ITLRDIFD----F----IVFNWYWFALSAIAFA-GIGIVY-ALSRPDVYRSSAMVLIDEQ
C3J7R8          ITLSDIGL----I----LRSNWYWFAITLCVAI-GGASAY-LLHTPNVYKREASILVKDK
A0A1G8BVM8      TAIADLLG----I----LWRNRFWFALSIIIAV-SIAVFY-VRSTPKTYSRTATILIKDD
A0A1I1FXP9      INSDKLLS----I----LNKSLWWIIMFVVVAT-LGAYTY-VRYTRPTYEAYSVLKLDIK
A0A3N4H5N3      IDLSVVFK----S----LVKHWYLFIICVIIFL-GLAFLY-LRIATPVYEISGSVIIKEG
A0A2P8EAX2      IDLFKSVR----L----LLPYWPYIIASILLFV-GLSFLY-LKSATPFYEITSSVLIREG
A0A4V2F6N9      IDLMRSVK----V----VLPFWPYILASILLFV-GLSFLY-LKSATPYYEITSSVLIREG
A0A3B9FXJ0      VDLQLLLL----F----TWKNRYIILLIMMLSL-LAGYMV-NKYSVPRYSAKSVVQFKEF
R5GSU5          IDWLSIVRACTGT----LRRQWRWFVFSIIVCG-CLAFLY-ERKQPRVYQRQAVIEIEGA
A0A2A3UE91      FDIGVIAF----L----FMKSRIYIVLFFVISF-SLAFLY-LRYSQPIYESRAIIQINDA
A0A0A2G557      ISLSDIFY----L----LRQNWYYFIACLLIAL-ICGYVY-IKSTPNSYERTASVLVNTK
A0A2N2WFW8      FDFKLFLF----I----ARRNLKFILVFFALLF-ALIFMY-LRYTLPVYEASSVVQINSD
A0A1F3IU95      FDFKLFLN----I----TRKSLIYIIVFSALLF-TAVYVY-LRYTQPVYESACIVQINTD
A0A3D0VUF6      FDFKLFLN----I----TRKSLIYIIVFSALLF-TAVYVY-LRYTQPVYESACIVQINTD
A0A1T4PT95      ISLSDIFY----L----LQQNWYYFIFWLIIAL-AGGYIY-IKSTPNSYEKTASVLINTE
A0A6I6JYY3      IDLKKLVF----K----LLSNWYWFILCIVVAV-GAAFLY-NRYATPVYELSTTVLVEED
A0A2A4PYG9      FDLGVFIG----I----LKKQFKWIVLFFLLAG-IGAFLY-LRYTPLLFEASALLQMTSQ
A0A1F3K695      FDLGLFLF----V----FRKSILLIGIFLFLIV-AVMYAY-LRYTPPLYRASSVIQINDQ
A0A353KZR1      FDLGLFLF----V----FRKSILLIGIFLFLIV-AVMYAY-LRYTPPLYRASSVIQINDQ
A0A2N2WYB5      FDFAIFMQ----I----LKKSLWVSIVLILLSF-FAAFLY-LRYTQPLYSTQTIIQINEN
A0A1F3K4G0      FDLAIFLQ----I----VRKNYWAPILFVAVSF-VASFLY-LRYTQPVYQTQSIIQINET
A0A356H8Y3      FDLAIFLQ----I----VRKNYWAPILFVAVSF-VASFLY-LRYTQPVYQTQSIIQINET
A0A351HSA6      FDLAIFLQ----I----VRKNYWAPILFVAVSF-VASFLY-LRYTQPVYQTQSIIQINET
A0A1F3Q014      FELGLFIF----I----ARKSFFWIILFFILAF-LGASAY-LRYTTPIFESSSVLQIETT
A0A2A4YXP3      SDPILFFH----L----LKRNLLLFAVIIICCL-LVSLVY-LRYTAPVYEAKLVYQVNSL
A0A2D5KD44      FDLGLFLY----I----IKKNLLWVMLTIGMSI-LGSFLY-IRYTAPVYRASADIQIEKS
A0A1F3R158      LDIILLLQ----I----FKKNLLLFIAIIITTS-IVAFIY-LRYTVPLYQSQLVLQVGSK
A0A2M8ADX2      LDIILLLQ----I----FKRNLFLFAAIILACA-VISFIY-LRYTIPLYQSQLVLQVGSK
A0A1J5B2H0      IDPKLFLF----L----VKRNLLLFAILFIMAI-AGSYIY-LRYTPPIYETHSIIQLSSD
A0A1V5N756      FDLKLLLS----I----VKKNIPYVLIIFAFFF-TLAFLY-LRYTYPKYETSGTIQIYTE
A0A651GU15      FELGLFLY----I----ARKSLKWIALLAVFTF-TFAYLY-LRYNAPVYQASTIIQLSKS
A0A3Q9FR88      IDFDKLEF----V----IKKKFIWVILILMMAG-ICAFLY-IRWTPRIYEASTLNQIKLT
A0A553GEX3      IDFDKLEF----V----IKKKFIWVILILMMAG-MCAFLY-IRWTPRIYEASTLNQIKLT
A0A150ADJ9      IDFDKLEY----V----VKKNIVWVLLLISLTT-ICAYLY-IRWSPRIYEATTLNQIKLT
A0A1B1FWQ4      IDFDKLEF----V----VKKNIIWVILLLILSG-VAAYLY-IRWTPEIYQANTLNQVKLT
A0A1S1Z228      IDFDKLEY----V----VKKNIIWVILLLMLSG-IAAYLY-IRWTPEIYQAHTLNQVKLT
A1ZKR2          LDLEKVWE----I----FRKSIIWMLLLPLFTI-SIGHLW-LRYTKPVYKSSSTLKLAIK
A0A1Q3GX01      IDLEKIWE----I----LKKSILWMLLLPLLTL-SVAHIW-LRYTKPIYESSSNLKLAIK
A0A349DQI4      IDLEKIWE----I----LKKSILWMLILPLLTL-SVAHIW-LRYTKPVYESSSSLKLAIK
A0A4P5TMD1      FNPGLLMI----I----TRKSLIWCILIVLLTV-STSILY-LRYTTPLYEVTAQIMIKQV
A0A2N3IIZ0      IDFAKILY----I----LRKNWYWLIVFPLLSV-SLAYLY-LRYTKPIFQSTANLKMEFK
A0A1F3SJM1      YDPLILRT----I----LRRYWWWPLTFVFIFG-LLAFSY-LRYTKPIYESSMILQLSDK
A0A2G2EB96      YDPLILRT----V----LKRYWWWAALLVMAFA-SFAYIY-LRYTKPTFESSMVLQLGDQ
A0A2G6PRA9      YDPLILRT----V----LRRYWWWAALLVLTFA-ACAWVY-LRYTKPTYESSMVLQLGDK
A0A497D5Z2      MDVRRLVI----S----VLRNWYWFILAVVVAL-AIAFLY-NRYTTPLYKICSSILIEEK
A0A662B170      MDVRRLAI----S----VLRNWYWFILAVVVAL-AIAFVY-NRYTTPLYKICSSILIEEK
A0A2A5FYT6      FDFGLLLY----I----TQRNIFWIIAILIVAG-TAAYFY-IRYTPPIYESIGIIQVRTD
A0A2E6SYP1      FDLGLALL----I----IRRNLFLTILLILMGA-GFAFFV-NRYTTPTYYASSVVKISEK
A0A2E5RLE8      FDLGLAIL----I----IRKNLISILFSISIGF-CVAFFI-NRYTTPQYSASSIVKISEK
A0A2E7TQF6      FDLGLAIL----I----IRKNLISILFSISIGF-CVAFFI-NRYTTPQYSASSIVKISEK
A0A2E6GVY9      FDLSLAIL----I----IRKNLLFIVLSIFLGF-CIAFFI-NRYTTPQYYSSSIVKISEK
A0A350JJ90      FDLGLLLM----I----TSKSLIWIVSIILLLG-GLAFTY-VYYTQPKYESTSIIQIINE
A0A3M1CDV2      LDIGLLID----I----TLKSKWWYVLFFSIAG-ISVFLY-LRYSERIYSSQSIIQIVNS
A0A6C1QGZ7      IDIKLFLY----I----AKKNILFPIIFILIAV-AGAWIY-LRYTPPVFQTSAIIQMEGQ
A0A4P5U6G4      FNPGLLFI----I----IKKSFIWCVLIVLITM-SSSLLY-LRYTPPLYEVGSTLMIKPE
A0A2E2TFD1      FEIGLFIH----L----IQKSFIWILLFVSLAF-GGAYLY-LRYYQPMYQSTSILQLKES
A0A2E4ELE6      FEIGLFVH----L----AQKSLLFVLAFFVIAF-ISSSLY-LRYTQPIYSSSSILQLKEQ
A0A522EYA6      FEIGLFIF----L----IKKSFLWIILFFSVSF-AAAFIF-LRYTPEVFESRTILQVNND
A0A2E3XZI5      FELGLFLY----L----INKIKWVLITILIIFL-LGSRIY-LRYKPEIYKTETRLQLAVK
A0A6I7QXV0      FNLSLLVS----I----IRKTFGWFLLILFITV-LSVWLF-LRYTQPIYETSSEIIQKTE
A0A2M7NLQ9      FDVSKLIR----V----VKKKLIYVIFLLIICV-VASWIV-LRYTKRVYSSSSTLKLEMK
I4AFR0          FDVSKLIR----V----VKKNIIYVILLLIICV-AASWVV-LRYTHRIYNSSSTLKLEMK
A0A2N2Y3E5      FDIPLFLL----V----FRKSLLYFTIIAVLCG-AGAYAY-LRYTQPLFQASAIIQLKDE
A0A2D9D7T6      YNPLILGE----I----LRKHWFAPILFIVFFS-TVAFFY-LRYTKPIFQSKAVIQIVEE
A0A1F3PPL5      FDVRIFTY----I----IKKSMFLVAIIMGISI-VGAFLY-LRYTPPLYQSITVLQISNN
A0A357QK06      FDVRIFTY----I----IKKSMFLVAIIMGISI-VGAFLY-LRYTPPLYQSITVLQISNN
A0A662AEA4      FDLQIFLL----I----LKKNVWLTFLFIILSL-FGTFIF-LRYTPPVYKSVSIIQINNE
A0A0S2HYK8      FDIITFKR----I----LYRSVWIGLFIILLAL-GAGFLK-IRYTAPLYEAKSVIQIQED
A0A2N5ZWN6      FDITTFKR----I----FIRSFWMGIIIMMLVI-GGAFLK-IRYTSPVFEAKSVLQIQED
A0A2E0FJ09      FEIGLFLY----L----TRQIWVWMLLIVIVCF-GLGFLY-IRYTPPQYKAKALIQRTSQ
A0A1F3FZ62      FDLGLLFK----I----IQKTILPIFILFIISS-TIAFLY-LRYTHPVFEASSVIQLSSS
A0A1F3K211      FDLGLLFK----I----IQKTILPIFILFIISS-TIAFLY-LRYTHPVFEASSVIQLSSS
A0A1V6I2U9      FDARTFLI----I----FKKNVWVVILLILISL-GAGFAY-HRYSTPRYKTSTIIQVKNE
A0A2H0B957      FDFNISLQ----V----FKKSIILSVLVFILAA-VGAFVY-LRYTQLIYKSVSIIQLKNE
A0A1F3CFW6      FDVNIFLQ----V----FKRSIILSIIIFFAAI-VGVYVY-LRYTLPIYKSSSIIQLKNE
A0A2M7E2T8      FDVNIFLQ----V----FKRSIILSIIIFFAAI-VGVYVY-LRYTLPIYKSSSIIQLKNE
A0A2M7NC69      FDVNIFLQ----V----FKRSIILSIIIFFAAI-VGVYVY-LRYTLPIYKSSSIIQLKNE
A0A1F3KLL5      FDLPIFLM----I----IRKSIWWIVIIFILAL-FSAFAF-LRYTPPIYQSNSILQINEQ
A0A359D1M1      FDLPIFLM----I----IRKSIWWIVIIFILAL-FSAFAF-LRYTPPIYQSNSILQINEQ
A0A0F2NS19      LDIILLLK----V----FKKTFIYFVGIIAICV-TLSLIY-LRYTVPIYQSKLVLQVGSE
A0A2A5H8X6      LDIILLLK----V----FKKTFIYFVGIIAICV-TLSLIY-LRYTVPIYQSKLVLQVGSE
A0A2H0GAU8      LDIILLLK----I----FKRNLFLFIAIITICV-VVSFVY-LRYTIPIYQSQLVLQVGSE
A0A2M8FTK1      LDIILLLK----I----FKRNLFLFIAIITICV-VVSFVY-LRYTIPIYQSQLVLQVGSE
A0A2A5B3B0      SDPILFFH----L----LKQNLLSFAIIIAVCL-MGAFIY-LRYTTPIYESVLVYQVSSL
A0A5C6RXM7      SDPILLLH----L----LRSHLKWFFVIILFCL-LSSYLY-LRYTIPVYQSNLIFQVGSL
A0A1F3C1M2      FDIGLFVY----I----VKKSLILIGLLIGIAA-VSVFAY-LRYTLPTYKSSSIIQINTK
A0A1F3DS87      FDFALFIY----I----IKKSAILIGLLIGIAI-FSVFAY-LRYTLPTYKSSSIIQINTK
A0A6A0R6K9      FDIGLFIY----I----TKKNSLWILLTIILMV-LAAFLY-LRYTAPIFSSQSIIQIKKS
A0A2E7CT70      FEIGLFLY----L----LKKSRFTIILILLSAF-SLGFLY-LRYTPKTYQTSATLQINIK
A0A2D5V560      FELGLFLY----L----LNKIKWYAITLIILCI-TSAFIY-IRYTPKTYQTSSIIQVAVK
A0A2D7K5A8      FELGLFLY----L----LNKIKWYSIIIIIISI-SLAFLY-LRYTPKTYQTGALIQVAVK
A0A2E1XQ82      FELGLFLY----L----LNKIKWYAIIILIISI-SLAFLY-LRYTPKTYETGALIQVAVK
A0A5C8A5B4      IDLRAIFG----K----IRSRWWWFLITVPLAL-AVAIAYVKT-TPKKFDVGAVMLLGNK
A0A4Y9ITE2      IDIIELLR----F----YSTKWKAILISVIIFM-ILGGIYAYT-KSPVYEVQANVLITDN
A0A5M8NYX7      GSLADIFF----H----YLNYWKWFVASLFVCL-LISFIYLRY-TTREYSVSSRALIKDE
A0A3D5KRY6      ----FIKA----T----LLKNWYWLAAFSFAGM-VGGYAYNKV-VLPYYRISTTVLVHDE
A0A1V5IPN7      EIKISDYL----R----ILLQYRYLIILIFVVVLAGTIIYTLR-QPRIYSASGRILMENQ
A0A0E3V905      NIRALLS-----K----YSKLWPWFILSTVLML-AIGHIYISN-KQPIYKIQASLLVQDQ
A0A553ETH6      IDLDKAQA----V----LKKNWIWIVIIFVISI-TSAYLVIRW-TKPLYESTSELKLDVE
A0A640Q161      TIDIAHYL----G----IIKRYAFRIVSLAIAFTILVALLVMR-MTPMFTSTTTILVEAD
A0A640QU49      TIDVAHYL----G----IIKRYAFRIVSLAIAFTILVTLLVMR-MTPLYTSTATILVEAE
A0A1Q3PII2      WTANPLWK----T----VRYHWYWFAISPLLSL-LLAWAFLRY-QTPHYTIKASLLVRDD
A0A351BXT2      DNFKIYLN----I----LRMNLIPMTIITLLCI-LLTIVYVMY-AKDIYKSSATIKINRP
A0A2K8Z965      NLRNLIS-----R----YIKRWPWFVVSIGLML-AGAYIYLLD-KQPVYKIQASLLVQDQ
A0A418M8U8      RVSDLLP-----K----FTRNWPWILFSVCVFL-VAAYTYLAY-KQPVYKIQASLLIQDE
I2GTA4          RVSDLLP-----K----FTRNWPWILFSVCVFL-VAAYTYLAY-KQPIYKTQASLLIQDE
A0A2K8ZAJ2      YNLGTLLI----R----YVRNWPWFMLSILLAQ-AAAYIYLLY-QPLVYNVQASVLIKDE
A0A368JPA3      DGQGTLK-----D----YLKHWKWFLISLITLI-VAGFVYIWF-TEPIYRVQASLLVKDE
A0A5N1JI29      DAKGTLK-----D----YLKHWKWFLISLIALI-VAGFVYIWF-TEPIYRVQASLLVKDE
A0A3P1BT12      DVPGTLK-----D----YLKHWKWFLISLITMI-VAGFVYIWF-TEPIYRIQASLLVKDD
A0A3P1CI15      DGKGTLK-----D----YLKHWKWILISLIAML-VAGFVYIWF-TEPIYRIQASLLVKEG
A0A4R8CUK1      SDGRGAWQ----D----YLKQWEWFLLSLITML-VAGFVYIGF-TEPVYRIQASVLVQEE
A0A3D0MYJ7      NDIRFYFF----S----ILKYKYIILITTIVGF-LVAFFFARS-LPNIYQSKVQINVEK-
A0A662AH13      NSLKDYIN----L----IKLNLIPILLITITGL-IVSIIFALM-AKDIYTATVAMKIQK-
A0A5C7QA01      IDLKELFF----S----LIAQWKLIALCVFLSL-VCALLYLRV-TPNTYSVDALIQVEDS
A0A3D3LS70      DNLHLFLN----L----VKSNWILILIVFIISA-VFTGLYVFR-AKDIYKSSTSLLIQK-
A0A1G1TM36      -------------------------MVGVALAL-LAAYAYNQL-AQPTYEVQASILVEEG
A0A1G7ZF38      WTKNPFWK----A----VRYRWYWFLISPLLSV-LLGFTFLRY-KTPHYTITASLLVRDD
C6VS52          WANHPLWK----A----IQFRWYWLVVSPIVSL-LLGTAFLRY-KTPRYQVTASLMVRDD
A0A2A4G4B1      IDLQELLG----F----VLSQWKKMVLGGLIGA-LLAFGYLKT-VNPKFRVETSVLLKSV
A0A0P7X1V8      IDLLQIFG----L-----LWHNKWIIITLTLLG-GVSAYIYAQSQIPIFESNGSLQITEA
A0A5C8KAD6      M-FLDLVY----K----FTPYWPLFLTLLVISC-MAGWAYLNYYATPVYEASASLLIKDE
A0A5N1J695      M-FSSLMF----R----FLPYWPLFAGLLVVSL-FGAWGYLRYLSVPTYEVSASLLIKDE
A0A1H4ADG3      FDFTKIFH----R----IRANW-YYCVICAIVM-VGLAGIYLYVANPTYKAMATVLIKDN
A0A5B8VUR8      FDFTKVIQ----R----IRANW-LYAVLSAILM-VVLAVIYLYVTSPTYKAMATVLIKDN
A0A3N2M1H3      FSIKDYIQ----A----CKSRWQWILLSLIICV-GAGVLYILC-QQPEYQRTEEVLIKDQ
A0A4S2G8T2      FSIKDYIQ----A----CKSRWQWILLSLIICV-GAGVLYILC-QQPEYQRTEEVLIKDQ
A0A1T5K9D4      INLVDIFF----Y----LLNHWYWFVLCIGLAV-AFTSYRYAK-TPFSYRSNATIIIKNP
A0A077ENE7      INLLDILK----Y----LLHHWKWFVLSILIFG-GYYYYQYSK-TPFVYNSSEIVMVKTP
A0A6I5UW06      INLLDILK----Y----LLHHWKWFVLSILIFG-GYYYYQYSK-TPFVYNSSEIVMVKTP
T0NN57          INVLDLLK----Y----LLHHWKWFALSILIFG-GYFYYQYSK-SPFVYSRSEVVMIKTA
X5K347          INVLDLLK----Y----LLHHWKWFALSILIFG-GYFYYQYSK-SPFVYSRSEVVMIKTA
A0A212K7W5      IQIQDLWK----M----SVEKWHWFAISLTICL-IFAFLYIAI-TSPVYTRMAAVLIKDN
F5IU11          IRIQDLWK----M----SVEKWHWFVISLGICL-ISASLYIAI-TPPVYTRMAAVLIKDN
A0A6I1IYY4      ITLRDVVE----L----IIANWYWFAISVIVCV-SAAYLYTRT-LVPVYQRQAVMLVKTG
K0XJ09          VTLRDIVE----L----VFDNWYWIVLSVVICM-SVAWFYLAM-QTPLYKRSAVMLVKSE
R5EUZ0          VTLRDIVE----L----VFDNWYWIVLSVVICM-SVAWFYLAM-QTPLYKRSAVMLVKSE
W0EQS0          ITLRDIVE----L----IFDNWYWIVLSIAVCV-SVAWLYLAM-QTPLYKRTAVMLVKSE
A0A1Y3WE15      ITLRDIVE----L----IFDNWYWIVLSVAVCV-LVAWLYLAK-QTPLYKRSAVMLVKAE
A0A1Y4GUK3      ITLRDIVE----L----IFDNWYWIVLSVAVCV-SVAWFYLAM-QTPLYKRSAVMLVKAE
A0A352Z1R7      AHIYDYLS----V----ILRRRKLFTLAFCAVF-FSVVLYTYL-MKPIYEASSTLHIKKE
A0A3N2N6F7      INISDFLS----L----CVRCWKWFAFSVAACL-IIGALYVLT-SPKIYTRTAQVVVQDD
A0A4P7VVU7      FNLHDFFI----L----CLNKWKWFVISIIIFL-GLGVLYIMS-TPETYTRTASVMINED
A0A2V1ILM4      FNLHDFFI----L----CLNKWKWFVISIIIFL-GLGVLYIMS-TPETYTRTASVMINED
A0A3N2L0E8      FNLHDFFI----L----CLNKWKWFVISIIIFL-GLGVLYIMS-TPETYTRTASVMINED
A0A3N2LFC5      FNLHDFFI----L----CLNKWKWFVISIIIFL-GLGVLYIMS-TPETYTRTASVMINED
A0A0A2F501      LSLRDLWA----M----CWARKFWFVLSLGLFL-GGAILYILI-TPPVYKRTATLLIKDD
R5B7P0          VQIGQLVR----R----CLSRWYWFALSLAVCL-ALGALYILR-STPTYNTSADIQIKSN
R5B0L5          VKISDVIF----I----TLKRWPWILLSLAICV-GCAVLYVLR-TPSMYTRSASIVIKSS
A0A6I1TEC0      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYYLLS-TPNVYQRTASLLIKDE
A0A3R5XWG1      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYYLLS-TPNVYQRTASLLIKDE
A0A646GTR1      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYYLLS-TPNVYQRTASLLIKDE
A0A5P0Y910      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYYLLS-TPNVYQRTASLLIKDE
A0A414YFM3      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYYLLS-TPNVYQRTASLLIKDE
A0A6A7UIA7      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYYLLS-TPNVYQRTASLLIKDE
A0A6A7VPS3      LRLQDLFY----L----CLARWKWFVLSLFVTM-GAAGYYLLS-TPNVYQRTASLLIKDE
A0A374THP7      IRLQDLFY----L----CLAKWRWFILSLAVTL-GIATYYILT-TPNVYQRTASLMIKDD
A0A6G1VND1      IRLQDLFY----L----CLAKWRWFILSLAVTL-GIATYYILT-TPNVYQRTASLMIKDD
A0A0A2EVS5      FSLKEIFR----L----CLIRWKWILLSLLITV-GAATAYLMI-TPVEYKRSASILIKES
A0A1T4NAJ7      FSLKEIFR----L----CLIRWKWILLSLLITV-GAATAYLMI-TPVEYKRSASILIKES
A0A255T941      LRLQDLWG----L----CLPRWRWFVLSVLICA-SAAVLYLLR-TPNIYTRTASILIKED
A0A3N2KCL3      VPLTDILY----R----TLHHWPWVLLSLVVCV-GAAVVYLLC-TPKVYTTTASIMIKDE
A0A4P7VSV0      VPLTDILY----R----TLHHWPWVLLSLVVCV-GAAVVYLLC-TPKVYTTTASIMIKDE
A0A2V1IJY1      VPLTDILY----R----TLHHWPWVLLSLVVCV-GAAVVYLLC-TPKVYTTTASIMIKDE
A0A4P7VXK7      VPLTDILY----R----TLHHWPWVLLSLVVCV-GAAVVYLLC-TPKVYTTTASIMIKDE
A0A1Y4CHN5      ISIQDFLY----M----CLSKWYWFAISLVVLI-ALALIYIMR-TPPEYTRSASMLIKEE
A0A1M6I2S6      IRIQDLWG----M----FVPRWHWFALSLFAAL-AIAAFYLLS-TPNIYTRTAAILVKDD
A0A1Y3V692      IRIQDLWG----M----FVPRWHWFALSLFAAL-AVAAFYLLS-TPNIYTRTAAILVKDD
F3PXM2          IRIQDLGS----M----FVPRWRWFALSLAVAL-SAAALYLLR-TPAIYTRHAAILVKDD
A0A3E4ZNL4      IRIQDLWG----I----FVPKWYWFAISLFITL-VCASLYLLS-TPNIYTRTAAVLIKDD
A0A174AHH7      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLYLLS-TPNIYTRTAVILIKDD
A0A174JCE8      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLYLLS-TPNIYTRTAVILIKDD
A0A3E4JMC4      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLYLLS-TPNIYTRTAVILIKDD
A0A412SND6      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLYLLS-TPNIYTRTAVILIKDD
A0A414IEQ9      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLYLLS-TPNIYTRTAVILIKDD
A0A415UKN5      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLYLLS-TPNIYTRTAVILIKDD
A0A6I0U0V8      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLYLLS-TPNIYTRTAVILIKDD
A0A6I2PDH7      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLYLLS-TPNIYTRTAVILIKDD
A0A0M1W8D8      IRIQDLWG----M----FIPKWYWFALSLFVAL-ATASLYLLS-TPNIYTRTAVILIKDD
A0A3R6GKX5      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A7V4S1          IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
B0NU19          IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
D4V601          IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A0A4Q0U3M9      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A0A4R4H1Q2      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A0A6I0GII7      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A0A6I0KYU7      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A0A397WLT5      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A6KY94          IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLYLLS-TPNVYTRTAAILVKDD
A0A173UQR8      IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLYLLS-TPNVYTRTAAILVKDD
A0A3R6HK75      IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLYLLS-TPNVYTRTAAILVKDD
A0A412B7D1      IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLYLLS-TPNVYTRTAAILVKDD
A0A412VNY9      IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLYLLS-TPNVYTRTAAILVKDD
A0A414LTU9      IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLYLLS-TPNVYTRTAAILVKDD
I9Q4U4          IRLQDLWG----M----FFQKWYWFALSLFVAL-ATASLYLLS-TPNVYTRTAAILVKDD
A0A6A2J529      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A0A3R6GM96      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A0A015XH67      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A0A078RZN2      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A0A4R4I3T9      IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A6L0K5          IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A7ACT5          IRIQDLWG----M----FIPKWYWFATSLFVAL-ATASLYLLS-TPNVYTRTAAILIKDD
A0A373ISF0      IRIQDLWG----L----FVPKWHWFVLSLFVTM-SVAVLRLMS-TPSIYTRSAAILVKDD
U6RF62          IRIQDLWG----L----FVPKWRWFVLSLFVTM-SVAVLRLMS-TPSIYTRSAAILVKDD
A0A662ZZD5      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALYLLG-TPNIYTRTAAILVKDD
A0A3A5TI83      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALYLLG-TPNIYTRTAAILVKDD
A0A415NEB6      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALYLLG-TPNIYTRTAAILVKDD
A0A6I0I238      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALYLLG-TPNIYTRTAAILVKDD
A7AJ60          IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALYLLG-TPNIYTRTAAILVKDD
A0A6A2JF01      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALYLLG-TPNIYTRTAAILVKDD
A0A6I0Y2Y2      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALYLLG-TPNIYTRTAAILVKDD
A0A6I2Q447      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALYLLG-TPNIYTRTAAILVKDD
A0A395YYT3      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALYLLG-TPNIYTRTAAILVKDD
A0A015UXN7      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALYLLG-TPNIYTRTAAILVKDD
A0A5M5W148      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALYLLG-TPNIYTRTAAILVKDD
A0A6I2NTL0      IRIQDLWG----I----FMPRWHWFALSLFVTL-ATAALYLLG-TPNIYTRTAAILVKDD
A0A016E4F9      IRIQDLWG----M----FVPRWHWFVLSLFAAL-AVATFYLLS-TPNIYTRTAAILVKDD
A0A4Q5CFJ7      IRIQDLWG----M----FVPRWHWFALSLFAAL-AVATFYLLS-TPNIYTRTAAILVKDD
A0A6H9P0U9      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLYLLS-TPPIYTRTAAILVKDN
A0A108TH71      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLYLLS-TPPIYTRTAAILVKDN
I8VXH0          IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLYLLS-TPPIYTRTAAILVKDN
A0A412S0N6      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLYLLS-TPPIYTRTAAILVKDN
A0A412IIJ0      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLYLLS-TPPIYTRTAAILVKDN
A0A0P0FM97      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLYLLS-TPPIYTRTAAILVKDN
R6KTP3          IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLYLLS-TPPIYTRTAAILVKDN
A0A139LU87      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLYLLS-TPPIYTRTAAILVKDN
A0A1C6B3Y5      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLYLLS-TPPIYTRTAAILVKDN
E2NMQ4          IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLYLLS-TPPIYTRTAAILVKDN
A0A412YDB9      IRIQDLWS----M----FVPKWYWFAVCLFITL-AIAVLYLLS-TPPIYTRTAAILVKDN
R7DY01          IRIQDLWS----M----FVPKWYWFAVCLFITL-AIAVLYLLS-TPPIYTRTAAILVKDN
A0A414LGK8      IRIQDLWS----M----FVPKWYWFAVCLFITL-AIAVLYLLS-TPPIYTRTAAILVKDN
A0A415IPQ4      IRIQDLWS----M----FVPKWYWFAISLFITL-TIAVLYLLS-TPPIYTRTAAILVKDN
A0A3E5BRW7      IRIQDLWG----M----FVPKWHWFAGSLLITL-AIAVLYLLS-TPPIYTRTAAILVKDN
K9DXS6          IRIQDLWG----M----FVPKWHWFAGSLLITL-AIAVLYLLS-TPPIYTRTAAILVKDN
A0A1M6KFV3      IRIQDLWG----M----FVPKWYWFAGSLFVTL-TIAALYLLS-TPPIYTRTAAILVKDN
A0A1Q6G7L3      IRIQDLWG----M----FVPKWYWFAGSLFVTL-TIAALYLLS-TPPIYTRTAAILVKDN
A0A413H235      IRIQDLWG----M----FVPKWYWFAGSLFVTL-TIAALYLLS-TPPIYTRTAAILVKDN
A0A1M5B2J8      IRIQDLLY----L----CLAKWHWFVLSLAVCL-GVAIAYLLR-TPPVYTRSASILIKDD
A0A255RCT5      IRIQDLLY----M----CLAKWYWFVLSLAVCL-GVAIAYLLR-TPPVYTRSASILIKDD
A0A1Y4GLF5      LRIQDLFY----L----CLAKWKWFVISLVVTC-GIAVLYLLR-TPSVYTRTASVLIKED
A0A1H3XSC0      IRVQDLLY----L----CLSKWKWFVLSLAVTV-GIAVFYLLR-TPPVYTQTASVLIKDD
A6LE40          LRIQDLLF----L----CLAKWQWFVLSLVVTV-GAATVHLLR-TPAVYTRTASVLIKED
A0A4Y1VPX5      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
B3JI46          LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
R6NN15          IRIQDLYY----L----CLAKWRWFVLSLVICL-GIAFIYLLK-TPPVYTRTASLLIKEE
A0A358R8U0      IQIKDLLY----L----CLAKWKWFILSLLVTL-SLAFLYLLK-TPSVYTRSATLLIKEN
R6WSB6          IQIKDLLY----L----CLAKWKWFILSLLVTL-SLAFLYLLK-TPSVYTRSATLLIKEN
A0A401LPX7      ITIQDLFY----L----CLNKWHWFVISLVLCL-GGATFYLLR-TPSVYVRTASILIKDD
A0A6I0J0P8      ITIQDLFY----L----CLNKWHWFVISLVLCL-GGATFYLLK-TPSVYVRTASILIKDD
A0A6I1BFM0      ITIQDLFY----L----CLNKWHWFVISLVLCL-GGATFYLLK-TPSVYVRTASILIKDD
A0A6G0GNY9      ITIQDLFY----L----CLNKWHWFVISLVLCL-GVGTFYLLK-TPSVYVRTASILIKDD
A0A3A5Z900      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
A0A285TGL6      ITIQDLFY----L----CLDKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
A0A3A5RFX4      ITIQDLFY----L----CLDKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
A0A1Q6IUW9      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
A0A3R6NPG7      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
A0A413XDP6      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
K6AP24          ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
A0A6I2NHV3      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
A0A662ZYI7      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
A0A078RYI7      ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
C7XEQ8          ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
D7INX6          ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
K5ZG55          ITIQDLFY----L----CLNKWHWFAISLALCL-GVATFYLLR-TPSVYVRTASILIKDD
A0A3N2N9B8      LPISDILF----L----TLRKWPWIILSLTICV-GAALTYILR-TPTVYTRAAQIMIKDT
A0A3N2NMI0      VPIVDIIF----L----TLRKWPWILLSLIVCV-GAAMIYILR-TPDVYTRATEIMIKEP
A0A359I8H7      FSLKDFLA----R----CLSKWRWFAVSIVLFC-CLGVLYVLR-QQPVYSRSMELLIKDQ
A0A3N2KA63      FSLKDFLA----R----CLSKWRWFAVSIVLFC-CLGVLYVLR-QQPVYSRSMELLIKDQ
A0A4Q0IMT7      FSLKDFLA----R----CLSKWRWFAVSIVLFC-CLGVLYVLR-QQPVYSRSMELLIKDQ
A0A3B9FAU3      FNLRMLLD----I----VLGNWFWILQSVILFG-AAGWYYLKI-TPNTYQRTALVVIKED
A0A3C1E5L7      FNLRMLLD----I----VLGNWFWILLSVILFG-AAGWYYLKI-TPNTYQRTALVVIKED
A0A4Q0UAV1      INIKELLY----Y----FLSKWYWFVISVAVCV-AFASYKLMS-TRPTYVRTITVMFKTE
A0A354SN68      FVLKDFLF----A----CLAQWKLFALSVAVCV-GATMLYLSS-KSPVYMRRASVLMKED
A0A3N2N595      VPLSDIIY----R----TLHYWPLVLLSLFICV-GAAVMYLLC-TPKIYTTSASILIKDN
A0A0A2DUD9      FSLQDLWR----L----VCIRWYVIAISILLAL-GVAVLYILR-TPPVYKRTASVMIKAD
A0A3P1ZBJ5      VDIQDILY----L----CLSKWYWFLLSLILSL-ALGVLIILR-TTPVYNRYTTIMIKEN
R5FHS9          VVITDFLY----L----CLRKWWWFAIALIIAF-GVAIAYILR-TPPVYTRTESVVISNS
A0A413TW79      IRLQDLMY----L----CLVRWRWFVISLVVTL-GIATYYLLS-TPGVYQRTASILIKED
A0A3E5E9M7      IRLQDLMY----L----CLVRWRWFVISLVVTL-GIATYYLLS-TPSVYQRTASILIKED
A0A3E4SK73      IRLQDLMY----L----CLVRWRWFVISLVVTL-GIATYYLLS-TPSVYQRTAFILIKED
A0A415GGC6      IRLQDLMY----L----CLVRWRWFVISLVVTL-GIATYYLLS-TPSVYQRTASILIKED
A0A413DBH9      IRLQDLMY----L----CLVRWRWFVISLVVTL-GIATYYLLS-TPSVYQRTASILIKED
A0A1Y4PQK7      LRIQDLFY----L----CAAKWKWFVLSLLVAF-GIGYYYLLK-TPPVYTRTAELLVKRE
A0A1Y4IH41      LSIQDLFY----L----CAAKWQWFVLSLLVAF-GIGYYYLLK-TPPVYTRTAELLVKRE
A0A3A6AAP4      LRIQDLFY----L----CAAKWQWFVLSLLVAF-GIGYYYLLK-TPPVYTRTAELLVKRE
A0A6I0ZRD2      LRIQDLFY----L----CAAKWQWFVLSLLVAF-GIGYYYLLK-TPPVYTRTAELLVKRE
A0A1Y4DYA7      LNLKDLLF----S----LLKKWYWFVISILISI-TIAIFYIMC-TPPIYTRSASLLIKED
A0A1Y3X4I9      INFKDLMY----L----CLAKWYWFVISLVVLL-GFTALHLLT-TPPVYTRSASLLIKED
A0A1Y4FNK8      IRIQDLFY----L----CLNKWYWFVISLAVTI-GVAVVYLLT-TPPVYTRSASLLIKED
A0A355FD59      IRIQDLFY----L----CLAKWRWFVLSLFVTL-GIAVLYLLT-TPAVYTRSASLLIKED
A0A359CEZ9      IRIQDLFY----L----CLAKWRWFVLSLFVTL-GIAVLYLLT-TPAVYTRSASLLIKED
A0A353Q7B4      IRIQDLFY----L----CLAKWRWFVLSLFVTL-GIAVLYLLT-TPAVYTRSASLLIKED
F8X3A5          IRLQDLLY----L----CLFRWRWFVISLFITL-SIATFYILT-TPPIYIRSASILIKED
A0A1M3KVR9      IRLQDLLY----L----CLFRWRWFVISLFITI-SIATFYILT-TPPIYIRSASILIKED
A0A4Y9IJS3      IRLQDLLY----L----CLFRWRWFVISLFITI-SIATFYILT-TPPIYIRSASILIKED
A0A495WI87      MRIQDLLY----L----CASNWYWFALSLMITL-GAAFLYIKV-TPPVYTRSASILIKED
A0A354M4S6      MRIQDLLY----L----CASNWYWFALSLMITL-GAAFLYIKV-TPPVYTRSASILIKED
R7DH52          MRIQDLLY----L----CASNWYWFALSLMITL-GAAFLYIKV-TPPVYTRSASILIKED
A0A4Q5E7L5      LRIQDLLY----L----CLARWKWFVLSLAVTL-GIATFYILR-TPQVYTRTASVLIKED
A0A4P8LP09      LRIQDLLY----L----CLAKWKWFVLSLVVTT-GVAAVYLLR-TPAVYTRTASVLIKED
A0A4R4GZU7      LRIQDLLY----L----CLAKWKWFVLSLVVTT-GVAAVYLLR-TPAVYTRTASVLIKED
A0A016CWA4      LRIQDLLY----L----CLAKWKWFVLSLVVTT-GVAAVYLLR-TPAVYTRTASVLIKED
A0A1C6H117      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A0M1W0V2      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A139KA16      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A174VQ92      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A1Q6HCG0      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A1Y4JYM9      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A3A5QW67      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A3A5RQE6      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A3A6BP07      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A3E5E153      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A3Q9IP20      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A412WV15      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A413ICP6      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A414KYB9      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A5B3FWR2      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A6I0WNS4      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
E5WX00          LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
K0X3P3          LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A415TAH7      LRIQDLLY----L----CLARWKWFVLSLAITT-GVAAVYLLC-TPAVYTRTASVLIKED
A0A078T2W6      LRIQDLLY----L----CLARWKWFVLSLMVTI-GVATVYLLR-TPAVYTRTASVLIKED
A0A6I1AQV4      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A5C6L2P1      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A412MJT7      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A3E4WKT5      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A3A5YY33      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A078TAH2      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A1E9CFZ7      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A373FYU5      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A3A5TZ72      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A3A5XBP2      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A3A6MEG9      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A3E4JP35      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A3E4KP40      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A3E4NX82      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A3E4XFU8      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A412RG70      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A412TD37      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A413GAA4      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A414M7I4      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A496BTA0      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A496D2V6      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A4Q5G1P5      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A5C6KCA6      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A5M5AHM5      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A6I0KZV6      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A6I0Y5K7      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A6I1BFB8      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A6I2P5W5      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
E5UZA2          LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A069SMG6      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-PPAVYTRTASVLIKED
C3RFN5          LRIQDLLY----L----CLARWKWFVLSLVVTI-GVATVYLLR-TPAVYTRTASVLIKED
A0A3A5Z014      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVHLLR-TPAVYTRTASVLIKED
A0A6I0ING7      LRIQDLLY----L----CLARWKWFVLSLVVTV-GAATVHLLR-TPAVYTRTASVLVKED
A0A6I2P894      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVHLLR-TPAVYTRTASVLVKED
A0A078S3Q8      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVHLLR-TPAVYTRTASVLVKED
A0A069SJV7      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVHLLR-TPAVYTRTASVLVKED
A0A3E5DXI5      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVHLLR-TPAVYTRTASVLVKED
A0A3E5EM98      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVHLLR-TPAVYTRTASVLVKED
A0A3E5F453      LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVHLLR-TPAVYTRTASVLVKED
I9T3G6          LRIQDLLY----L----CLARWKWFVLSLAITV-GAATVHLLR-TPAVYTRTASVLVKED
A0A3E4SYU0      LRIQDLLY----L----CLARWKWFVLSLVVTI-GVATVYLLR-TPAVYTRTASVLIKED
A6LGY1          LRIQDLLY----L----CLARWKWFVLSLVVTI-GVATVYLLR-TPAVYTRTASVLIKED
K5ZSH4          LRIQDLLY----L----CLARWKWFVLSLVATI-GVATVYLLR-TPAVYTRTASVLIKED
A0A6A2RTB3      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A6I0VY00      LRIQDLLY----L----CLARWKWFVLSLAVTI-GAATAYLLR-TPAVYTRTASVLIKED
A0A1M4YZ07      LRIQDLLY----L----CLARWQWFVLSLVVTV-GAATVHLLR-TPAVYTRTASVLVKED
A0A4Q5E5M7      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAYLLR-TPTIYTRTASVLIKED
A0A0P0FQW1      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAYLLR-TPTIYTRTASVLIKED
A0A5M5C0W6      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAYLLR-TPTIYTRTASVLIKED
A0A6I0H151      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAYLLR-TPTIYTRTASVLIKED
A0A6I0HI59      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAYLLR-TPTIYTRTASVLIKED
A0A642LZ22      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAYLLR-TPTIYTRTASVLIKED
A0A6I0IP89      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAYLLR-TPTIYTRTASVLIKED
A0A642NJ89      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAYLLR-TPTIYTRTASVLIKED
A0A6I0HI52      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAYLLR-TPTIYTRTASVLIKED
A0A6I0YVB5      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAYLLR-TPTIYTRTASVLIKED
A0A6G0G4T5      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAYLLR-TPTIYTRTASVLIKED
A0A6I0HFG9      LRIQDLLY----L----CLARWQWFVLSLAVTI-GAATAYLLR-TPTIYTRTASVLIKED
A0A416GA42      LNPMDLLH----V----ALKKWYYYVGAVVCCL-LFAYIYLHR-TAPMYQRMATVLIKDK
A0A1T3IYP5      INVLDLLK----Y----LLHHWKWFTLSILIFG-GFFYYQYSK-TPFIYNQSEVVMIKTP
A0A3P1Z8V4      TNILPVLL----KCWGIFRRYWYWFALSTVLSL-IAGYVYQQM-QDRVYSGEAVILIDSS
A0A060RD97      LTARQVVE----L----VLANWYWFAVSLLVAL-LLGGYLYVK-SPLVFKRQASIMLKDK
A0A3C1ITV0      FQLSDMIS----W----TLCHKKFFAISIVICV-ALGLIYAQR-AQRIYQRSASVMLRSD
R7HN19          FQLSDMIS----W----TLCHKKFFAISIVICV-ALGLIYAQR-AQRIYQRSASVMLRSD
A0A350IHV0      LSLTEIWA----M----IWNNKWWYVLSLVVCI-FMAGFVIYR-TAPKYTRTAKVIVDDS
R5RVP0          LNLADLWS----M----IWDNKWWYVLSVAICL-CFSVFYLYR-TASSYTRTAKVMIDDT
R6A0L2          MQLIPLLK----LCYHQFINHWAWFALSAVVCG-CIGWYYQQC-QPRVYQRQAVMLIEDS
R7LG80          MQIIPLLK----LCINQLLRNWYWFLLSIVICL-GLGWIYRQS-QPSVFKQQSVILIEEA
A0A2L2WX98      AQLIPLLR----LCLGQLKAHWVWFLFSVIACA-ALGFLYLQC-QPRIYQRQAVILLEDT
A0A285T4L1      INLVDLFV----Y----LLSKWKWFVLSVLLFG-GLAWYHYAT-SPLVFFRNVTVIIKDP
G5GD56          IQLIPLFK----MCWALFLANLKWFVLSVILCL-VLGYLYQAR-QSRVYQRQAVILFEDN
R5KD55          ISIRDILI----S----CASHWRWYVATVVVAL-AVAVLYIKK-TQPVYKRDASIMVLER
A0A174QNT3      VTLRDLLE----L----FLNNWYWFIASILFCV-GGAWLYLSA-VSPVYQRTAVMLVKSD
A0A4S2FGS1      ITLRDIVE----L----FLNNWYWFAASAVACV-AMAWIYLSA-TPPLYQRTAVMLVKGD
R9I0H0          ITLRDIVE----L----FLNNWYWFAASAVACV-AMAWIYLSA-TPPLYQRTAVMLVKGD
K5BUT9          INLRDVVE----L----IIANWYWFVLSVLVCV-GSAYFYVLT-IQPVYQRQAVMLVKDK
A0A174FPA3      INLRDVVE----L----IIANWYWFVLSVLVCV-GSAYFYVLT-IQPVYQRQAVMLVKDK
R6S9Y6          INLRDVVE----L----IIANWYWFVLSVLVCV-GSAYFYVLT-IQPVYQRQAVMLVKDK
A0A642LIH6      INLRDVVE----L----IIANWYWFVLSVLVCV-GSAYFYVLT-IQPVYQRQAVMLVKDK
C9KX15          INLRDVVE----L----IIANWYWFVLSVLVCV-GSAYFYVLT-IQPVYQRQAVMLVKDK
A0A6H0KRK1      INLRDIVE----L----IIANWYWFALSVFICL-SVAYLYTRT-LVPVYQRQAVMLVKTG
R6DAG6          INLRDIVE----L----IIAKWYWFALSVFICV-SAAYLYTRT-LVPVYQRQAVMLVKTG
A0A3L8AAP1      INLRDIVE----L----LIAKWYWFALSVFICV-SAAYLYTRT-LVPVYQRQAVMLVKTG
A0A4S2AYX2      INLRDIVE----L----LIAKWYWFALSVFICV-SAAYLYTRT-LVPVYQRQAVMLVKTG
A0A4Y9H477      INLRDIVE----L----LIAKWYWFALSVFICV-SAAYLYTRT-LVPVYQRQAVMLVKTG
A0A0E2M2Y7      FSIEEYLL----G----LLSSWKWIVGSIIVCL-LVAYIYTQR-QSPAYIAQAAVLIKSA
A0A0K2J6Z0      FSIEEYLL----G----LLSSWKWIVGSIIVCL-LVAYIYTQR-QSPAYIAQAAVLIKSA
B2RKZ8          FSIEEYLL----G----LLSSWKWIVGSIIVCL-LVAYIYTQR-QSPAYIAQAAVLIKSA
A0A212GC82      FSIEEYLL----G----LLSSWKWIVGSIIVCL-LVAYIYTQR-QSPAYIAQAAVLIKSA
A0A254MU12      FSIEEYLL----G----LLSSWKWIVGSIIVCL-LVAYIYTQR-QSPAYIAQAAVLIKSA
R6CQ93          INLVDLFV----Y----LLSKWKWFVLSILFFG-GLAWYYYAQ-SPLVFFRSVTVIIKDQ
A0A3D1NQW3      FSVHDLIQ----T----VIANWYWFVISVFVCV-GCGYIYILR-TPKIYSRTANILVKDS
B0MT10          FSVHDLIQ----T----VIANWYWFVISVFVCV-GCGYIYILR-TPKIYSRTANILVKDS
R7JGW9          FSVHDLIQ----T----VIANWYWFVISVFVCV-GCGYIYILR-TPKIYSRTANILVKDS
A0A3D2BF46      FSIHDLIQ----M----VIGNWFWFLLSTVVCL-SCALFYIYT-APKVYNRTATILIKDG
A0A358R538      VTLHDILR----M----VAANWYWFVISAAVCL-GAAYYYLAS-TPRIYSRTATILVKDS
A0A1Y4AAB8      FSLHDLIQ----M----ILANWYWFAISVIVCL-GAGYLYLAR-TPKVYSRKATILVKDD
A0A1Y3WWY9      INLHDIIR----M----ILMNWYWFVLSVLVCL-GVAYYYLAK-TPKIYSRTATILVKDS
A0A1Y4U5L4      INLHDIIR----M----ILMNWYWFVLSVLVCL-GVAYYYLAK-TPKIYSRTATILVKDS
A0A1Y3VCJ1      IDLHDIIR----M----VIANWYWFILSILVCV-GAAYYYLAK-TPKIYTRSATILIKDS
A0A1Y3QTW7      LTLHDLLQ----M----VLANWYWFALSVLICL-GMAYYYLAS-TPKIYSRTATILVKDS
R6XWY7          LTLHDLLQ----M----VLANWYWFALSVLICL-GMAYYYLAS-TPKIYSRTATILVKDS
A0A4Y1X9Y9      LTLHDLLQ----M----VLANWYWFALSVLICL-GVAYYYLAS-TPKIYSRTATILVKDS
A0A4Y1WM66      LTLHDLLQ----M----VLANWYWFALSVLICL-GVAYYYLAS-TPKIYSRTATILVKDS
A0A174AVF1      LTLHDLLQ----M----VLANWYWFALSVLICL-GVAYYYLAS-TPKIYSRTATILVKDS
A0A656Q4F4      LTLHDLLQ----M----VLANWYWFALSVLICL-GVAYYYLAS-TPKIYSRTATILVKDS
A0A1Q6EIY0      ITLHDLIQ----M----VLANWYWFALSAIICL-GTAYYYLAS-TPKIYSRTATILVKDS
A0A5B5VN71      ITLHDLIQ----M----VLANWYWFALSAIICL-GTAYYYLAS-TPKIYSRTATILVKDS
E4M8L3          ITLHDLIQ----M----VLANWYWFALSAIICL-GTAYYYLAS-TPKIYSRTATILVKDS
I3YQ50          ITLHDLIQ----M----VLANWYWFALSAIICL-GTAYYYLAS-TPKIYSRTATILVKDS
R5UEY8          ITLHDLIQ----M----VLANWYWFALSAIICL-GTAYYYLAS-TPKIYSRTATILVKDS
A0A1H4D866      VTLHDIIR----M----VIANWYWFVLSALVCL-SLAYYYLAS-TPKIYSRTATILVKDS
A0A5B3G4Y7      ITLHDIIR----M----VIANWYWFVLSTVCCL-CAAYYYLAS-TPKIYSRTATILVKDS
A0A374A9J5      ITLHDIIR----M----VIANWYWFVLSTVCCL-CAAYYYLAS-TPKIYSRTATILVKDS
A0A5B3GQN5      ITLHDIIR----M----VIANWYWFVLSTVCCL-CAAYYYLAS-TPKIYSRTATILVKDS
A0A1Q6E9S3      ITLHDIIR----M----VIANWYWFVLSTVCCL-CAAYYYLAS-TPKIYSRTATILVKDS
D4IJ36          ITLHDIIR----M----VIANWYWFVLSTVCCL-CAAYYYLAS-TPKIYSRTATILVKDS
A0A414Q925      V-IADMLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
A0A415PUS9      V-IADMLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
A0A108TCU0      V-IADMLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
A0A413BA42      V-IADMLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
S3Y344          V-IADMLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
A0A4Q5G8Y8      V-IADMLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
A0A412TGL3      V-IADMLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
A0A413VJ33      V-IADMLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
A0A414L0W6      M-IADMLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
A0A412DP39      V-IADVLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
A0A413ZSE8      V-IADMLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
B0NP84          V-IADMLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
R6AK43          V-IADMLS----A----VYRNRKWFILSVAVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
A0A412N2D9      V-IADMLS----A----VYRNRKWFILSVVVCV-LIGFLYLKS-SPEIFLRTATVLVKDE
A0A1Y4JYS9      V-IADMLS----A----VYRNRKWFILSVVVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
R6LHA4          V-IADMLS----A----VYRNRKWFILSVVVCV-LIGFLYLKS-SPKIFLRTATVLVKDE
A0A3E5HPT8      INIVDLFI----Y----LIAHWKWFVLSILLFG-GYFWYSYCE-TPFVYSRTAIVMIKTP
C6IJ48          INIVDLFI----Y----LIAHWKWFVLSILLFG-GYFWYSYCE-TPFVYSRTAIVMIKTP
Q8A3U2          INIVDLFI----Y----LIAHWKWFVLSILLFG-GYFWYSYCE-TPFVYSRTAIVMIKTP
A0A3R6S1H6      LNLIDLWY----M----FKRYWYWFVLSVMVFL-GGAVYYVKS-TAKIYTCVASVLIKND
A0A3R6SD81      LNLIDLWY----M----FKRYWYWFVLSVMVFL-GGAVYYVKS-TAKIYTCVASVLIKND
A0A354WXN6      LNILDLVK----I----AWANWYWFVISIVLCL-SIAFVYLKW-APKVYTRTASVLIKDD
R5IP14          LSLRDILE----I----GLANWKWFALSVIVCL-SIAYVYVQT-LPYIYTRSASVIIKDN
A0A316SZX7      INLRDILD----L----LISQWKWFALSICICL-GIAFLYLKQ-ATPIYTRTASVMIKDD
A0A1Y4AIY1      VTLGDIFQ----I----VKAKWYWFALSIGICL-GIAYIYLLQ-APKVYTRSASVLIKED
A0A0J6CIR2      LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLYLKW-APKVYTRTASVLIKDN
A0A3D8HG59      LNLGDIIQ----I----VRANWYWFALSVVVCM-SAAFVYLQW-APKQYTRTASVLIKDD
A0A3R6S408      LNLGDIIQ----I----VRANWYWFALSVVVCM-SAAFVYLQW-APKQYTRTASVLIKDD
F3ZRU7          IDLVEIGT----M----LMRHWLWYIVAVALAL-VLGFLYIKS-TPKTYERHASVLIKDD
A0A1C5Q1F3      LHVGDWLH----I----ALANWKWFVLSLVVCM-GASFWYIKR-SPDIYSRSASVLIKDE
R7A239          LHVGDWLH----I----ALANWKWFVLSLVVCM-GASFWYIKR-SPDIYSRSASVLIKDE
A0A3R6HIK7      LNLWDLFQ----I----FKANWYWFVLSVILCV-GAGYLYLLQ-APRVYTRTASVLVKEE
K5ZVW7          LNLWDLFQ----I----FKANWYWFVLSVILCV-GAGYLYLLQ-APRVYTRTASVLVKEE
A0A1Y4D5Z0      LNLWDLLQ----I----LKANWYWFVLSVVACL-GLAYLYLKQ-APLVYTRSASVLIKEE
A0A413VXJ7      ISIADILQ----L----IWSNRYWFALSIILCI-GIAFFYIQS-TSKVYSRKATVLIRDD
I9RSN9          INIADILQ----L----IWSNRYWFILSIFLCV-GIAFFYLQS-SSKIYSRKASVLIRDD
U6RJK5          INIADILQ----L----IWSNRYWFILSIFLCV-GIAFFYLQS-SSKIYSRKASVLIRDD
A0A1Q6GA32      INIADILQ----L----IWSNRYWFILSIFLCV-GIAFFYLQS-SSKIYSRKASVLIRDD
I9RPU6          INITDILH----L----IWVNWYWFVLSVLVCG-GIAFFYLKS-SSKVYSRKASVLIRDD
I8YFS5          ISIVDIFH----L----VIANWYWFVLSILICA-GIAFFYLKS-SSKVYSRKASVLIRDD
A0A6H9LTF8      ISIVDIFH----L----VIANWYWFVLSILICA-GIAFFYLKS-SSKVYSRKASVLIRDD
I8Y597          ISIVDIFH----L----VIANWYWFVLSILICA-GIAFFYLKS-SSKVYSRKASVLIRDD
A0A1Q6GBF5      INITDIFR----F----VLANWYWFVLSVLVCT-GIAYFYVKS-SSKIYSRKASVLIRDD
I8YFZ3          INITDIFH----L----ILVNWYWFVLSVLVCG-GVAFFYLKS-SSKVYSRKASVLIRDD
A0A6H9M1J1      INISDIFH----L----VLANWYWFVLSVLVCG-GVAFFYLKS-SSKVYSRMASVLIRDD
A0A1Q6GDH2      INITDILH----L----IWVNWYWFVLSVLVCG-GIAFFYLKS-SSKVYSRKASVLIRDD
U6RSB0          INITDILH----L----IWVNWYWFVLSVLVCG-GIAFFYLKS-SSKVYSRKASVLIRDD
I9GXM2          INISDIFY----L----VLANWYWFILSVLVCG-GVAFFYLKS-SSKVYSRKASVLIRDD
I9SIK1          INISDIFH----L----ILANWYWFVLSVLVCG-GVAFFYLKS-SSKIYSRKASVLIRDD
A0A6H9LZ74      INISDIFH----L----ILANWYWFVLSVLVCG-GVACFYLKS-SSKIYSRKASVLIRDD
I9TP59          INISDIFH----L----VLANWYWFVLSVLVCG-GVAFFYLKS-SSKVYSRMASVLIRDD
R5S343          LTLRDMIG----I----VWMHKWWFTASLVVCI-ILASGYLMW-MPNVYTRTASVLIKDS
A0A1M6K7I9      INIADLLL----I----LRNNWKWFAASIFVCM-ALAFVYLKS-TPKTYSRKATVLIRDD
A0A5M6A8C8      INIVDLLL----I----LRNNWKWFAASIFVCM-ALAFVYLKS-TPKTYSRKATVLIRDD
A0A6H9LT84      INLIDIFR----L----IFVNWYWFVLSVLICI-GFAFFYLKS-SSKVYSRKASVLIRDD
A0A6H9LUV5      ISIVDIFH----L----VLANWHWFTLSILVCV-GIAFFYLKS-SSKVYSRKASVLIRDD
A0A3R5ZMK1      LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLYLKW-APKVYTRTASVLIKDD
A0A3E4ZTK7      LNLEDILQ----V----VLANWHWFVLSVVVCA-GAAFLYLKW-APKVYTRTASVLIKDD
A0A1Y3ZIA4      LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLYLKW-APKVYTRTASVLIKDD
K5Y1A4          LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLYLKW-APKVYTRTASVLIKDD
A0A4Q5CIT0      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLYLKW-APKVYTRTASVLIKDD
A0A3R6K8X4      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLYLKW-APKVYTRTASVLIKDD
A0A414GI87      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLYLKW-APKVYTRTASVLIKDD
A0A415BDM7      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLYLKW-APKVYTRTASVLIKDD
A0A412DM15      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLYLKW-APKVYTRTASVLIKDD
A7AEU7          LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLYLKW-APKVYTRTASVLIKDD
A0A1Q6I3T6      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLYLKW-APKVYTRTASVLIKDD
A0A414XX40      LNLGDILQ----T----VLANWYWFVLSVVVCA-GTAFLYLKW-APKVYTRTASVLIKDD
A0A3R6BKI7      LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLYLKW-APKVYTRTASVLIKDD
A0A414LPI6      LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLYLKW-APKVYTRTASVLIKDD
A0A412M2W1      LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLYLKW-APKVYTRTASVLIKDD
K5ZX55          LNLGDILQ----T----VLANWYWFVLSVVVCA-GAAFLYLKW-APKVYTRTASVLIKDD
A0A5F0U645      LNLIDMYR----V----VRANWYWFLLSVAVCC-AVAVLYLGW-APKIYQRTATVLIKDD
K5ZBN2          LNLIDMYR----V----VRANWYWFLLSVAVCC-AVAALYLGW-APKIYQRTATVLIKDD
A0A0J6CKW3      LNLIDMYR----V----VRANWYWFLLSVAVCC-AVAVLYLGW-APKIYQRTATVLIKDD
A0A0F5IQM7      LNLIDMYR----V----VRANWYWFLLSVAVCC-AVAVLYLGW-APKIYQRTATVLIKDD
A0A496CDT3      LNLIDIYR----V----VRANWYWFLLSVAVCC-AVAVLYLGW-APKIYQRTATVLIKDD
A0A6G1ZKM3      LNLIDMYR----V----VRANWYWFLLSVAVCC-AVAVLYLGW-APKIYQRTATVLIKDD
S0GLB0          LNLIDMYR----V----VRANWYWFLLSVAVCC-AVAVLYLGW-APKIYQRTATVLIKDD
A0A3R6NLC1      LNLIDIYR----V----VRANWYWYLLSVVVCC-AIAVLYLGW-APKIYQRTATVLIKDD
A0A416WYC9      LNLIDIYR----V----VRANWYWYLLSVVVCC-AIAVLYLGW-APKIYQRTATVLIKDD
A0A0F5IT40      LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLYLKW-APKVYTRTASVLIKDN
A0A496CX20      LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLYLKW-APKVYTRTASVLIKDN
A0A5F0UBI0      LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLYLKW-APKVYTRTASVLIKDN
A0A6G1ZHG0      LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLYLKW-APKVYTRTASVLIKDN
S0GSI7          LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLYLKW-APKVYTRTASVLIKDN
K5YB65          LNLSDLFH----I----VLANWYWFVLSVLVCA-GVAVLYLKW-APKVYTRTASVLIKDN
A0A0F5IWP9      LNLKDLFH----I----VLANWYWFLLSVLICC-GAAFLYLKW-APKVYTRTASVLIKDN
A0A0F5IZT8      LNLKDLFH----I----VLANWYWFLLSVLICC-GAAFLYLKW-APKVYTRTASVLIKDN
A0A417LKQ2      LNLRDLFN----I----VRANWYWFLLSVLLCS-GAAFLYLKW-APKVYTRTASVLIKDN
A0A416TME1      LNLNDLFH----I----VLANWYWFLLSTLFCC-GVAFLYLKW-APKVYTRTASVLIKDN
A0A416XPE8      LNLNDLFH----I----VLANWYWFLLSTLFCC-GVAFLYLKW-APKVYTRTASVLIKDN
A0A3B0C2S4      VNLWEVAQ----K----YLRYWPWFVLGILICL-GGAYAYMRY-APIVYESSAKIKIIDE
L8JI02          INIKGIVL----Y----LLSKWHYFVFAAIFLL-PGAYLYTKY-ATKVYLVKASILLKSE
A0A4Q5WS95      PFVEAFVY----R----YLPYWPLFAILAIFFT-ALSVGYLRY-ATPVYEANATILIKDE
A0A501VZX6      NIFSSLLY----K----YLPYWPLFALLLLISC-LGTWGYLRYFAIPSYETSASLIIKDE
A0A399SH26      NLLTVLLR----K----FLPYWPVFIGLAILSM-ALAWVYLRY-ATPVYEIAATLIIKDE
A0A501W1A9      NLFGAIVF----R----FLPFWPLFVVLIGVCL-AGAWAYLHYVATPTYSTSASLIVKDE
A0A0E3ZGV6      NLVASLVY----K----FLPFWPLFVVLFILSV-AGAWAYLKFYATPTYAITASLIIRDE
A0A1I2N4S1      NLAVALLY----K----FLPFWPLFLVLLLLGM-AGAWAYIKYYTIPSYAVTASLLIKDE
A0A2T5YE44      NLAVALLY----K----FLPFWPLFLVLLVLGM-AGAWAYIKYYTIPSYAVSASLLIKDE
A0A1V9FHD0      NIISLALN----W----YLPYWPLFLILIVLGS-AGALVYLNFFATPVYETYATVMVKDE
A0A4V4H170      NIVSVAIN----W----YLPYWPLFLILIVLGL-AGAWAYLKYFSTPVYETYATIMVKDE
A0A1V9F098      NIISVVTN----W----YLPYWPMFLVLLILGL-AGAWAYLKFYSIPVYETYATIMVKDE
A0A4R2VU64      NIISVVTN----W----YLPYWPMFLILLVLGL-AIAWAYLRYFSIPVYETYATIMVKDE
A0A4S8HY23      NFVSVAIN----W----YLPYWPLFLMLIVFAL-AGAWAYLTYYATPVYETYATIMVKDE
A0A1V9F383      NIGSLIVN----W----YLPYWPLFLILIIVGV-GSAWAYLHFIAVPVYETNATVMVKDE
G8TRZ6          NIGSLIIN----W----YLPYWPLFLILTVVGL-AAAWAYINFVAVKQYESYATVMVKDN
A0A543WA52      NLFKLILS----R----FLPFWPLFAILIFFGL-LGAWSYLKWAT-PIYGVSATLIIKDE
A0A1M5BA90      NAVEAFMY----R----YLPYWPLFALLLILAG-TAAYMYLHYIAKPVYQISANILIKDE
A0A512B879      GVVERFIY----S----YLPYWPLFALLLVVFL-VAGSFYL-YLTKPIYEISADILIKDE
A0A559PPI3      NLFSSMMD----L----FFPFWPLLAVILVVVL-FLAWGYKNYAT-PIYEVSATLIIKDE
A0A1T5CS78      NLFRYIIK----T----FFPFWPLFLVLVVVCV-LGAWGYLKYVT-PIYEASASIMIKDE
A0A0Q9Z8F1      NLFRYIIK----T----FFPFWPLFLVLVVVCI-LAAWGYLKYAT-PIYEASASIMIKDE
A0A2N0U0M7      NLFRYIIK----T----FFPFWPLFLVLIVVCI-LAAWGYLKYAT-PIYEASASIMIKDE
A0A2N3U785      FDLRGVLT----K----YLRYWYLFAATLLLSL-AGAYTYLRY-ATPQYLISSTLLIQDN
A0A0D3L8Q3      INFKEIIL----K----YLRYWYLFLLGTIICF-GLAYLYLRY-TTPQYLITTSILIKSD
A0A0E3ZG78      KDIRRILL----N----YLRYWYLFLIGAALGL-CGAFLYLRYYTIPKYSVYSTVLIKDD
A0A1I6BRK6      GDLKNIVL----Q----YTRYWYLFLLGAVLSI-SVAFFYLRYYAVPQYIVSGTMLIKDD
A0A243WAB1      KDIKRMVG----Q----YIRYWYLFLLGGMIGL-GITYFYLRYYAVPQYHVYSTLLVKDD
A0A6G8C8X6      KDIRGLIQ----Q----YVRYWPLLLLGTTLGL-ATAFLYLRYYAVPQYWTESTLLIKDD
A0A5B6TJH8      NDIRNTFI----Q----YSRYWYLFLLGALLSV-GAAFMYLRYHTSVQYKVASRLLIKEN
A0A519U664      KDFKRIIS----Q----YSRYWYLFVLGASIGL-GIAYLYLRFYAIPQYVVSSTMLIKDD
A0A519UDD1      FDARRILL----Q----YTRYWYLFLIGAILGV-TAAFVHLHYYAVPQYTVYSTMLIKDD
A0A519MA34      KDFRRMIH----Q----YTRYWYLFVLGAALGL-GAAYFYLRYYAIPQYVVSSTMLIKDE
A0A519UCX0      RDFKRVLQ----Q----YSRFWYLFVLGAILGS-GAAYLYLRFYAIPQYVVSSTLMIKDD
A0A4R5DL69      RRLISLWP--------------WLILSQIFSLL-ASF--IYLRYSTPRYEITSTILVKDD
A0A1M4YED3      ENILSILQ----F----RFAPYWPLFIILAIIS-GVASYLYLKYTPPVYSAYSTMMIKDE
A0A2H3NSN0      VDLNTIWH----T----IKRGKWIILGTCLAMI-AAFA-GYTFMVAPEYEAAATVQVE--
A0A2P6C324      LDLGALWE----A----VKRSKWVILGTCVFVT-ALTA-AVTMMMPQVYEAGAVVSVE--
A0A1M6XHU0      INFAEIWH----T----IRRGKWIILLTTLVVA-GVIG-AYTYTLPPVYESSAIVFVD-T
A0A5S9C8G0      INFAEIWH----T----IRRGKWIILLTTLVVA-GIIG-AYTYTLPPVYESSAIVFVD-T
G2SF81          INFAEIWH----T----IRRGKWIILLTTLVVA-GIIG-AYTYTLPPVYESSAIVFVD-T
A0A5S9EYW1      INFAEIWH----T----IRRGKWIILLTTLVVA-GAIG-AYTYTLPPVYESSAIVFVD-T
D0MHQ9          INFAEIWH----T----IRRGKWIILLTMLVVA-GAIG-AYTYTLPPVYESSAIVFVD-T
A0A126PFG0      LNLRAVLA----R----YRYHWSLFVAGVALAL-LGAY-LYTQLVQPAYEVRASLLVEGE
A0A3M1N7Z3      WDLRRVLI----V----LSREWWWPTLSVLFAA-FTAW-AYLRYTEATYQTTAVVQVNLA
                                                                :           

A0A1T5MMH4      DE----------ASELGI----SILA---GKDQQNTDLISGEIEMIRSRLFLDQVLDSL-
A0A2W4R1L8      NE----------ATELGI----NRLV-----EDQNLNIMSGEIEIIQSKLFLARVLDSL-
A0A2E5CV79      PGT-------------------SMIM---QYGSRDRSDMSNEIEVLRSRRLAKDVVKLFW
A0A2D4ZVH1      KNR---------YSYAGAGIENLLTS---TYGIGVGSTIANELQIMKSRKLSYDLAERI-
A0A0K8QSK7      SGGSPF------SQTESAISSQAFEG---FGIMGQNNNIYNQIEVLKSWPIIEEAVQEL-
A0A1V6CN82      -GSTTF------WRQAGGFSGEALRG---FG--TSYQGIQNQMIIMKSQPVVAKAIREL-
A0A1M4XZ45      KASSPL------SGAMGGAQQSIFQG---LGGMNSMQNIYNQMVVLSSTPIISRTLNEL-
A0A399D319      KAGSPL------ASGAGGSSEGIFQG---LGMMNSMRNIYNQMVILNSTPIVSRTLNEL-
A0A1M6GR99      ------------SGSSSSSGESRYIN---SELLSRSQNIQNELEIIKSFPNISQTVRNL-
A6EBM4          KTALS-----------------DIAD---ALNTNTATNMQSESFAIESRHLLLNAIKRL-
A0A1M6TTV4      SE----------AGILGIQNPMD----------QDIKGLSGEIEILKSRLFASQVVNAV-
A0A4Q8RX32      QRNI--------ADPTSFL-----PG---SELFSGRNTFHNSLLTLQARPLLEKVLNKL-
K0X1U5          EKKGGGGLSSLMGGISG-----GGFS---LDGMIGGGSVNDEILVISSHSLIREMVQRL-
R5EXK3          EKKGGGGLSSLMGDIAG-----GGFS---LDGMIGGGSVNDEILVISSHSLIREMVQRL-
A0A401UAP7      NE----------ANEFGIT------K---IMEDQNLNLISGEIELIQSNLFLSRVIDSL-
A0A1W2GF52      ND----------ANLLGLQNPLE----------QDIKGIAGEIEILRSRLFFSKVVDAI-
A0A2G5L7B8      SD----------AGILGIQNPME----------QDIKGLSGEIEILKSRLFASQVVDAV-
A0A523GAC0      KD----------ANFLGF------LE---INEEQNLNNISGEIELIKSKLFFDKVIKTL-
L8JW09          SD----------ASELGL------LG---LSENKNLNIISGEIELIKSKLFFSKVIETV-
A0A364XUP5      NE----------ATELGI----ATIT---SDEPQNADLISGEIEIIRSKLFLNIVLDSI-
A0A1M5RLA9      NE----------ATEFGI----KPTV---ED--PNFNLLSGEIELIESRLFLGRVLDSS-
A0A385SFR9      KE----------ATEFGI----KPTV---ED--PNLNLLSGEIELIESRLFLGRVLDSS-
A0A5M4A9J4      KGSNPLEGSGGSGSLNASD---VFQG---FGLFQGKQNLENQIQILQSWTLVSKAVNEM-
A0A5M4B1C7      KGNNPLDGSSSGTSFNASD---VFQG---FDLFQGKQNLENQRQILKSWTIISDAVDKL-
A0A0D3LFR6      KP----------AASFGF----VDSD------KATMEGMSSEIELIKSKLFLNKVLSAL-
M7N6D4          KQ----------ADFLGY----RSLD---SDPNQNMNGMSEEIELIKSKLFLTRVLKAV-
A0A4D7K1D4      DE----------TSVLTFG------V---DPQKNNMNALSGEMELLRSKVFFSRLIDSL-
A0A5C7MX19      KK----------AQILGVE---KIAV---EQDNAA---INREIQLFKSRLLVERIVDSL-
A0A1Q3ZMZ7      DQGK------------------EVLE---LENINSKKSLSSNIELLKSPVLFENAIKKL-
A0A2D8JJW3      DN----------SGIAKMPG--FEAF---SDDKK----LEDKIRNIGLRPIAQATIDKLS
A0A2W2AFF7      QKAGNMDGKQLLEDLGFLSGKGN---------------VDNEVEIFKSRSLMESVVRDM-
R7PCR1          NDSGSMGRAGRGANML--------LE---LNGVSVGNSLQDETFILQSYRLMERVVSRL-
A0A2N5YXE2      NKT---------NQILGIN---AGVM---ETD------LAPVIELVRSNEFLKTVVASL-
A0A1G9E2A9      RN----------ANVL------FGRN---SDLGSQVENITGEIEFIKSRLVYNRVIDSM-
A0A098LL25      SE----------AGVLGLNK--FNDE---NMPGNKLSTISGEIEFLKSRYLYEKIVDRM-
A0A6C0GJI1      RE----------ASVLGLNGV--------NAVEDMSANLSGEIELIRSKLIYDEVIKRM-
A0A2T2YJE8      SE----------AGRLGLGGT--------IENQQTLSNLSGEIEIIKSNFTFERLQQKL-
A0A127B287      TE----------AKVLELPGA---------GMESDLGKLQGEVDLIKSDLVYDRLKKSM-
A0A3M9N829      SE----------AGVLGL----ESNG---LPIEAGAGKLQGEVDLIKSDIVYERLKKTM-
A0A0P0CSF9      SQ----------AGVLGL----QNSG---LKVESGIGQLQGEVDLIKSNIVFERLKKTM-
A0A5M8QQB8      SE----------AGVLGL----ENNG---LKVESGIGKLQGEVDLIKSNIVFERLKETM-
A0A3M9MNC3      SE----------AGVLGL----ENNG---LKVESGIGKLQGEVDLIKSNIVYERLKKTM-
A0A5B6TAX2      SE----------AGVLGL----ENNG---LTVESGVGKLQGEVDLIKSNIVYERLKKTM-
A0A5N1IQ33      SQ----------SGVLGLESA--GKA---VDARQSSKNLAGEVELIKSSVIYQRLRDSL-
A0A512AYT3      SQ----------AGALGLGGP-MGDA---ASSQQSMASLSGEVELIKSDLIYENLKRRL-
A0A5M6CYN7      SQ----------AGALGLGGP-LSD-------QQAISSLSGEIELIKSDLIYENLKRRL-
A0A369QP10      SE----------AGRLGLDG-----T---IENQQNLSNLSGEIEIIKSNLTYERLQQKL-
A0A126PDF2      SE----------AGVVGLGGQ-LAAA----DPR-ASSKLAGEVQLIKSEIIYKELRDSL-
A0A2Z3GKA1      SE----------AGVVGLGGQ-LAAA----DPR-ASSKLAGEVQLIKSEIIYKELRDSL-
A0A502GZP7      SE----------AGVVGLGGQ-IAAA----GPSVGASKLAGEVQLIKSEIIYKQLRDSL-
A0A519SBU8      SE----------AAKVGLGGL-ADA------DARNGAQLAGEVELIKSNLTYKNLKERL-
A0A4Q3JNZ3      SE----------ADKFGIGGI-KG--------EP-GNQLAGEVELIKSNLTYQHLKERL-
A0A519Q9V3      SE----------AANLGLGAA-KGG------DSP-SNQLAGEIELIKSNLTYQHLKERL-
A0A0M3RW20      QE----------AGTLGLGGG-LAGP----EGPLSMNNLSGEVELIKSNLIYRQLRDSL-
A0A495VFX4      QE----------AGTLGLTGK-LAVA----EGPLSMNNLSGEVEFIKSNLIYRQLRDSL-
A0A1S9B3W0      TE----------AGQLGLLP---PGA---ADPRQSMSQLAGEVELIKSDLIYTRLRDSL-
A0A1W1VRL3      TE----------AGLLGLGA---GGS---VEKRRPGANLEGEVELIKSNLIYRRLKDSL-
A0A1M6R305      TE----------AGALGLGGA-LGEG---VAGRQSISKLSGEVELIKSNIIYRRLKDSL-
A0A4Z0PHK3      TE----------AGALGLDGP-LGQA---V-GASSLNKLSGEVELIKSNIIYERLKDSL-
A0A2M9B9H9      TE----------AGILGLDGP-VGQA---V-GSSNVNKLSGEVELIKSNIIYQRLKDSL-
A0A4Z0QCY9      TE----------AGVLGLDGA-LGQA---V-GASSLNKLSGEVELIKSNIIYQRLKDSL-
A0A418R9X5      SE----------AGVL-LGG--IGQA---AEQKQTLNKLSGEVELIKSDIIYRRLKDSL-
A0A428JSJ3      SE----------AGLL-LGD--VGQA---AEQKQNLNKLSGEVELIKSDIIYRRLKDSL-
A0A428KI59      SE----------AGVL-LGD--IGQA---AEQKQTLNKLSGEIELIKSDIIYRRLKDSL-
W8F1I6          SE----------AGVL-LGD--IGQA---AEQKQTLNKLSGEIELIKSDIIYRRLKDSL-
A0A246FQC0      SE----------AGVLGLGA--LGGA---IDQKKNLNSLSGEIEVIKSDIIYQRLKDSL-
A0A372E5P8      TE----------AGVLGLGG--LGGA---VEQKQSLTKLSGEVELIKSDIIYSRLNDSL-
A0A1H3EMW1      TE----------AGVLGLGG--LGAA---VEQKQSLNKLSGEIELIKSDIIYRRLNDSL-
A0A1H9ZSN3      TE----------AGVLGLGS--LGGA---VEQKQSLTKLSGEIELIKSDIIYSRLNDSL-
A0A5N1J2M4      KE----------AGLLGLK---LGES---DKQRVGTNQLSGEIELLKSNLIYEKVRQSM-
A0A519S476      SE----------AANLGL-A--SVKA---LDNTQPANQLAGEVELIKSKLTYQALKERL-
A0A4Q3JRW8      SE----------AANLGFGA--AVKG---EEGANTTNQLAGEIELIKSNLTYKNLKDRL-
A0A519M923      SE----------AANLGLGG--AAKG---ADDGRPGAQLAGEVELIKSNLTYQHLKERL-
A0A4Z0ENW1      SD----------ASALGLG---MAMG---GGDNNQASQLAGEVELIKSGLTYKRLKQTV-
A0A519UDB4      SN----------ANDLGLG---ELTG---RGNDNNSSQLSGEVELIKSNLTYKRLKQVV-
A0A3S0QKV1      RQ----------DAELNLPGL---VA---NP-QQNVNKLAGEVELIKSDLIYSRLRDSL-
A0A328BL48      QQ----------AGDLGLLAA---GA---QAGQQGMSKLSGEVELIQSDLIYTRLRDSL-
A0A5R8WLY4      QQ----------AGDLGLLSA---GA---QPGQQGISKLSAEVALIQSDLIYTRLRDSL-
A0A1I5WSL8      NE----------GSALGLAGQ-MAPA---AADKGRGGKLAGEVEVIKSNIIYRRLKDSL-
A0A0U3JVM7      NE----------GSALGLAGQAAAPA---VMDKGR-TKLAGEVELIKSNIIYRRLKDSL-
A0A1G1SSV2      NE----------GSALGLGGQ-GAPA---VVPNGR-TKLAGEVELIKSNIIYQRLKDSL-
A0A1G1SXV7      NE----------GSALGLGGQ-GASA---ALPNGR-AKLAGEVELIKSNIIYQRLKDSL-
A0A6G8CBJ6      TE----------AGLLGMGP--VGGA---VEKRQELANLSGEVELIKSNLIYRRLKDSL-
A0A0W8EDI5      TQ----------SAVLGLGG--VGGS---AEAQQNAKNLAGEVELIKSNLIYRKLQDSL-
A0A3B7RBP8      TQ----------TAVLGLGA--VGGA---AEAQQNSKNLAGEVELIKSNIIYRKLQDSL-
A0A3R9P8H7      TE----------AGVLGLGG--LGGA---VEQKQNLNKLSGEIELIKSDIIYRRLKDSL-
A0A238WIA7      TE----------AGVLGLEG--LGKM---VEQKQTVTQLSGEMELINSDLIYRRLRDSL-
A0A212UCJ7      TE----------AGVLGLEG--LGKM---VEQKQTMTQLSGEIELIKSDLIYRRLRDSL-
A0A4Z0MQE1      TE----------AGVLGLEG--LGK-------APSTSQLSGEIELIKSNLIYRRLRDSL-
A0A4Z0PCF4      TE----------AGVLGLEG--LGKM---VEQKQTIAQLSGEIELIKSDLIYRRLRDSL-
A0A5D6VDG1      ED----------AGALGLG---LGAG---AEARQNMNNLSGEIELIKSNLIYRQLKDSL-
A0A6H1CVS0      ED----------AGALGLGQT-LGAA---VETRQKLNSLSGEVELIKSNLIYRQLKDSL-
A0A243WHR7      TE----------AGALGLGGA-LTGD---I--RQSGNKLSGEIELIKSNIIYEHLKDSL-
A0A5B8A0P6      TE----------AGALGL-GA-LGQG----DGRQNINKLSGEVELIKSNIIYRRLKESL-
A0A076HRT9      TE----------AGTLGLGGA-M-KE---AEGRQSLNKLSGEVELIKSNIIYRRLRDSL-
A0A4Z0PVM7      TE----------AGALGLDGP-LAQA---VGS-SSLNKLSGEVELIKSNIIYQRLKDSL-
A0A1M6DHW8      TE----------AGALGLSGT-MGKG---IEERQSINKLSGEVELIKSNIIYRRLKDSL-
A0A4Q5LC61      TE----------AGALGLAGP-LGKG---IEEQQTLNKLSGEVELIKSNIIYRRLKDSL-
A0A2U1FKU2      EKNGVSGGLSQFQDLG--------LL---MGNSE----VENELLVFKAKRLTAIVVDKL-
A0A0A2F954      EKSGATSGLQQFQELG--------LM---TGNSE----VENEILLLKSKRLTAVVVDKL-
A0A0A2FW91      EKSGATSGLQQFQELG--------LM---TGNSE----VENEILLLKSKRLTAVVVDKL-
A0A2D2N2N1      EKSGATSGLQQFQELG--------LM---IGNSE----VENEILMLKSKRLTAIVVDKL-
Q7MWZ2          EKSGATSGLQQFQELG--------LM---IGNSE----VENEILMLKSKRLTAIVVDKL-
T2NDT6          EKSGATSGLQQFQELG--------LM---IGNSE----VENEILMLKSKRLTAIVVDKL-
W1R7P9          EKSGATSGLQQFQELG--------LM---IGNSE----VENEILMLKSKRLTAIVVDKL-
A0A1R4AFZ0      EKSGATSGLQQFQELG--------LM---IGNSE----VENEILMLKSKRLTAIVVDKL-
A0A1R4DVZ7      EKSGATSGLQQFQELG--------LM---IGNSE----VENEILMLKSKRLTAIVVDKL-
A0A2A8CVM9      AQSGPGGMG---------------AF---GQQRD----LASEVGVLQYSAELASRVVAEL
A0A5M4B212      QNQSPLTTPTDSEANVFQG---FGLF---QGTQN----TENQIQILKSWTQIRKTLEHF-
A0A3D1KEX9      DNNGKYANNSALNALKQLN---GVQV---TDN------LKNEIFILQSRRLMEMVVERM-
A0A358Y7S2      NKT---------RDILGKD---ALNV---EKALN----LNQEVELLRSELLINKVIEKL-
A0A1X7J248      SE----------ASVFGFN---P--L---SEESSNLNTLSGEVELIRSKLFLKQVINKL-
E4TQD2          SE----------ASVFGFN---P--L---KEENSNLNTLSGEVELIRSKLFLKQVIDKL-
A0A2J6HHN3      DK----------GQMLFET---KNLY---DED------IYRKIEVMRSPVFIRRVVSRL-
A0A1Y3WMT8      DKQGGGGALSSLVGDVTGG---G-FS---LDGMIGGGSVNDEILVISSHTIIREMVQRL-
A0A1Y4GQU1      EKKGSSGSLSSLMSGVSGG---G-FS---LDGMIGGGSVNDEILVISSHTIIREMVQRL-
A0A6A0R272      SSNV--------TDFLAID---M--F---SESFNQYNKILTEARIISSRTMIEKALEKL-
A0A1V5W8T5      QN----------EDLLKID---N--I---YGQTS----ITNLIELIRSREFLKRTLHKL-
A0A2T8HKA9      QN-TNVTARFTRSSMMNTV---S---------------VASEILQLKSKELMRHTIATI-
A0A2I0QZ80      NQG---------ADLLDLS---D--V---RTEGS----IAKEIELLRSQLLFKKAIKQL-
A0A3E1F1A3      NQG---------ADVLGFA---E--A---RSDGS----IAKEIELLRSQMLFEKAVQNL-
A0A2U2XBJ3      NQG---------ADVLDFK---D--I---RKEGT----IAKEIELLRSQLLFEKAVADL-
A0A4Q4KU94      NQG---------ADLLDFK---D--A---RKDGS----IAKEIELLRSQLLFEKAIDDL-
A0A3B8INU3      SE----------ATLFGFS---N------FNENPNLNYLSGEIELLKSRLFFSQVISAL-
A0A2W1NDY9      DEG---------QRILEFK---D--F---NTENN----LSADVELLRSPFLMEKVLMNL-
A0A5C8AQR5      DQA---------KDVLNME---N--I---NSKSN----VSSEIELLKSQFLFEKAIDKL-
A0A1G0CI31      DQG---------KEIVEIE---N--I---NTKDN----IASEIELLRSELLFGMAVERL-
A0A556N0M0      DQA---------KELLELD---N--I---NKIDD----ISSEIELLRSQLLFEMAISKM-
F2IKD6          DQG---------KQLLEID---N--I---NKRID----ISTEIELLRSQLLFDMTIARM-
A0A1I7BM74      DQG---------ANVLDLK---N--V---NNDGN----ISKEIELLRSQFLFEEALKRL-
A0A2G2FJ17      DQG---------ADVLDFK---N--I---KEDAS----ISREIELLRSEYLFEKALDRL-
A0A2E3R1D0      DTDLADVLPEAMP-----S---G-FW---RQERN----LSNELLVLDQSMPLAEAVAAR-
A0A2T2USC0      QRQVSSILGEQGSSF---S---P-FG---SQ-NN----LANEVLVANQSEAITRNVATR-
A0A2T2V0F3      GEGVSSILSESG-SM---N---P-FG---SR-RN----LANEVLVANQSEAITRNVAVR-
A0A2T2S682      QSR-SAVPSLTGGRSSGAS---A-LG---GQRRS----LSNQILVINQSEALAQEVAVR-
D5H561          QQS-GTESAIGAQAQAQGS---G-LL---PSSSS----LRNELMFLRNSQALRERVAER-
A0A2H3NWA9      SPS-TLVS--TRGRM---V---P-GL---AGNRS----LSNQLFVLRQSRELAQRVADR-
A0A2A8CVB6      SQSGGVVAQLSSRGL---S---P-YS---AESRT----LQNELFVLQQSMTIPNRVADS-
A0A2P6C1S6      QQS-SVLSGLGRGRT---S---P-FL---QQDQT----LQNELLILRQSRTIANRVARQ-
A0A2T2UTM4      GQT-SVLSGLGRGRR---S---P-FG---QRDQT----LQNELLILRQSRTIARRVAKR-
A0A414ZBF2      QGGGNMGESAAFRDVFSLG---N-------------SKVDNEMGFFKSKRLMMEVTRQL-
A0A1Q3Q573      KS----------TQILGID---NLVF---EKDPTE---INREMQVLKSTMLLGKIADKL-
A0A662BAY3      NSNSPLTNKNANEDNVFQG---FGIT---DSDRN----IFNQLIVLTSTPILNRTLEEL-
A0A4U3L369      SGGSSGSSSL--SASSGIF---Q-DL---GGAFSMASTVNNEEEILLTRSLMYRVVKDL-
A0A357YNR3      QK----------GGASEVT---TFRE---MGIVSRRNNADNEVEILKKTMIVEKVVRDL-
A0A5E8AX52      NE----------AVILGVQ---NPLE---NSGVNS---LSGEIELLKSNLFFSRVVEAI-
F4KK08          TSIN--------SAIERLA---Q-FT---GDKHSYSDDVSNQIIILGTERVVSETVRRL-
A0A6B5PK86      DN-A--------KNVIDVE---N-IN---SKKDV----FFSEVELLRSELLFKQAMNSL-
A0A2G2F510      DT-A--------KEVLDFQ---N-LG---SRDNQ----LSGVVELLRSELLFKRAVKSL-
A0A316JZ08      DK-A--------ADVIDFE---N-IN---TLDDD----ISAVVELLRSELLFERAVDKL-
A0A496LCF9      SGSL--------SYMQNMT---QNFG---VVDKTN---IENQILLLRSQDLIARTIDSL-
A0A5P2G2A9      QKGGMSGMLGSSSSGSNSS---FGDL---SSLLNVKSSVDNELLILQTRDLMHKVVVDM-
A0A3C0ZQC7      GQ-QSQMPLFDVTGIGAVK---N---------------IKNELEILKSRSLAEAVAVRL-
A0A419VXB7      ESSG-----------VDLQ---NIFS---SSPLKSDVKLSNHIEILKSFSLNYEVLENL-
A0A0B0BTJ4      YNRSSNSDL---TGFMPGR---M-MY---RTNSG----VEDELLIMGSRSIMERVVAEL-
A0A3B9CNN6      YNRSSNSDL---TGFMPGR---M-MY---RTNSG----VEDELLIMGSRSIMERVVAEL-
R5X290          YNRSSNSDL---TGFMPGR---M-MY---RTNSG----VEDELLIMGSRSIMERVVAEL-
A0A1Q6E6I7      YNRSSNSDL---TGFMPGR---M-MY---RTNSG----VEDELLIMGSRSIMERVVAEL-
C3J7R8          MDAS--------NVLSELF---ESSA---LTSLGGRSAVENELFILKTDFLIDQVIERL-
A0A1G8BVM8      KKGGGGI-----SEAAAFQ---DMFS---MGSNS----VYNEMGILKSRQLMLQVVEQL-
A0A1I1FXP9      QQ-A--------SGLLSRV---Y-SA---TGEEMQSSNLSGEIELITSFMLYNKVIDKMG
A0A3N4H5N3      DR-P--------TTVAESS---VLNE---LDNLKTSIKLENEIEKLKSKSLMNEAVISN-
A0A2P8EAX2      ER-A--------GNLTESP---ILSD---LENIKTTVKLDNEIEKLRSKSLLNEAVISK-
A0A4V2F6N9      ER-A--------GNLTESP---ILSD---LENIKTTVKLDNEIEKLRSKSLLNEAVISK-
A0A3B9FXJ0      DP----------SSSLDFA---DILR---PGNVDR---LNEEMTVITSKSYKYNALQEL-
R5GSU5          DGSSGSRRMPSNMNALLEL---N-GI---TAGDQ----LQNEIFILQSHRLIERVVTRL-
A0A2A3UE91      NQ-A--------DDILKLN---S-LS---NNGNV----LAEAIEQIRSKVFLKRVVEKL-
A0A0A2G557      SDISGPL-----ADIMKIS---G-TD---IGGIKGNDKIENEIIIFRTERLLSRVIDEL-
A0A2N2WFW8      DK-A--------QKLFESK---N-FY---DED------IYRKIEIMRSPVFMERVIEKL-
A0A1F3IU95      DK-A--------EKLFDNK---T-YY---EDD------IYRKIEIMRSPVFMQRVVSNL-
A0A3D0VUF6      DK-A--------EKLFDNK---T-YY---EDD------IYRKIEIMRSPVFMQRVVSNL-
A0A1T4PT95      SNMSGPLADI--MKISGAE---L-GF---KGTDK----IENEIIIFRTHNMLSQVVNRL-
A0A6I6JYY3      KVTSPLEESGVSANVFQGF---G-VM---NSMRN----IFNQMVIMHSTPLITRTINEL-
A0A2A4PYG9      NT-A--------QKVLNVE---N--I---YEQ-D----VAGEIELIRSRAFLSNALSRI-
A0A1F3K695      NQ-A--------DKLLNLE---S--V---YENTN----LAHVVELIRSKEFLKRAFEKL-
A0A353KZR1      NQ-A--------DKLLNLE---S--V---YENTN----LAHVVELIRSKEFLKRAFEKL-
A0A2N2WYB5      DR-T--------TRLLNIE---D--V---YQNDD----ISKVIELLRSKEFLKRAFSNL-
A0A1F3K4G0      NN-T--------TKVLKIE---D--V---YQDND----ILKVIELLRSKEFLKRTFLKL-
A0A356H8Y3      NN-T--------TKVLKIE---D--V---YQDND----ILKVIELLRSKEFLKRTFLKL-
A0A351HSA6      NN-T--------TKVLKIE---D--V---YQDND----ILKVIELLRSKEFLKRTFLKL-
A0A1F3Q014      NQ-A--------SKLLNVG---N-IT---EPDNG----LAEGIELLKSKVFLKRVLSQL-
A0A2A4YXP3      NT-A--------SSVLNVG---G-GF---KESNS----LAKDVEILRSKLLFKRALRKI-
A0A2D5KD44      NQ-A--------NRLLDVE---D--Y---YESND----ISSEIELLKSPLLMEATLEKL-
A0A1F3R158      NT-A--------DQVLKVD---N--F---EEKED----VEKDVELLKSKFLLKRALSKL-
A0A2M8ADX2      NT-A--------DQVLKVD---N--F---QEQED----VAKDVELLKSKFLLKRSLLKL-
A0A1J5B2H0      NE-A--------QKIFQTN---NINV---EEDNN----LAKQIELMRSSLFLNRVISKL-
A0A1V5N756      EE-V--------RQVFGKK---T--------QVD----LAKKVELLNSSMFLSRVFSKL-
A0A651GU15      DN-A--------TKILQVN---K-IY---EEKT-----LSAELELLRSKLLLQETVKRL-
A0A3Q9FR88      SSSQDF------AEKFGIM---N-NS---LNDGK----LESEMALITSGVTYNRVIDSL-
A0A553GEX3      SSSQDF------AEKFGIM---N-NS---LNDGK----LESEMALITSGVTYNRVIDSL-
A0A150ADJ9      SSSQEF------AEKLGLM---S-NS---LNDGK----LESEMALITSGVTYNRILDSL-
A0A1B1FWQ4      SSSQEF------AEKFGIT---N-SS---LEEGK----LESEMALITSGVMYERIVDSL-
A0A1S1Z228      SSSQEF------AEKFGIA---N-SS---LEEGK----LESEMALITSGVMYERITDSL-
A1ZKR2          DE-G--------VGMLGIK---G-LI---PGGSYSGGNLVGEIEFIRSQIIFNDVINAM-
A0A1Q3GX01      DE-G--------VQMLGIK---Q-LI---TNNN-SNGNLIGEIEFIRSQIIFNAVINTM-
A0A349DQI4      DE-G--------VQMLGIK---Q-LI---TSNS-INGNLIGEVEFIRSQIIFNSVIDAM-
A0A4P5TMD1      NTSSSLGIGVTSGGVNSAD---Q-MD---HNE------LQKNIQIMKSNVILDRVIDQL-
A0A2N3IIZ0      DE----------SAGLDL----R-IG---LNQENPIDNIAGELEVIRSPLIYEEVLKNI-
A0A1F3SJM1      DE-A--------KDVLNID---N-LN---VRGDQ----LSSVVELLRSELLFERAIAHL-
A0A2G2EB96      DS-A--------KDVLDIE---N-IN---SRDNE----ISSVVELLRSELLFERALNKL-
A0A2G6PRA9      DN-A--------KDVLNIE---N-IN---SREND----MSGVVELLRSELLFEKALNKL-
A0A497D5Z2      NTGSPLSGNMNNGDVFQGF---S-LM---GSDYN----LFNQMAVLKSKPLIRRVVDEL-
A0A662B170      NTGSPLSGNMNNGDVFQGF---S-LM---GSDYN----LFNQMAVLKSKPLIRRVVDEL-
A0A2A5FYT6      NT-A--------SQILEAT---P-AY---LRQD-----ISGDIEFLRSKEFFKNILNTL-
A0A2E6SYP1      ND-V--------NQMMNFE---N-IY---ETN------LVAEMSRLKSKKMLSEALADL-
A0A2E5RLE8      ND-V--------NQMMNFE---N-IY---ETN------LVAELSRLKSKKMLSEALNTL-
A0A2E7TQF6      ND-V--------NQMMNFE---N-IY---ETN------LVAELSRLKSKKMLSEALNTL-
A0A2E6GVY9      ND-V--------NQMMNFE---N-IY---ETN------LVAELSRLKSKKMLSEALKTL-
A0A350JJ90      NQ-A--------NRILNV----G-DI---YEDAD----ISKDIELLRSPEFFKRVIANL-
A0A3M1CDV2      D--A--------HQILQLN---P-AN---TEGNNK---VAEAIEQIRSKTFLERIINNL-
A0A6C1QGZ7      FQ-A--------TRILPTA---G-IY---EED------IARQLELMRSDVFLQRALSRL-
A0A4P5U6G4      N--T--------SKAIGLD---N-IG---LEASRGNADLQRDIQVMKSNLIMDRVLDKL-
A0A2E2TFD1      NQ-A--------SQLLEID---F-GK---NQNED----MMSDLEVIRSKEFLKTIFKKL-
A0A2E4ELE6      NR-A--------TQVLDLE-----RM---NEKAD----ISADIEIIRSKEFLKTIFAKL-
A0A522EYA6      NQ-A--------SRILNVD---N-FN---EAQND----IAKSIELLRAKVFFKRVLATL-
A0A2E3XZI5      DE-P--------LEFMQMN---P-LS---SNSTN----LKSELAIIKSQKSILRLIKKL-
A0A6I7QXV0      K--T--------AQILGTD---E-LL---RGDDD----VSREIQIIRSRLLVARALEHL-
A0A2M7NLQ9      G--T--------SELLGR----G-IF---SSDENVTNFLVGEIELILSRSVYEEAVKRL-
I4AFR0          G--T--------SELLGK----G-IF---ASDENAINFLSGEIELILSRSVYEEAVKKL-
A0A2N2Y3E5      ADKT--------NKILNI----Q-NI---YDEFN----PNQTIELIRSKEFIKRVIKSL-
A0A2D9D7T6      DR-V--------KEVLGK----D-AF---TDRESADGGLSKYIELLKSEFIFEKAVERL-
A0A1F3PPL5      NN-A--------DKVLEI----E-NL---REENT----IAQTIELLRSQEFLKRVFSKL-
A0A357QK06      NN-A--------DKVLEI----E-NL---REENT----IAQTIELLRSQEFLKRVFSKL-
A0A662AEA4      GSKA--------QKILNI----E-DI---YEKKD----ISNVIELLRSKEFLKRVFKKL-
A0A0S2HYK8      KK-T--------SQVFQLD---D-LY---EDNKK----LNKTIALIRSKEFLKRTFAKL-
A0A2N5ZWN6      NK-N--------TQVFQLD---N-LY---EDNKK----LSKTIALIRSKEFLKRTFSKL-
A0A2E0FJ09      DN-A--------RRILNVK---N-PL---QEDET----LTGDVELLRSPLLMEKTVASL-
A0A1F3FZ62      NS-A--------NKVLQTA---N-IY---DGEND----ISKTVELLKSKVFLKRVFSKL-
A0A1F3K211      NS-A--------NKVLQTA---N-IY---DGEND----ISKTVELLKSKVFLKRVFSKL-
A0A1V6I2U9      NK-T--------NQILGI----S-SN---LMEKD----LAPVIELIRSNEFLKTVVEVL-
A0A2H0B957      NTNA--------NKILNL----T-NA---VEEIN----SIQTIELIRSKEFLKKTFNKL-
A0A1F3CFW6      GTTA--------NKVLNL----T-TA---VEEIN----SMQVIELIRSKEFLKRTFNKL-
A0A2M7E2T8      GTTA--------NKVLNL----T-TA---VEEIN----SMQIIELIRSKEFLKRTFNKL-
A0A2M7NC69      GTTA--------NKVLNL----T-TA---VEEIN----SMQIIELIRSKEFLKRTFNKL-
A0A1F3KLL5      NQ-T--------AEILGFK---N-NF---IKPSE----LPAVMELIRSNEFLKRVFVKL-
A0A359D1M1      NQ-T--------AEILGFK---N-NF---IKPSE----LPAVMELIRSNEFLKRVFVKL-
A0A0F2NS19      NT-A--------NKVLQV----D-NF---SKTED----VAKDVELLRSKLLLKRALSKL-
A0A2A5H8X6      NT-A--------NKVLQV----D-NF---SKTED----VAKDVELLRSKLLLKRALSKL-
A0A2H0GAU8      NT-A--------NKVLQV----D-NF---SQKED----IAKDVELLKSKLLFKRALSKL-
A0A2M8FTK1      NT-A--------NKVLQV----D-NF---SQKED----IAKDVELLKSKLLFKRALSKL-
A0A2A5B3B0      NT-A--------SKVLEV----R-EF---QETNS----LSKDVEILKSKLLFKRALKRI-
A0A5C6RXM7      NT-A--------NQVLNV----D-NF---HENNT----IDKDIEILRSKLLFRRAISRL-
A0A1F3C1M2      NQ-T--------NQLLNI----E-NV---SDNNE----LAQIIELIRSTEFLKRTFNKL-
A0A1F3DS87      NQ-T--------NQLLNI----E-NV---SDNNE----LAQIIELIRSTEFLKRTFNKL-
A0A6A0R6K9      NQ-A--------NRLLDV----E-DY---YETND----ISAELEILQSNIIVERAIKSL-
A0A2E7CT70      DK-A--------DELLEI----Y-SF---QQKTN----INSEVELLKSQIIIDKAIKKL-
A0A2D5V560      EQ-P--------NGFSDL----Y-SY---NINTN----LNSEIALMNSEKAIEKVIRDI-
A0A2D7K5A8      EQ-P--------NGFSDL----Y-TY---NINTN----LNSEIALMKSQKAIDRVIEDL-
A0A2E1XQ82      EQ-P--------NGFSDL----Y-TY---NINTN----LKSEIALMKSQKAIDRLVEDL-
A0A5C8A5B4      KRTGFS-------------ENSEFIKGTSYLSNSV--DLEDNLAVLTSNKIMTSTLQRL-
A0A4Y9ITE2      -DTKSDFLRSF--------SMADM------FGGK--SSVDDEIAIMYSHSLFSEIVKKF-
A0A5M8NYX7      -QKGRTAMDMN--------TFSDL-G---FMPKI--GSFDNEIEVLQSKTLMKEVVDSL-
A0A3D5KRY6      ---SKTTDLNN--------IYRQL-S---TIQGG--PAIQDEVGVLQSYNLSLQTVKYF-
A0A1V5IPN7      -------SSGA--------DILLLTN---QGGGK--NSINNQIELMRSKPILNAAYEIM-
A0A0E3V905      ---QKGSEQSS--------SLKEL-G---VFAHK--QVVENEIEILRSFTLMNRVADKL-
A0A553ETH6      -------ANAS--------ELGLV-N---FGENNNINVISGEIELIQSRLFFNKVIDNI-
A0A640Q161      ------KANVV--------SIEEV-Y---GLDTKRKDYMQTQYEILQSRQIAERTVESL-
A0A640QU49      ------KANVV--------SIEEV-Y---GLDTKRKDYMQTQFEILRSRQIAQRTVESM-
A0A1Q3PII2      -SRGSDFNESA--------LLEEL-G---LPNAT--SSVENEIEILRSRTLLSQVVADL-
A0A351BXT2      ---QGSVLSSS--------LIPEF-Q---DFITD--RYISNEIEVLKSYKIREMVAENL-
A0A2K8Z965      ---QKGSEQNN--------TLKEL-G---VFTPK--QVVENEIEVLRSFTLMNRVVEKL-
A0A418M8U8      ---KKGNERDQ--------PLKEL-D---AYVPK--KVVENETEILRSYTLMNRVVDKL-
I2GTA4          ---KKGNERDQ--------PLKEL-D---AYVPK--KVVENETEILRSYTLMNRVVDKL-
A0A2K8ZAJ2      ---RKGISEQS--------AMKET-N---IFTQT--KLVENEIEILRSYSLMDRVVTNL-
A0A368JPA3      -PPKSGVSSDG--------ILKDL-T---TYSPG--KVIENEIEILKSSSLMKKVVDSL-
A0A5N1JI29      -PPKSGVSGDG--------ILKDL-T---AYSPG--KVIENEIEILKSNSLMKKVVDSL-
A0A3P1BT12      ---QKSPSDNG--------VLKEL-N---IYSPS--KVVENEIEILKSNSLMKKVVDSL-
A0A3P1CI15      ---KDNVADEG--------LLKQL-H---IYSPN--KVVENEIEILKSNSLMKKVVDSL-
A0A4R8CUK1      -PRIGA--DES--------IPADP-D---NRNQQ--TVVDNELEILTSNSLMKKVIDTL-
A0A3D0MYJ7      -------KQQS--------ILTGL-S---VPEGSAGSDIQSQIAIMKGYYVREIVAKSI-
A0A662AH13      -PSSGGILDAP--------LLPEF-S---SFGDD--RFIANEIEILKSYRLRTMVANAL-
A0A5C7QA01      -KGASS----A--------LLGDLSS---MIEQK--SPAQAEIEILRSRLVLGEVIGQL-
A0A3D3LS70      --PQGSLLTSN--------MIPGF-S---DYASD--RSISNEIEILKSQTIRSLTATAL-
A0A1G1TM36      -NKQPG--ERS--------ALQEL-D---FANGN--NVLESEMEILRSRRLMQQVVQTL-
A0A1G7ZF38      -SRGSDFHETA--------LLEEL-G---LPDAT--SSVENEIEILKSRTLLSQIISDL-
C6VS52          -SRGSDLHETA--------LLEEL-G---LPDAA--GSVENEIEILKSRTLLGQVVDDL-
A0A2A4G4B1      -TNSIP---DELS------VFDDLGM---VSGSAS--TLEDEIQLFRSRPLIKQMVEKH-
A0A0P7X1V8      -GNRYSMAGSDLSNL----MVSNF-G----IGMGS--SIENEIHVLQSRTFTGELAQRI-
A0A5C8KAD6      -KKGVNDSK----------MTESI-D---AFITSK--IVENEINVIHSRTLMKQVVNKL-
A0A5N1J695      -KKGINDPR----------MMEAI-D---AFASSK--LVDNEIKVIQSRGLMNKVVDTL-
A0A1H4ADG3      -TGQNNSPQSNGIS-----SLQSL-G---LFPGAS--NVDNERDILVSYPLIHQVVSDL-
A0A5B8VUR8      -DGKSPAPQNNGIG-----SLESL-G---LYPRSS--TVDNEREILVSYPLIHQVVTDL-
A0A3N2M1H3      -EGGSGVP--DMAG-----VFSSF-G---LVSSNT--SVYNELISLKSPAVMYEVARRL-
A0A4S2G8T2      -EGGSGVP--DMAG-----VFSSF-G---LVSSNT--SVYNELISLKSPAVMYEVARRL-
A0A1T5K9D4      -SNTRATT-----------KLDNY-S---NLINSV--SMSNEMLQLKSKTLMAEVVKDL-
A0A077ENE7      -SNTPTTA-----------RITR--S---FGANTI--SVKDEILQLKSKELMRLVVDKV-
A0A6I5UW06      -SNTPTTA-----------RITR--S---FGANTI--SVKDEILQLKSKELMRLVVDKV-
T0NN57          -SNTPTTA-----------RITR--S---SVASSV--SVKDEILQLKSKELLRQAIDRT-
X5K347          -SNTPTTA-----------RITR--S---SVASSV--SVKDEILQLKSKELLRQAIDRT-
A0A212K7W5      -SAKGGML-SDNIN-----TFSDM-G---LFKSNT--NINNEILTFKSPLLMQEVVQRM-
F5IU11          -SAKGGML-SDNIN-----TFSDM-G---LFKSNT--NINNEILTFKSPLLMREVVQRM-
A0A6I1IYY4      -GKTANSDISAMLE-----LQGGV--------TGS--GVENEMYILRSHQLVREVVNRL-
K0XJ09          -NKSGN-DMSAVLE-----LNGGI--------SGS--GVENEIYILQSHQLMREVVGRL-
R5EUZ0          -NKSGN-DMSAVLE-----LNGGI--------SGS--GVENEIYILQSHQLMREVVGRL-
W0EQS0          -NKSSN-DMSAILE-----MNGGV--------SVG--SVDNEIYILQSHQLMREVVERL-
A0A1Y3WE15      -NKSNN-DMSAIME-----LNGGI--------SGS--GVDNEIYILQSRQLMREVVERL-
A0A1Y4GUK3      -NKSNN-DMSALLE-----LNGGI--------SGS--GVENEIYILQSRQLMREVVERL-
A0A352Z1R7      -RGQGVLV--------------DM-----TFDQSN--SIDAELEIIKSRTNIEQVAKRL-
A0A3N2N6F7      -EAGSSSQ--SITS-----ALSDM-G---LFTTST--NVANELLAFQSPALIGDVIERL-
A0A4P7VVU7      --TESGSQ--GVAS-----ALSDI-G---LFQSSA--NVNNEMLAFQSPAIIADVIQRL-
A0A2V1ILM4      --TESGSQ--GVAS-----ALSDI-G---LFQSSA--NVNNEMLAFQSPAIIADVIQRL-
A0A3N2L0E8      --TESGSQ--GVAS-----ALSDI-G---LFQSSA--NVNNEMLAFQSPAIIADVIQRL-
A0A3N2LFC5      --TESGSQ--GVAS-----ALSDI-G---LFQSSA--NVNNEMLAFQSPAIIADVIQRL-
A0A0A2F501      -SKGKGLS-LNDQF-----SFGDM-G---LLQSNT--NVNNELISIQSPTLTLEVVRRL-
R5B7P0          -TKGASMP-GDI-G-----EFGNM-G---LFAVKS--NVNNELHAFESPDIMSEVVARL-
R5B0L5          -SQGASIS-----D-----TFAEM-G---LVQTNS--NVNDEISKLQSPDIMLEVAKRL-
A0A6I1TEC0      -SKGSSIN-NDVES-----MFSDM-G---LGGTKS--NVNNELIAIKSPSVLLEVGKQL-
A0A3R5XWG1      -SKGSSIN-NDVES-----MFSDM-G---LGGTKS--NVNNELIAIKSPSVLLEVGKQL-
A0A646GTR1      -SKGSSIN-NDVES-----MFSDM-G---LGGTKS--NVNNELIAIKSPSVLLEVGKQL-
A0A5P0Y910      -SKGSSIN-NDVES-----MFSDM-G---LGGTKS--NVNNELIAIKSPSVLLEVGKQL-
A0A414YFM3      -SKGSSIN-NDVES-----MFSDM-G---LGGTKS--NVNNELIAIKSPSVLLEVGKQL-
A0A6A7UIA7      -SKGSSIN-NDVES-----MFSDM-G---LGGTKS--NVNNELIAIKSPSVLLEVGKQL-
A0A6A7VPS3      -SKGSSIN-NDVES-----MFSDM-G---LGGTKS--NVNNELIAIKSPSVLLEVGKQL-
A0A374THP7      -SKSQGIS-SDVSS-----MFADM-G---LGNAKS--NVNNELIAIQSPAVLLETGKRL-
A0A6G1VND1      -SKSQGIS-SDVSS-----MFADM-G---LGNAKS--NVNNELIAIQSPAVLLETGKRL-
A0A0A2EVS5      -DKPGASL-AQDIG-----GFADM-G---LFSKST--NVHNELVSLRSPATLLEVIKRL-
A0A1T4NAJ7      -DKPGASL-AQDIG-----GFADM-G---LFSKST--NVHNELVSLRSPATLLEVIKRL-
A0A255T941      -AKGKSSN-LI--S-----DFADMGG---LFKSNT--NIKNELSTIKSPNLMTEVVKRL-
A0A3N2KCL3      -AAGKSAG-A---E-----DFGDF-G---LFQNKT--NIQNEITTLKSADLMEEVVRRL-
A0A4P7VSV0      -AAGKSAG-A---E-----DFGDF-G---LFQNKT--NIQNEITTLKSADLMEEVVRRL-
A0A2V1IJY1      -AAGKSAG-A---E-----DFGDF-G---LFQNKT--NIQNEITTLKSADLMEEVVRRL-
A0A4P7VXK7      -AAGKSAG-A---E-----DFGDF-G---LFQNKT--NIQNEITTLKSADLMEEVVRRL-
A0A1Y4CHN5      -GKGQSIS-SDVSS-----AFASM-G---LVQSNT--NVNNEVIALQSPAIMTDVVKRL-
A0A1M6I2S6      -TKSGSST-TM--S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVRRL-
A0A1Y3V692      -TKSGSST-TM--S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVRRL-
F3PXM2          -SKGGATS-GSM-G-----EFADF-G---LFKSNT--NINNELLTLASPTLMTEVVKRL-
A0A3E4ZNL4      -SKNGSST-SAM-N-----EFADM-G---LFKSNT--NINNELLTMKSPTLMTEVVRRL-
A0A174AHH7      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A174JCE8      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A3E4JMC4      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A412SND6      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A414IEQ9      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A415UKN5      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A6I0U0V8      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A6I2PDH7      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A0M1W8D8      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A3R6GKX5      -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A7V4S1          -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
B0NU19          -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
D4V601          -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A4Q0U3M9      -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A4R4H1Q2      -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A6I0GII7      -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A6I0KYU7      -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A397WLT5      -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A6KY94          -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A173UQR8      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A3R6HK75      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A412B7D1      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A412VNY9      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A414LTU9      -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
I9Q4U4          -SKNNSSA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A6A2J529      -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A3R6GM96      -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A015XH67      -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A078RZN2      -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A4R4I3T9      -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A6L0K5          -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A7ACT5          -SKNNSPA-SAM-N-----EFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-
A0A373ISF0      -SNSGSSG-GAM-S-----EFSDM-G---IFRSNT--NINNELFTLKSPALMTEVVRRL-
U6RF62          -SKSGSSG-GAM-S-----EFSDM-G---IFRSNT--NINNELFTLKSPALMTEVVRRL-
A0A662ZZD5      -SKGGTST-NVV-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A3A5TI83      -SKGGTST-NVV-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A415NEB6      -SKGGTST-NAV-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A6I0I238      -SKGGTST-NVV-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A7AJ60          -SKGGTST-NVV-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A6A2JF01      -SKGGTST-NVV-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A6I0Y2Y2      -SKGGTST-NVV-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A6I2Q447      -SKGGTST-NVV-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A395YYT3      -SKGGTST-NVV-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A015UXN7      -SKGGTST-NVV-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A5M5W148      -SKGGTST-NVV-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A6I2NTL0      -SKGGTST-NVV-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A016E4F9      -SKSGSST-NAM-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A4Q5CFJ7      -SKSGSST-NAM-S-----EFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-
A0A6H9P0U9      -SKSSSST-SAM-N-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
A0A108TH71      -SKSSSST-SAM-N-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
I8VXH0          -SKSSSST-SAM-N-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
A0A412S0N6      -SKSSSST-SAM-N-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
A0A412IIJ0      -SKSSSST-SAM-N-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
A0A0P0FM97      -SKSSSST-SAM-N-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
R6KTP3          -SKSSSST-SAM-N-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
A0A139LU87      -SKSSSST-SAM-N-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
A0A1C6B3Y5      -SKSSSST-SAM-N-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
E2NMQ4          -SKSSSST-SAM-N-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
A0A412YDB9      -SKSSSST-SSM-S-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVSRL-
R7DY01          -SKSSSST-SSM-S-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVSRL-
A0A414LGK8      -SKSNSST-SSM-S-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVSRL-
A0A415IPQ4      -SKSSSST-SAM-S-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
A0A3E5BRW7      -SKSSSST-SAM-S-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
K9DXS6          -SKSSSST-SAM-S-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-
A0A1M6KFV3      -SKSNSST-NAM-S-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVSRL-
A0A1Q6G7L3      -SKSNSST-NAM-S-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVSRL-
A0A413H235      -SKSNSST-NAM-S-----DFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVSRL-
A0A1M5B2J8      -SKGKSAS-TDM-E-----SFADF-G---IFTTNT--NVNNEMGTLQSPDLMREVVTRL-
A0A255RCT5      -SKGKSAS-TDM-E-----SFVDF-G---IFTTNT--NVNNEMGTLQSPDLMREVVRRL-
A0A1Y4GLF5      -SKGNSIS-SGM-E-----TFSEF-G---LFQSST--NVNNELLAFQSPAVMTEVVKRL-
A0A1H3XSC0      -SKGKSVS-SDL-E-----SFSEF-G---LFQSST--NVNNELVALQSPAVMTEVVRRL-
A6LE40          -SKGKSVS-SDL-E-----SFSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A4Y1VPX5      -SKGKSVS-SDL-E-----SFSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
B3JI46          -SKGKSVS-SDL-E-----SFSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
R6NN15          -SKGQSLS-GDVGA-----SFSDL-G---LFQPNT--NVNNELVSLQSPAVMYDVVKRL-
A0A358R8U0      -TKGQSLA-SDV-E-----SFGDL-G---LFQTTT--NVNNELLVLQSPSIMLEVVKRL-
R6WSB6          -TKGQSLA-SDV-E-----SFGDL-G---LFQTTT--NVNNELLVLQSPSIMLEVVKRL-
A0A401LPX7      -SKGKSSS-ADM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
A0A6I0J0P8      -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLQSPDIMREVVSRL-
A0A6I1BFM0      -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLQSPDIMREVVSRL-
A0A6G0GNY9      -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLQSPDIMREVVSRL-
A0A3A5Z900      -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
A0A285TGL6      -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
A0A3A5RFX4      -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
A0A1Q6IUW9      -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
A0A3R6NPG7      -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
A0A413XDP6      -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
K6AP24          -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
A0A6I2NHV3      -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
A0A662ZYI7      -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
A0A078RYI7      -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
C7XEQ8          -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
D7INX6          -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
K5ZG55          -SKGKSSS-TDM-E-----SFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-
A0A3N2N9B8      -SKGKS---AGMEE------FSDF-G---LISTKT--DVENEIINLRSGELMEEVVSRL-
A0A3N2NMI0      -SKGKS---AGMEE------FADL-G---LISSST--SVANEITNLRSGDLMEEVVRRL-
A0A359I8H7      -DGGGGVA--DISN-----AFSSL-G---LVSSNT--NVNNELISLSSPAVMYEVVKNL-
A0A3N2KA63      -DGGGGVA--DISN-----AFSSL-G---LVSSNT--NVNNELISLSSPAVMYEVVKNL-
A0A4Q0IMT7      -DGGGGVA--DISN-----AFSSL-G---LVSSNT--NVNNELISLSSPAVMYEVVKNL-
A0A3B9FAU3      -SPQRG---KDLNA-----MFANL-G---QNPDQS--NVNNEMAAIQAPSNVLETVKRL-
A0A3C1E5L7      -SPQRG---KDLNA-----MFANL-G---QNPDQS--NVNNEMAAIQAPSNVLETVKRL-
A0A4Q0UAV1      -ESGNGTL--AMPD------LSAL-G---ISNNSG--DLANEMIVIRSVDLLTDVVATL-
A0A354SN68      -NRRSASI-GNTSG-----IFNNL-G---IGKSYM--NTNDEVAIINSQTIALEVVQSL-
A0A3N2N595      -AKSNTPSMSVGGD-----EFANM-G---LFQNKT--NIQNEMTTFMSSDLMTEVVKRL-
A0A0A2DUD9      -DKGKSLS-NDMSS-----AFSEL-G---LFQSNT--NVNNELLSMKSPMLMEEVVRRL-
A0A3P1ZBJ5      -TKGGGRS---VEQ-----QLSQL-G---LFE-NT--SVSNEILSFQSPALMEDVVKRL-
R5FHS9          -DDSRSVSIDDIFS-----SASSG-G---ISTNSN--YVNNELIALQSPSIMLEVVKRL-
A0A413TW79      -GKSQSIN-SDVAS-----MFSDM-G---LSGGKS--NVNNELIAIQSPAVLLEAGKQL-
A0A3E5E9M7      -GKSQSIN-SDVTS-----MFSDM-G---LSGGKS--NVNNELIAIQSPAVLLEAGKQL-
A0A3E4SK73      -GKSQSIN-SDVAS-----MFSDM-G---LSGGKS--NVNNELIAIQSPAVLLEAGKQL-
A0A415GGC6      -GKSQSIN-SDVAS-----MFSDM-G---LSGGKS--NVNNELIAIQSPAVLLEAGKQL-
A0A413DBH9      -GKSQSIN-SDVTS-----MFSDM-G---LSGGKS--NVNNELIAIQSPAVLLEAGKQL-
A0A1Y4PQK7      -YRGRSIA-SDIEG------FDNF-G---LFRSAT--NVNNELIALQSPSVMTEVVKRL-
A0A1Y4IH41      -YRGRSIS-SDIEG------FDNF-G---LFRSAT--NVNNELVALQSPAVMTEVVKRL-
A0A3A6AAP4      -YRGRSIS-SDIEG------FDNF-G---LFRSAT--NVNNELVALQSPSVMTEVVKRL-
A0A6I0ZRD2      -YRGRSIS-SDIEG------FDNF-G---LFRSAT--NVNNELVALQSPSVMTEVVKRL-
A0A1Y4DYA7      -NKSNSPS-GN-AG-----VLYDL-D---LFQTGT--NVNNEIQSLQSPAVMYDVVKRL-
A0A1Y3X4I9      -SKGNSLS-NS-AG-----VLGDL-D---LFQTNT--NVNNEMQSLQSPAVMYDVVKRL-
A0A1Y4FNK8      -SKGNSMS-DA-AG-----VLGDM-N---LFQTST--NVNNEIQSLQSPSVMLDVVKRL-
A0A355FD59      -SKGKSMA-GDVSS-----LFSDL-G---LSQANV--NVNNELIAIQSPAVILETIKRL-
A0A359CEZ9      -SKGKSMA-GDVSS-----LFSDL-G---LSQANV--NVNNELIAIQSPAVILETIKRL-
A0A353Q7B4      -SKGKSMA-GDVSS-----LFSDL-G---LSQANV--NVNNELIAIQSPAVILETIKRL-
F8X3A5          -SKSQSIS-SDVAS-----MFADF-G---LSQPNT--NVNNELIAIQSPAIILETVKRL-
A0A1M3KVR9      -SKSQSIS-SDVAS-----MFADF-G---LSQPNT--NVNNELIAIQSPSIILETVKRL-
A0A4Y9IJS3      -SKSQSIS-SDVAS-----MFADF-G---LSQPNT--NVNNELIAIQSPSIILETVKRL-
A0A495WI87      -SKGKSLS-ADAGS------FADL-G---LIQANT--NVNNEIISLQSPAIMTDVVKRL-
A0A354M4S6      -SKGKSLS-ADAGS------FADL-G---LIQANT--NVNNEIISLQSPAIMTDVVKRL-
R7DH52          -SKGKSLS-ADAGS------FADL-G---LIQANT--NVNNEIISLQSPAIMTDVVKRL-
A0A4Q5E7L5      -AKGKSVS-SDMDA------FSDL-G---LFQSGT--NVNNELIAFQSPALITEIVKRL-
A0A4P8LP09      -SKGKSVS-SDLES------FSEF-G---LFQSNT--NVNNELIAFQSPALMTEVVKRL-
A0A4R4GZU7      -SKGKSVS-SDLES------FSEF-G---LFQSNT--NVNNELIAFQSPALMTEVVKRL-
A0A016CWA4      -SKGKSVS-SDLES------FSEF-G---LFQSNT--NVNNELIAFQSPALMTEVVKRL-
A0A1C6H117      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A0M1W0V2      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A139KA16      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A174VQ92      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A1Q6HCG0      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A1Y4JYM9      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A3A5QW67      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A3A5RQE6      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A3A6BP07      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A3E5E153      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A3Q9IP20      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A412WV15      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A413ICP6      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A414KYB9      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A5B3FWR2      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A6I0WNS4      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
E5WX00          -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
K0X3P3          -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A415TAH7      -SKGKSVS-PDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-
A0A078T2W6      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A6I1AQV4      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A5C6L2P1      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A412MJT7      -SKDKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A3E4WKT5      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A3A5YY33      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A078TAH2      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A1E9CFZ7      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A373FYU5      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A3A5TZ72      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A3A5XBP2      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A3A6MEG9      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A3E4JP35      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A3E4KP40      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A3E4NX82      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A3E4XFU8      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A412RG70      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A412TD37      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A413GAA4      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A414M7I4      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A496BTA0      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A496D2V6      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A4Q5G1P5      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A5C6KCA6      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A5M5AHM5      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A6I0KZV6      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A6I0Y5K7      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A6I1BFB8      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A6I2P5W5      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
E5UZA2          -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A069SMG6      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
C3RFN5          -SKGKSVS-SDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRL-
A0A3A5Z014      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-
A0A6I0ING7      -SKGKSFS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-
A0A6I2P894      -SKGKSFS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-
A0A078S3Q8      -SKGKSFS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-
A0A069SJV7      -SKGKSFS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-
A0A3E5DXI5      -SKGKSFS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-
A0A3E5EM98      -SKGKSFS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-
A0A3E5F453      -SKGKSFS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-
I9T3G6          -SKGKSFS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-
A0A3E4SYU0      -SKGKSVS-SDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRL-
A6LGY1          -SKGKSVS-SDLES------FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRL-
K5ZSH4          -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A6A2RTB3      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A6I0VY00      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-
A0A1M4YZ07      -SKGKSVS-SDLKS------FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-
A0A4Q5E5M7      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A0P0FQW1      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A5M5C0W6      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A6I0H151      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A6I0HI59      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A642LZ22      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A6I0IP89      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A642NJ89      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A6I0HI52      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A6I0YVB5      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A6G0G4T5      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A6I0HFG9      -SKGKSVS-SDLES------FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-
A0A416GA42      -ESGTRTP-SEAE------IFKEV-G---FMNLSG--NVENEILIFKSLHLAEQVVRRL-
A0A1T3IYP5      SNTPTTAR-ITRS------SVANVVS------------VKDEIIQLKSKELMRLVVDKV-
A0A3P1Z8V4      -SDSSHGG-MRSRSKNSLNTLMQLNG----INVGD--NLENELFILSSLRLMKQVVATL-
A0A060RD97      -SGSGQ---GEAA------IFADLGL---LSSTSS--LVDNEIFILRSASLMRTVVQKL-
A0A3C1ITV0      -NKGQAQI-SELA------AFADL-G---IGSTGI--DVYNELQAFQSPLLMQDVVNQL-
R7HN19          -NKGQAQI-SELA------AFADL-G---IGSTGI--DVYNELQAFQSPLLMQDVVNQL-
A0A350IHV0      -NENSA-M-KELA------SFTNAMS--LRRNSGA--NVYNEMESFTSPDIMSVVVDRL-
R5RVP0          -NENSA-L-RDLASFTGGVRYRSMNG--------S--NVYNEIEAISSPDIMQTVVKRL-
R6A0L2          NGSSTGGL-RRTSKNSGMNTLLELNG----VSVGD--NLKNEIFIISSKRLMSRVVDKL-
R7LG80          DSDPRSRM-VK----GNMSGLLELNG----ISVGD--NLKNEIFILSSKRLMTRVVDKL-
A0A2L2WX98      DGRSAMGR-KASSSMN---TLLELNG----ISVGD--NLKNEVFILSSQRIMERVVDSL-
A0A285T4L1      SNKTST-------------AGLDRYD---NYINKV--NVANEILQFRSKRLMREVVQRL-
G5GD56          ESGSGGGM-SRSARNNGLNTLMQLNG----ISVGD--NLKNEMFILTSERLMTRVVDSL-
R5KD55          NDKPTVLN-QLLN------DYVDF-G---FFADNT--NVNNVIAAIKSPDVMSEVVDRL-
A0A174QNT3      -NQNSQ---NDLS------AMLELSG----IPGGS--SVENEVYILRSYQLLNDVVQRL-
A0A4S2FGS1      -SQNSQ---NDIS------AMLDLNG----IPGGS--SVENEVYILRSYQLLNDVVQRL-
R9I0H0          -SQNSQ---NDIS------AMWEVSG----GLGGS--GVENEVYILRSYQILNDVVQRL-
K5BUT9          -EKSA----SDMS------AMLEVSG----GITGT--SVDNEIYILRSHQLLREVVNRL-
A0A174FPA3      -EKSA----SDMS------AMLEVSG----GITGT--SVDNEIYILRSHQLLREVVNRL-
R6S9Y6          -EKSA----SDMS------AMLEVSG----GITGT--SVDNEIYILRSHQLLREVVNRL-
A0A642LIH6      -EKSA----SDMS------AMLEVSG----GITGT--SVDNEIYILRSHQLLREVVNRL-
C9KX15          -EKSA----SDMS------AMLEVSG----GITGT--SVDNEIYILRSHQLLREVVNRL-
A0A6H0KRK1      -GKNAN---SDIS------AMLELQG----GITGS--GVENEMFILRSHQLVREVVNRL-
R6DAG6          -GKNAN---SDIS------AMLELQG----GITGS--GVENEMFILRSHQLVREVVNRL-
A0A3L8AAP1      -GKTAN---SDIS------AMLELQG----GITGS--GVENEMFILRSHQLVREVVNRL-
A0A4S2AYX2      -GKNAN---SDIS------AMLELQG----GITGS--GVENEMFILRSHQLVREVVNRL-
A0A4Y9H477      -GKTAN---SDIS------AMLELQG----GITGS--GVENEMFILRSHQLVREVVNRL-
A0A0E2M2Y7      -EKSGA-P-RSMK------QFEEI-G---LFMDNS--EVENEILVLKSKRLTAIVVDKL-
A0A0K2J6Z0      -EKSGA-P-RSMK------QFEEI-G---LFMDNS--EVENEILVLKSKRLTAIVVDKL-
B2RKZ8          -EKSGA-P-RSMK------QFEEI-G---LFMDNS--EVENEILVLKSKRLTAIVVDKL-
A0A212GC82      -EKSGA-P-RSMK------QFEEI-G---LFMDNS--EVENEILVLKSKRLTAIVVDKL-
A0A254MU12      -EKSGA-P-RSMK------QFEEI-G---LFMDNS--EVENEILVLKSKRLTAIVVDKL-
R6CQ93          -SNKTS-T-AGLD------RYDNYIN-------KV--NVANEILQFRSKRLMREVVQRL-
A0A3D1NQW3      -RKGGD---TDLA------TLSDLAG----LSQRR--NVDNEIYILQSRRLMTEVVKQL-
B0MT10          -RKGGD---TDLA------TLSDLAG----LSQRR--NVDNEIYILQSRRLMTEVVKQL-
R7JGW9          -RKGGD---TDLA------TLSDLAG----LSQRR--NVDNEIYILQSRRLMTEVVKQL-
A0A3D2BF46      -KKGSE---TDIA------AFGDLLG----ATARR--NVDNEIIVLKSRNLMTEVVRRL-
A0A358R538      -RKGGD---TDLA------AFSDLAG----FQNRR--SVDNEVFILQSRRLMAEVVRRL-
A0A1Y4AAB8      -RKGAN---MDIS------AFSDISG----FQSRN--SVDNEIYILQSRRLMQEVVRTL-
A0A1Y3WWY9      -RKGGA---PELS------AFSDLAS----FQTQR--SVDNEIYILQSRRLMSEVVRRL-
A0A1Y4U5L4      -RKGGA---PELS------AFSDLAS----FQTQR--SVDNEIYILQSRRLMSEVVRRL-
A0A1Y3VCJ1      -RKGGD---VELS------AFSDLSG----YQSRK--SIDNELFILQSRKLMTEVVRRL-
A0A1Y3QTW7      -RKGGD---MELG------AFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-
R6XWY7          -RKGGD---MELG------AFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-
A0A4Y1X9Y9      -RKGGD---MELG------VFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-
A0A4Y1WM66      -RKGGD---MELG------AFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-
A0A174AVF1      -RKGGD---MELG------AFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-
A0A656Q4F4      -RKGGD---MELG------AFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-
A0A1Q6EIY0      -RKGGD---TDLG------AFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-
A0A5B5VN71      -RKGGD---TDLG------AFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-
E4M8L3          -RKGGD---TDLG------AFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-
I3YQ50          -RKGGD---TDLG------AFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-
R5UEY8          -RKGGD---TDLG------AFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-
A0A1H4D866      -RKGGD---LELT------AFSDLAG----FQNRR--SVDNEVFILQSRRLMTEVVKRL-
A0A5B3G4Y7      -RKGGD---VDLT------AFSDLAG----FQNRR--NVDNEVFILQSRRLMTNVVKQL-
A0A374A9J5      -RKGGD---VDLT------AFSDLAG----FQNRR--NVDNEVFILQSRRLMTNVVKQL-
A0A5B3GQN5      -RKGGD---VDLT------AFSDLAG----FQNRR--NVDNEVFILQSRRLMTNVVKQL-
A0A1Q6E9S3      -RKGGD---VDLT------AFSDLAG----FQNRR--NVDNEVFILQSRRLMTNVVKQL-
D4IJ36          -RKGGD---VDLT------AFSDLAG----FQNRR--NVDNEVFILQSRRLMTNVVKQL-
A0A414Q925      -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-
A0A415PUS9      -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-
A0A108TCU0      -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-
A0A413BA42      -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-
S3Y344          -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-
A0A4Q5G8Y8      -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-
A0A412TGL3      -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-
A0A413VJ33      -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-
A0A414L0W6      -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-
A0A412DP39      -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-
A0A413ZSE8      -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-
B0NP84          -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-
R6AK43          -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-
A0A412N2D9      -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-
A0A1Y4JYS9      -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-
R6LHA4          -QKGGG-V-NGAA------AFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-
A0A3E5HPT8      -------A-NSRS------AMQLNNA---DFIGQV--NVASEILQFKSKELMRKVIDRL-
C6IJ48          -------A-NSRS------AMQLNNA---DFIGQV--NVASEILQFKSKELMRKVIDRL-
Q8A3U2          -------A-NSRS------AMQLNNA---DFIGQV--NVASEILQFKSKELMRKVIDRL-
A0A3R6S1H6      -SKGTSLA-SEAA------AFEDL-N---VLNTKS--SVDNEVLVFQSRNLMIEVVRRL-
A0A3R6SD81      -SKGTSLA-SEAA------AFEDL-N---VLNTKS--SVDNEVLVFQSRNLMIEVVRRL-
A0A354WXN6      -KKGGG-F-SEAN------AFGDL-G---ITMGSR--NVDNEVLVFKANRLMEMVVKRL-
R5IP14          -KSGG--F-SESA------MFKDL-GSMDMINVRS--SAETEMLIFQSYRLMQDVVSQL-
A0A316SZX7      -RRGGA-I-TESA------AFQEL-G---AFNIKS--NVDNEILLFESKRLMEEVVRLL-
A0A1Y4AIY1      -RRSSR-S-MSAY------GFSDLNN---MLGIQR--NVDNEVIVFKTYRLMEKVARRL-
A0A0J6CIR2      -SKG-GGL-SESA------AFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSVVAERL-
A0A3D8HG59      -TKGSGAM-SEAS------AFSDL-G---MFSMKS--SVDNEVLVFQSRQLMQNVVKRL-
A0A3R6S408      -TKGSGAM-SEAS------AFSDL-G---MFSMKS--SVDNEVLVFQSRQLMQNVVKRL-
F3ZRU7          KASGGANM-QGVA------ALTDL-A---DFGLKS--SVDNEILIFQSNSLLREVSTRL-
A0A1C5Q1F3      -TRGAQLP-NAAS------AFSEM-D---LLNIQS--TVDNEVLIFKSKRLMIEVARKL-
R7A239          -TRGAQLP-NAAS------AFSEM-D---LLNIQS--TVDNEVLIFKSKRLMIEVARKL-
A0A3R6HIK7      -QRKSR-A-ATTY------GFTDL-D---MFGLQR--NVDNEVIVFKAYRLMEMVARRL-
K5ZVW7          -QRKSR-A-ATTY------GFTDL-D---MFGLQR--NVDNEVIVFKAYRLMEMVARRL-
A0A1Y4D5Z0      -NRWGR-S-RSLY------GFSDL-D---MLSLQR--NVDNEVIVFKTYRLMETVARRL-
A0A413VXJ7      -SKGGG-I-SESS------AFADL-G---LFGGKR--NVDNEVLIFQSRHLMEEVARRL-
I9RSN9          -SKGGG-I-SESS------AFADL-G---LFGGKR--NVDNEVLIFQSRHLMEEVARRL-
U6RJK5          -SKGGG-I-SESS------AFADL-G---LFGGKR--NVDNEVLIFQSRHLMEEVARRL-
A0A1Q6GA32      -SKGGG-I-SESS------AFADL-G---LFGGKR--NVDNEVLIFQSRHLMEEVARRL-
I9RPU6          -SKGGG-M-SESA------AFSDL-S---LFGGKR--NVDNEVLVFQSRHLMEEVARRL-
I8YFS5          -SKGGS-I-SEST------AFADI-S---FLGGKR--NVDNEVLVFQSRHLMEKVARRL-
A0A6H9LTF8      -SKGGS-I-SEST------AFADI-S---FLGGKR--NVDNEVLVFQSRHLMEKVARRL-
I8Y597          -SKGGS-I-SEST------AFADI-S---FLGGKR--NVDNEVLVFQSRHLMEKVARRL-
A0A1Q6GBF5      -SKGGA-V-SESS------AFADL-S---LFGGKR--NVDNEVLVFQSRHLIEEVARRL-
I8YFZ3          -SKGGG-M-SESA------AFSDL-S---LFGGKR--NVDNEVLVFQSRHLMEEVAHRL-
A0A6H9M1J1      -SKGGA-M-SESA------AFADL-S---LFGGKR--NVDNEVLVFQSRHLMEEVARRL-
A0A1Q6GDH2      -SKGGG-M-SESA------AFSDL-S---LFGGKR--NVDNEVLVFQSRHLMEEVARRL-
U6RSB0          -SKGGG-M-SESA------AFSDL-S---LFGGKR--NVDNEVLVFQSRHLMEEVARRL-
I9GXM2          -SKGGG-M-SESA------AFSDL-S---LFGGKR--NVDNEVLVFQSRHLMEEVARRL-
I9SIK1          -SKGGG-M-SESA------AFSDL-S---LLGGKR--NVDNEVLVFQSRHLMEEVARRL-
A0A6H9LZ74      -SKGGG-M-SESA------AFSDL-S---LLGGKR--NVDNEVLVFQSRHLMEEVARRL-
I9TP59          -SKGGG-M-SESA------AFSDL-S---LLGGKR--NVDNEVLVFQSRHLMEEVARRL-
R5S343          -NKGGA-A-GEGR------VFEEL-N---LFNVKS--NVDNEVQVFKSTRLMSSVVRKL-
A0A1M6K7I9      -KKGGG-M-GESA------LFADL-N---LFGGAR--SVDNELLVFQSRSIMENVVRRL-
A0A5M6A8C8      -KKGGG-M-GESA------LFADL-N---LFGGAR--SVDNELLVFQSRSIMENVVRRL-
A0A6H9LT84      -SKGGN-M-SESS------AFADI-S---FFGGKR--NVDNEVLVFQSRNLMEKVARRL-
A0A6H9LUV5      -SKGGS-I-SESS------AFADI-S---LFGGKR--NVDNEVLVFQSRYLMEKVARRL-
A0A3R5ZMK1      -AKGGA-M-SESA------AFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-
A0A3E4ZTK7      -AKGGA-L-SESA------AFEDL-G---IFGTKR--NVDNEVLVFKSRRLMTEVARNL-
A0A1Y3ZIA4      -AKGGA-M-SESA------AFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-
K5Y1A4          -AKGGA-M-SESA------AFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-
A0A4Q5CIT0      -AKGGA-M-SESA------AFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-
A0A3R6K8X4      -AKGGA-M-SESA------AFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-
A0A414GI87      -AKGGA-M-SESA------AFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-
A0A415BDM7      -AKGGA-M-SESA------AFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-
A0A412DM15      -AKGGA-M-SESA------AFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-
A7AEU7          -AKGGA-M-SESA------AFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-
A0A1Q6I3T6      -AKGGA-M-SESA------AFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-
A0A414XX40      -AKGGA-M-SESA------AFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-
A0A3R6BKI7      -AKGGA-M-SESA------AFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-
A0A414LPI6      -AKGGA-M-SESA------AFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-
A0A412M2W1      -AKGGA-M-SESA------AFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-
K5ZX55          -AKGGA-M-SESA------AFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-
A0A5F0U645      -TKGGGAA-SEAA------VFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-
K5ZBN2          -TKGGGAA-SEAA------VFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-
A0A0J6CKW3      -TKGGGAA-SEAA------VFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-
A0A0F5IQM7      -TKGGGAA-SEAA------VFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-
A0A496CDT3      -TKGGGAA-SEAA------VFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-
A0A6G1ZKM3      -TKGGGAA-SEAA------VFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-
S0GLB0          -TKGGGAA-SEAA------VFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-
A0A3R6NLC1      -TKGGGAA-SEAA------VFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-
A0A416WYC9      -TKGGGAA-SEAA------VFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-
A0A0F5IT40      -SKGGG-L-SESA------AFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSVVAERL-
A0A496CX20      -SKGGG-L-SESA------AFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSVVAERL-
A0A5F0UBI0      -SKGGG-L-SESA------AFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSVVAERL-
A0A6G1ZHG0      -SKGGG-L-SESA------AFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSVVAERL-
S0GSI7          -SKGGG-L-SESA------AFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSVVAERL-
K5YB65          -SKGGG-L-SESA------AFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSVVAERL-
A0A0F5IWP9      -TKGGG-L-SESA------AFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSIVAERL-
A0A0F5IZT8      -TKGGG-L-SESA------AFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSIVAERL-
A0A417LKQ2      -AKGGG-L-SESA------AFEEL-N---MFNVKS--NVDNEVLVFKSKRLMNIVAERL-
A0A416TME1      -TKGGG-L-SESA------AFEEL-N---MFNVKS--NVDNEVLVFKSKRLMNIVSERL-
A0A416XPE8      -TKGGG-L-SESA------AFEEL-N---MFNVKS--NVDNEVLVFKSKRLMNIVSERL-
A0A3B0C2S4      -AKEMDI------------TVDPM-A---LLSGNPGINLDNEIQVLKSYRILGQVVEAL-
L8JI02          -RKN----DLGGKE-----FLRGM-G---LFTSDT--ELEDEIGILKSYGMVSNAIRSL-
A0A4Q5WS95      -KKGAE--ESS--------LSESM-N---VLSSKK--IVENEVVVLQSRNLADKIVAGL-
A0A501VZX6      -NKGVN--DAK--------MTESI-D---AFTSNK--IVENEIKVLYSRTLLKEVVEDL-
A0A399SH26      -KKGVD--DAR--------MTESI-N---AFASKK--IVENEIEVIQSRALMKKVALGL-
A0A501W1A9      -KKGVN--ASK--------IEESI-D---AFNANK--TVENELNVLRSYALMSQVVREL-
A0A0E3ZGV6      -EKGVN--ASK--------ITESI-D---AFSSNK--IVENELNVLRSNALMNQVVNEL-
A0A1I2N4S1      -EKGVN--ASK--------IMESI-D---AFSTNK--TVENELNVLRSSALMSQVVHKL-
A0A2T5YE44      -EKGMN--ASK--------IMESI-D---AFNTNK--TVENELNVLRSSALMSQVVHKL-
A0A1V9FHD0      -KKGVD--ESG--------MGEAL-Q---IFPTKN--IVENEMEVIHSRKLITDVINQL-
A0A4V4H170      -KKGVD--ESG--------VLEAL-Q---IYPTKN--IVENEMEVIHSRKLMEKVVEQL-
A0A1V9F098      -KKGVD--ESG--------VLEAL-Q---IYPTKN--IVENEMEVIHSRKLMEKVVEQL-
A0A4R2VU64      -KKGVD--ESG--------VLEAL-Q---IYPTKN--IVENEIEVIHSRKLMEKVIEGL-
A0A4S8HY23      -KKGVD--ESG--------VQEAL-Q---IYPIKN--IVENEMEVIHSRKLMEKVVEQL-
A0A1V9F383      -KKGVD--ESG--------SMEAL-Q---IYPTKN--IAENEIEVIHSRKLMEQVIVQL-
G8TRZ6          -KKGVD--ESG--------AMEAL-Q---VYPMQN--IAENEIEVLQSKTLMTDVVNQL-
A0A543WA52      -KKGVD--DAR--------MMESI-N---AFDSKK--IVENEIEVIRSRGLVNKVVNDL-
A0A1M5BA90      -KKGAD--ESK--------ILEAL-N---I-TSNK--TVDNEVEVIQSGELLNEVIDSL-
A0A512B879      -KKGAD--ESK--------ILDAL-N---IYSSNK--IVENEIEVIQSKELLKKVVNSL-
A0A559PPI3      -NKGVD--NSK--------MVESM-S---PFDSKK--IVENEIKVIQSPDIMKKVVDTL-
A0A1T5CS78      -EKGVD--NSR--------IMESI-N---PFDSKK--IVENEIEVLKSRDLMKSVVRDL-
A0A0Q9Z8F1      -EKGVD--DSK--------IMESI-N---PFDSKK--IVENEIEVLKSRDLMKAVVRDL-
A0A2N0U0M7      -EKGVD--DSK--------IMESI-N---PFDSKK--IVENEIEVLKSRDLMKSVVRDL-
A0A2N3U785      -NKGASVYENS--------FFSEL-G---IFQTNQ--SINDEIELLKSISLMQRVVKDL-
A0A0D3L8Q3      -QQSGGLTESA--------VFNDI-P---GFKSHT--NIDNEIRLLKSQSLMHRVFNEL-
A0A0E3ZG78      -KSDSHLSNES--------AFSDL-E---IFQATK--NINNEIEVLQSESLMKRVASEL-
A0A1I6BRK6      -KSGQSLSNAD--------ALSDL-N---TFKATR--NVDNEIEVLKSKGLMERVIREL-
A0A243WAB1      -KSGQSVSNAE--------ALSDL-T---MLKSAR--NIDNEIEVLRSESLMEKVVSEL-
A0A6G8C8X6      -KSGQGLANAD--------AFSDL-P---AFKSTR--NIDNEIEVLRSKTLMERVVNEL-
A0A5B6TJH8      -QRGQGISGAG--------TFSDL-D---MFNSTK--VVDNEILILDSKTLMERVVQDL-
A0A519U664      -KGGQGLSNAD--------ALSDL-T---TFKSTR--SIDNEIEVLRSASIMERVAKEL-
A0A519UDD1      -KSGQSLSSADNTG-----VLNDL-S---TFKSTR--NIDNETEVIKSKSLMNRVAKEL-
A0A519MA34      -KGGQGLSNAD--------ALSDL-T---TFKTTR--SVDNEIEVLKSASIMERVAKEL-
A0A519UCX0      -KSTQGLSSAD--------ALSDL-T---TFKSTR--SIDNEMEVLKSVSIMERVAKEL-
A0A4R5DL69      -TKGTDLGEAA--------ILENL-G---LAPGKS--NVDNEVEILKSRTLIESVVSDL-
A0A1M4YED3      -KRGVN--ESK--------MEESL-D---FYQSNK--VVENEIVVLSSKGLMEKVISNL-
A0A2H3NSN0      --------KPN--------QAQTV-R---FDIQPE--LSSEIGILTNSGSLAMRVITEL-
A0A2P6C324      -REAAP--ARM--------MVGL-------NEQRD--LSSEIGLLKNSGELARRVVSTI-
A0A1M6XHU0      -RGSGN--APV--------SVAAF-T---PIERRA--LSNELGILKNSAELATRVAKAI-
A0A5S9C8G0      -RGGGN--APV--------SVAAF-T---PIERRA--LSNELGILRNSAELATRVAEAI-
G2SF81          -RGSGN--APV--------SVAAF-T---PIERRA--LSNELGILRNSAELATRVAEAI-
A0A5S9EYW1      -RGGEN--APV--------SVAAF-T---PIERRA--LSNELGILRNSAELATRVAEAI-
D0MHQ9          -RGGGN--APV--------SVAAF-T---PIERRA--LSNELGILRNSAELATRVAEAI-
A0A126PFG0      -KKTPA--EKS--------ALQEL-D---LVTTPK--VVESEMEILKSRKLMLSVVRDL-
A0A3M1N7Z3      -QAVGG--FQT--------QNTAG-S---FFPPEV--LTEAYLELWSRYDLIAQVVQQL-
                                                                            

A0A1T5MMH4      -NIDVT---------------------YYSK-G-----EV------------------L-
A0A2W4R1L8      -KIDVS---------------------YYNK-G-----EI------------------L-
A0A2E5CV79      DSNRRN---------------------SLALFN-----TR--------------------
A0A2D4ZVH1      ----------------------------------------------------------N-
A0A0K8QSK7      -GFEVS---------------------VYSV-G-----QI------------------L-
A0A1V6CN82      -GFEVS---------------------YHNE-G-----KL------------------S-
A0A1M4XZ45      -DFEVS---------------------YYAL-G-----RV------------------A-
A0A399D319      -DFEVS---------------------YYAV-G-----RV------------------A-
A0A1M6GR99      -NLEVS---------------------YYEY-K-----NY------------------Q-
A6EBM4          -QYHIS---------------------FYSY-E-----RL------------------L-
A0A1M6TTV4      -GMDVS---------------------YFRPGR-----SH------------------L-
A0A4Q8RX32      -NFSVM---------------------YYEE-K-----LL------------------Y-
K0X1U5          -DLNIS---------------------YTSKKN-----FF------------------K-
R5EXK3          -DLNIS---------------------YTSKKN-----FF------------------K-
A0A401UAP7      -KLDVS---------------------YYSV-G-----EF------------------L-
A0A1W2GF52      -GMGIS---------------------YYHPGR-----SH------------------L-
A0A2G5L7B8      -GMNVS---------------------YFHPGR-----SH------------------L-
A0A523GAC0      -DLDIS---------------------YYAV-G-----NI------------------L-
L8JW09          -DLDLS---------------------YYTA-G-----QV------------------L-
A0A364XUP5      -NLSVS---------------------YFNK-G-----EL------------------L-
A0A1M5RLA9      -DLNVS---------------------YFSV-G-----RV------------------L-
A0A385SFR9      -DLNVS---------------------YFSV-G-----RV------------------L-
A0A5M4A9J4      -NAEVS---------------------YYEV-D-----MG------------------L-
A0A5M4B1C7      -HDEVS---------------------YYVV-N-----WG------------------H-
A0A0D3LFR6      -DLDVS---------------------YFTQ-G-----KI------------------L-
M7N6D4          -DLDVS---------------------YFEK-G-----KI------------------L-
A0A4D7K1D4      -DLDVT---------------------IRTTFG-----SL------------------K-
A0A5C7MX19      -PLEMS---------------------YFKE-G-----KT------------------K-
A0A1Q3ZMZ7      -DLAVG---------------------FFNK-G-----SI------------------L-
A0A2D8JJW3      EPVNSL---------------------FLTP-D-----YKLIFKYKEDK---------K-
A0A2W2AFF7      -QLNVN---------------------YFSS-G-----RV------------------K-
R7PCR1          -GLDVS---------------------YDTK-D-----GL------------------R-
A0A2N5YXE2      -PLDVS---------------------YYRQ-G-----TF------------------L-
A0A1G9E2A9      -DLAVS---------------------YYVV-G-----DV------------------V-
A0A098LL25      -KMNVS---------------------YFAY-G-----NI------------------L-
A0A6C0GJI1      -DMSVS---------------------YYAY-G-----QI------------------L-
A0A2T2YJE8      -PLDIN---------------------YYSI-G-----NV------------------L-
A0A127B287      -PLQVS---------------------YHVE-A-----RI------------------L-
A0A3M9N829      -PLQVS---------------------YHVD-A-----RV------------------L-
A0A0P0CSF9      -PLQVS---------------------YFVE-A-----RV------------------L-
A0A5M8QQB8      -PLQVS---------------------YFVE-A-----RV------------------L-
A0A3M9MNC3      -PLQVS---------------------YHIE-A-----RV------------------L-
A0A5B6TAX2      -PLQVS---------------------YHVE-A-----RV------------------L-
A0A5N1IQ33      -DLDVN---------------------YFAE-G-----TV------------------L-
A0A512AYT3      -NLNVS---------------------YYAL-G-----NV------------------L-
A0A5M6CYN7      -NLNVS---------------------YYAL-G-----NV------------------L-
A0A369QP10      -PLDIS---------------------YYAI-G-----NI------------------L-
A0A126PDF2      -DLYVN---------------------YYVQ-G-----TV------------------L-
A0A2Z3GKA1      -DLYVN---------------------YYVQ-G-----TV------------------L-
A0A502GZP7      -NLNVN---------------------YYVQ-G-----TV------------------L-
A0A519SBU8      -ALDVN---------------------YYVQ-G-----TV------------------L-
A0A4Q3JNZ3      -ALDVN---------------------YYVQ-G-----TV------------------L-
A0A519Q9V3      -ALDVN---------------------YYVQ-G-----TV------------------L-
A0A0M3RW20      -ELDVN---------------------YYAQ-G-----TV------------------L-
A0A495VFX4      -ELDVN---------------------YYAQ-G-----TV------------------L-
A0A1S9B3W0      -PLDVN---------------------YYAE-G-----TV------------------L-
A0A1W1VRL3      -ALDVN---------------------YYVE-G-----TV------------------L-
A0A1M6R305      -DLDVN---------------------YYAE-G-----TV------------------L-
A0A4Z0PHK3      -ELDVN---------------------YYVE-G-----TV------------------L-
A0A2M9B9H9      -ELNVN---------------------YYVE-G-----TV------------------L-
A0A4Z0QCY9      -ELNVN---------------------YYVE-G-----TV------------------L-
A0A418R9X5      -TLDVN---------------------YYVQ-G-----TV------------------L-
A0A428JSJ3      -ELDVN---------------------YYVQ-G-----TV------------------L-
A0A428KI59      -ALDVN---------------------YYVQ-G-----TV------------------L-
W8F1I6          -ALDVN---------------------YYVQ-G-----TV------------------L-
A0A246FQC0      -DLDVN---------------------YYVQ-G-----TV------------------L-
A0A372E5P8      -ALDVN---------------------YYVQ-G-----TV------------------L-
A0A1H3EMW1      -ALDVN---------------------YYVQ-G-----TV------------------L-
A0A1H9ZSN3      -ALDVN---------------------YYVQ-G-----TV------------------L-
A0A5N1J2M4      -NLEVS---------------------YFVR-G-----NV------------------L-
A0A519S476      -ALDIN---------------------YYVQ-G-----TV------------------L-
A0A4Q3JRW8      -ALDVN---------------------YYVQ-G-----TV------------------L-
A0A519M923      -ALDVN---------------------YYVQ-G-----TV------------------L-
A0A4Z0ENW1      -ALDIN---------------------YYTQ-G-----TV------------------L-
A0A519UDB4      -PLDIN---------------------YYTQ-G-----TV------------------L-
A0A3S0QKV1      -PLDVN---------------------YYAE-G-----TV------------------L-
A0A328BL48      -ELDVN---------------------YYTE-G-----TV------------------L-
A0A5R8WLY4      -ELDVN---------------------YYTE-G-----TV------------------L-
A0A1I5WSL8      -ALDVN---------------------YYVQ-G-----TV------------------L-
A0A0U3JVM7      -ALDIN---------------------YYVQ-G-----TV------------------L-
A0A1G1SSV2      -ALDVN---------------------YYVQ-G-----TV------------------L-
A0A1G1SXV7      -ALDVN---------------------YYVQ-G-----TV------------------L-
A0A6G8CBJ6      -ALDVN---------------------YYVE-G-----TV------------------L-
A0A0W8EDI5      -NLNVS---------------------YFVE-G-----TV------------------L-
A0A3B7RBP8      -NLNVG---------------------YFVE-G-----TV------------------L-
A0A3R9P8H7      -TLDVN---------------------YYVQ-G-----TV------------------L-
A0A238WIA7      -ELEVA---------------------YYAE-G-----TV------------------L-
A0A212UCJ7      -DLEVN---------------------YYAE-G-----TV------------------L-
A0A4Z0MQE1      -DLEVN---------------------YYAE-G-----TV------------------L-
A0A4Z0PCF4      -DLEVN---------------------YYAE-G-----TV------------------L-
A0A5D6VDG1      -DLDVN---------------------YYSQ-G-----TV------------------L-
A0A6H1CVS0      -DLDVN---------------------YYSQ-G-----TV------------------L-
A0A243WHR7      -ALDVN---------------------YYVE-G-----TV------------------L-
A0A5B8A0P6      -ALDVN---------------------YYAE-G-----AV------------------L-
A0A076HRT9      -DLDVN---------------------YYAE-G-----TV------------------L-
A0A4Z0PVM7      -ELNVN---------------------YYVE-G-----TV------------------L-
A0A1M6DHW8      -DLDVN---------------------YYVE-G-----TV------------------L-
A0A4Q5LC61      -DLDVN---------------------YYVE-G-----TV------------------L-
A0A2U1FKU2      -NLDLT---------------------LSKD-G-----FW------------------R-
A0A0A2F954      -DLDVS---------------------ISKQ-G-----FW------------------R-
A0A0A2FW91      -DLDVS---------------------ISKQ-G-----FW------------------R-
A0A2D2N2N1      -DLDVS---------------------IYKQ-G-----FW------------------R-
Q7MWZ2          -DLDVS---------------------IYKQ-G-----FW------------------R-
T2NDT6          -DLDVS---------------------IYKQ-G-----FW------------------R-
W1R7P9          -DLDVS---------------------IYKQ-G-----FW------------------R-
A0A1R4AFZ0      -DLDVS---------------------IYKQ-G-----FW------------------R-
A0A1R4DVZ7      -DLDVS---------------------IYKQ-G-----FW------------------R-
A0A2A8CVM9      RATESA---------------------LEEK-G-----KF--------------------
A0A5M4B212      -NFEVS---------------------YLQL-G-----RF------------------R-
A0A3D1KEX9      -NLDVD---------------------YVMM-K-----GL------------------Q-
A0A358Y7S2      -GIHTN---------------------LYSK-G-----TI------------------L-
A0A1X7J248      -PLDVT---------------------YHVI-G-----RF------------------K-
E4TQD2          -PLDVS---------------------YHVI-G-----RF------------------K-
A0A2J6HHN3      -PLDVS---------------------IFAK-G-----NI------------------L-
A0A1Y3WMT8      -ELNKI---------------------YTSK-K-----NF------------------F-
A0A1Y4GQU1      -ELNKV---------------------YTSK-K-----NF------------------F-
A0A6A0R272      -PLDVR---------------------YYKK-G-----RF------------------S-
A0A1V5W8T5      -NLYTS---------------------YYLE-G-----KF------------------L-
A0A2T8HKA9      -QGDIS---------------------YSKT-E-----GL------------------R-
A0A2I0QZ80      -PLQIS---------------------LYAK-G-----EF------------------L-
A0A3E1F1A3      -PLTVS---------------------HYAK-G-----EF------------------L-
A0A2U2XBJ3      -PLTVS---------------------LYAK-G-----EF------------------L-
A0A4Q4KU94      -PLNVS---------------------LYAR-G-----EF------------------L-
A0A3B8INU3      -PLQVS---------------------YFTQ-G-----KI------------------L-
A0A2W1NDY9      -NLKIS---------------------YFSE-G-----EV------------------L-
A0A5C8AQR5      -NMNVS---------------------LFSK-G-----KI------------------L-
A0A1G0CI31      -HMNVS---------------------LFSK-G-----RI------------------L-
A0A556N0M0      -NMNVS---------------------IFAE-G-----KI------------------L-
F2IKD6          -NMNVS---------------------VFSK-G-----KI------------------L-
A0A1I7BM74      -NLEVS---------------------HFAK-G-----EF------------------L-
A0A2G2FJ17      -DLQVS---------------------LFAE-G-----DV------------------L-
A0A2E3R1D0      ----------------------------------------------------------L-
A0A2T2USC0      ----------------------------------------------------------L-
A0A2T2V0F3      ----------------------------------------------------------L-
A0A2T2S682      ----------------------------------------------------------L-
D5H561          ----------------------------------------------------------L-
A0A2H3NWA9      ----------------------------------------------------------M-
A0A2A8CVB6      ----------------------------------------------------------L-
A0A2P6C1S6      ----------------------------------------------------------L-
A0A2T2UTM4      ----------------------------------------------------------L-
A0A414ZBF2      -RLDVS---------------------YKER-N-----GL------------------R-
A0A1Q3Q573      -PLDIS---------------------YLKE-G-----KS------------------K-
A0A662BAY3      -DFDIN---------------------YYSV-G-----RV------------------K-
A0A4U3L369      -QLNVS---------------------YYKK-E-----DI------------------R-
A0A357YNR3      -GLYAT---------------------YTEM-R-----PLSLLARFGLKDNVPSFLIIK-
A0A5E8AX52      -NYNVS---------------------YHYY-G-----NI------------------L-
F4KK08          -GLDVQ---------------------YHYD-A-----GL------------------R-
A0A6B5PK86      -AMNVS---------------------IFYK-G-----KI------------------L-
A0A2G2F510      -SLNVS---------------------LYSR-G-----NV------------------L-
A0A316JZ08      -NMSVS---------------------MFSR-G-----KL------------------L-
A0A496LCF9      PQFSID---------------------FYKK-K-----QF------------------K-
A0A5P2G2A9      -HLNVN---------------------YYKR-V-----PL------------------G-
A0A3C0ZQC7      --IKRG---------------------YTDS-T-----N---------------------
A0A419VXB7      -GWNVS---------------------WYRH-M-----PL------------------G-
A0A0B0BTJ4      -DANIV---------------------YATK-S-----KL------------------R-
A0A3B9CNN6      -DANIV---------------------YATK-S-----KL------------------R-
R5X290          -DANIV---------------------YATK-S-----KL------------------R-
A0A1Q6E6I7      -DANIV---------------------YATK-S-----KL------------------R-
C3J7R8          -NLDVS---------------------YSQS-R-----GI------------------R-
A0A1G8BVM8      -GLETN---------------------YQVK-D-----GL------------------R-
A0A1I1FXP9      ENIHIT---------------------YMQK-G-----NF------------------V-
A0A3N4H5N3      -KAFIF---------------------LYDK-I-----GF------------------F-
A0A2P8EAX2      -SAFVT---------------------FYDK-I-----GI------------------F-
A0A4V2F6N9      -NAFVT---------------------FYDH-N-----GM------------------F-
A0A3B9FXJ0      -PIEIS---------------------LIAS-G-----RI------------------R-
R5GSU5          -KLDVD---------------------YSVK-N-----GL------------------G-
A0A2A3UE91      -DISVN---------------------YYSE-G-----VF------------------K-
A0A0A2G557      -NLRVT---------------------YRKK-E-----GL------------------R-
A0A2N2WFW8      -PLDVS---------------------IFVK-G-----NI------------------L-
A0A1F3IU95      -PLGVS---------------------VFAK-G-----NI------------------L-
A0A3D0VUF6      -PLGVS---------------------VFAK-G-----NI------------------L-
A0A1T4PT95      -NLRVN---------------------YQRK-E-----GI------------------S-
A0A6I6JYY3      -DFEIS---------------------YYAV-G-----RV------------------K-
A0A2A4PYG9      -DLGIS---------------------YYSK-G-----KI------------------L-
A0A1F3K695      -PLSIA---------------------YYSE-G-----TF------------------L-
A0A353KZR1      -PLSIA---------------------YYSE-G-----TF------------------L-
A0A2N2WYB5      -PLQVS---------------------YFSE-G-----TF------------------L-
A0A1F3K4G0      -PIQIS---------------------YFSE-G-----TF------------------L-
A0A356H8Y3      -PIQIS---------------------YFSE-G-----TF------------------L-
A0A351HSA6      -PIQIS---------------------YFSE-G-----TF------------------L-
A0A1F3Q014      -PLQAS---------------------YYAE-G-----TF------------------K-
A0A2A4YXP3      -PIDVS---------------------YYNQ-G-----EI------------------L-
A0A2D5KD44      -PLQVS---------------------YFSE-G-----QF------------------L-
A0A1F3R158      -PLNVS---------------------YFNQ-G-----KF------------------L-
A0A2M8ADX2      -PLEVS---------------------YFNK-G-----KF------------------L-
A0A1J5B2H0      -PLDIS---------------------YYTE-G-----RL------------------L-
A0A1V5N756      -PLDIA---------------------YYKK-G-----RF------------------L-
A0A651GU15      -PLKVS---------------------YYLK-G-----DI------------------L-
A0A3Q9FR88      IDLTVT---------------------YQSV-G-----DV------------------R-
A0A553GEX3      IDLTVT---------------------YQSV-G-----DV------------------R-
A0A150ADJ9      IDLRLS---------------------YYSV-G-----EI------------------R-
A0A1B1FWQ4      IDLSVE---------------------YYSV-G-----DV------------------R-
A0A1S1Z228      IDLSVD---------------------YYSV-G-----DV------------------R-
A1ZKR2          -DLWIS---------------------YYQQ-G-----NI------------------L-
A0A1Q3GX01      -DLWVS---------------------YYEQ-G-----NI------------------L-
A0A349DQI4      -DLWVS---------------------YYEQ-G-----NI------------------L-
A0A4P5TMD1      -PLSIS---------------------YFNI-G-----QI------------------L-
A0A2N3IIZ0      -DLSVE---------------------YYAE-G-----RI------------------L-
A0A1F3SJM1      -NLNVS---------------------LYSR-G-----KI------------------L-
A0A2G2EB96      -NLNVS---------------------LFSR-G-----QI------------------L-
A0A2G6PRA9      -NLSVS---------------------LFSR-G-----EI------------------L-
A0A497D5Z2      -DFELS---------------------YYRE-G-----NI------------------M-
A0A662B170      -DFELS---------------------YYRE-G-----NI------------------M-
A0A2A5FYT6      -DLEVS---------------------YFSE-G-----QV------------------M-
A0A2E6SYP1      -KLDVN---------------------YYSK-G-----KF------------------L-
A0A2E5RLE8      -NIDVN---------------------YYTK-G-----KF------------------L-
A0A2E7TQF6      -NIDVN---------------------YYTK-G-----KF------------------L-
A0A2E6GVY9      -NIDVN---------------------YYTK-G-----KF------------------L-
A0A350JJ90      -PVDVS---------------------YYAE-G-----EV------------------L-
A0A3M1CDV2      -NLQIS---------------------YYNE-G-----TF------------------K-
A0A6C1QGZ7      -PLDVS---------------------YFSK-G-----RV------------------L-
A0A4P5U6G4      -PLLVS---------------------YYNT-G-----QI------------------L-
A0A2E2TFD1      -PLDIS---------------------YFNE-G-----EL------------------L-
A0A2E4ELE6      -PLTIS---------------------YYTE-G-----EF------------------L-
A0A522EYA6      -PLKVT---------------------YFAE-G-----TF------------------K-
A0A2E3XZI5      -KLNIL---------------------YYNE-G-----EI------------------I-
A0A6I7QXV0      -PLDVR---------------------YFKE-G-----RT------------------R-
A0A2M7NLQ9      -DLNIS---------------------YFVK-G-----RW------------------W-
I4AFR0          -DLSVS---------------------YFVK-G-----RW------------------W-
A0A2N2Y3E5      -PLDVS---------------------YYSK-G-----TF------------------L-
A0A2D9D7T6      -SLYTS---------------------VYSE-G-----KL------------------L-
A0A1F3PPL5      -PIDIQ---------------------YFNE-G-----TF------------------L-
A0A357QK06      -PIDIQ---------------------YFNE-G-----TF------------------L-
A0A662AEA4      -PLEIE---------------------YYTQ-G-----TF------------------Q-
A0A0S2HYK8      -PLDIR---------------------YFVE-G-----AF------------------L-
A0A2N5ZWN6      -PLETR---------------------YYIE-G-----AF------------------L-
A0A2E0FJ09      -PLQIR---------------------YFLE-G-----KI------------------L-
A0A1F3FZ62      -NFEVS---------------------YYIK-G-----RI------------------L-
A0A1F3K211      -NFEVS---------------------YYIK-G-----RI------------------L-
A0A1V6I2U9      -PLDIS---------------------YYRK-G-----TF------------------L-
A0A2H0B957      -PLGVS---------------------YYSQ-G-----TF------------------L-
A0A1F3CFW6      -PLKIS---------------------YFSQ-G-----TF------------------L-
A0A2M7E2T8      -PLKIS---------------------YFSQ-G-----TF------------------L-
A0A2M7NC69      -PLKIS---------------------YFSQ-G-----TF------------------L-
A0A1F3KLL5      -PFEIS---------------------YFSQ-G-----TF------------------L-
A0A359D1M1      -PFEIS---------------------YFSQ-G-----TF------------------L-
A0A0F2NS19      -PLEVS---------------------YFNQ-G-----KI------------------L-
A0A2A5H8X6      -PLEVS---------------------YFNQ-G-----KI------------------L-
A0A2H0GAU8      -QLKVS---------------------YYNQ-G-----NF------------------L-
A0A2M8FTK1      -QLKVS---------------------YYNQ-G-----NF------------------L-
A0A2A5B3B0      -PIDVS---------------------YYRK-G-----EI------------------L-
A0A5C6RXM7      -PLAIS---------------------FYNK-G-----TL------------------L-
A0A1F3C1M2      -PFQIT---------------------YFSE-G-----TF------------------L-
A0A1F3DS87      -PFQVT---------------------YFSE-G-----TF------------------L-
A0A6A0R6K9      -PLEVS---------------------YYTQ-G-----QF------------------L-
A0A2E7CT70      -NENVR---------------------YYSE-G-----EI------------------L-
A0A2D5V560      -ELKVF---------------------YYFE-G-----EX------------------I-
A0A2D7K5A8      -NLKVF---------------------YYFK-G-----EI------------------L-
A0A2E1XQ82      -NLKVF---------------------YYFE-G-----EI------------------L-
A0A5C8A5B4      -DFGIS---------------------YYAT-K-----YF------------------L-
A0A4Y9ITE2      -QLNKT---------------------YIVK-E-----NF------------------L-
A0A5M8NYX7      -NLRVA---------------------YYTN-G-----KL------------------K-
A0A3D5KRY6      -NWRYS---------------------WYQK-R-----FI------------------G-
A0A1V5IPN7      -KKNPD------------------------------------------------------
A0A0E3V905      -HLDVR---------------------YFQN-T-----TF------------------G-
A0A553ETH6      -DLNIS---------------------YFTT-G-----NV------------------L-
A0A640Q161      -SLYNN------------------------------------------------------
A0A640QU49      -SLYNN------------------------------------------------------
A0A1Q3PII2      -HLTTQ---------------------YFAS-G-----HL------------------K-
A0A351BXT2      -IDTFK------------------------------------------------------
A0A2K8Z965      -HLNVR---------------------YYEA-T-----TF------------------S-
A0A418M8U8      -HLDVR---------------------YFEK-T-----AF------------------G-
I2GTA4          -HLDVR---------------------YFEK-T-----AF------------------G-
A0A2K8ZAJ2      -GLDVQ---------------------YYRP-T-----RT------------------L-
A0A368JPA3      -GLNIR---------------------YFRS-T-----PF------------------G-
A0A5N1JI29      -GLNIR---------------------YFRS-T-----PF------------------G-
A0A3P1BT12      -GLNIR---------------------YFRS-T-----PF------------------G-
A0A3P1CI15      -GLNVR---------------------FFRS-T-----PF------------------G-
A0A4R8CUK1      -GLNVR---------------------YFHK-T-----AF------------------G-
A0A3D0MYJ7      ------------------------------------------------------------
A0A662AH13      ------------------------------------------------------------
A0A5C7QA01      -HLDVQLSSQEDNFKNRFLGANHYDTVYSND-A-----VI------------------F-
A0A3D3LS70      ------------------------------------------------------------
A0A1G1TM36      -GLSTV---------------------YQRP-G-----RF------------------S-
A0A1G7ZF38      -HLTTQ---------------------YFAA-G-----TL------------------K-
C6VS52          -HLTIQ---------------------YFAS-G-----LL------------------K-
A0A2A4G4B1      -NLHIR---------------------YYSK-N-----SF------------------K-
A0A0P7X1V8      --YDER---------------------YQPD-G-----RL------------------Y-
A0A5C8KAD6      -SLYAP---------------------IYEE-G-----KF------------------K-
A0A5N1J695      -MLYAQ---------------------VFEE-D-----QF------------------R-
A0A1H4ADG3      -QLYLN---------------------FSTY-K-----DF------------------R-
A0A5B8VUR8      -QLNLS---------------------FSTY-K-----DF------------------K-
A0A3N2M1H3      -HLDMN---------------------YDRL-G-----GF------------------H-
A0A4S2G8T2      -HLDMN---------------------YDRL-G-----GF------------------H-
A0A1T5K9D4      -NIDVN---------------------YIHH-V-----GL------------------R-
A0A077ENE7      -HADKS---------------------YKVH-K-----GL------------------R-
A0A6I5UW06      -HADKS---------------------YKVH-K-----GL------------------R-
T0NN57          -GSDIS---------------------YKVR-Y-----GL------------------R-
X5K347          -GSDIS---------------------YKVR-Y-----GL------------------R-
A0A212K7W5      -KLDED---------------------YSTK-G-----FF------------------R-
F5IU11          -KLDED---------------------YSIK-G-----FF------------------R-
A0A6I1IYY4      -HLDVS---------------------YEED-G-----FF------------------R-
K0XJ09          -HLDVT---------------------YQVK-N-----WL------------------H-
R5EUZ0          -HLDVT---------------------YQVK-N-----WL------------------H-
W0EQS0          -HLDVA---------------------YRVK-D-----WL------------------H-
A0A1Y3WE15      -HLDVT---------------------YQVK-D-----FL------------------H-
A0A1Y4GUK3      -NLDVT---------------------YQVK-D-----FL------------------H-
A0A352Z1R7      -HLDWQ---------------------VTKK-S-----KD------------------L-
A0A3N2N6F7      -GLRAN---------------------YVYK-K-----RL------------------R-
A0A4P7VVU7      -GLQTD---------------------YIYR-H-----NL------------------K-
A0A2V1ILM4      -GLQTD---------------------YIYR-H-----NL------------------K-
A0A3N2L0E8      -GLQTD---------------------YIYR-H-----NL------------------K-
A0A3N2LFC5      -GLQTD---------------------YIYR-H-----NL------------------K-
A0A0A2F501      -GLNVE---------------------YYAD-G-----RY------------------Y-
R5B7P0          -RLYMS---------------------YTVD-G-----TF------------------H-
R5B0L5          -SLDET---------------------YNID-G-----RF------------------H-
A0A6I1TEC0      -KLNVD---------------------YAVD-G-----RF------------------H-
A0A3R5XWG1      -KLNVD---------------------YAVD-G-----RF------------------H-
A0A646GTR1      -KLNVD---------------------YAVD-G-----RF------------------H-
A0A5P0Y910      -KLNVD---------------------YAVD-G-----RF------------------H-
A0A414YFM3      -KLNVD---------------------YAVD-G-----RF------------------H-
A0A6A7UIA7      -KLNVD---------------------YAVD-G-----RF------------------H-
A0A6A7VPS3      -KLNVD---------------------YAVD-G-----RF------------------H-
A0A374THP7      -KLDVD---------------------YAID-G-----AF------------------H-
A0A6G1VND1      -KLDVD---------------------YAID-G-----AF------------------H-
A0A0A2EVS5      -NLDID---------------------YKVD-G-----RF------------------H-
A0A1T4NAJ7      -NLDID---------------------YKVD-G-----RF------------------H-
A0A255T941      -RLNEV---------------------YSVR-E-----GL------------------K-
A0A3N2KCL3      -NLDMN---------------------YYIP-G-----RF------------------H-
A0A4P7VSV0      -NLDMN---------------------YYIP-G-----RF------------------H-
A0A2V1IJY1      -NLDMN---------------------YYIP-G-----RF------------------H-
A0A4P7VXK7      -DLDMN---------------------YYIP-G-----RF------------------H-
A0A1Y4CHN5      -HLDVN---------------------YKVD-G-----RF------------------Y-
A0A1M6I2S6      -GLNET---------------------YTVR-K-----GL------------------K-
A0A1Y3V692      -GLNET---------------------YTVR-K-----GL------------------K-
F3PXM2          -GLDET---------------------YTVR-R-----GL------------------R-
A0A3E4ZNL4      -VLNET---------------------YIIR-R-----GL------------------K-
A0A174AHH7      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A174JCE8      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A3E4JMC4      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A412SND6      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A414IEQ9      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A415UKN5      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A6I0U0V8      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A6I2PDH7      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A0M1W8D8      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A3R6GKX5      -GLNEI---------------------YTIR-R-----GL------------------K-
A7V4S1          -GLNEI---------------------YTIR-R-----GL------------------K-
B0NU19          -GLNEI---------------------YTIR-R-----GL------------------K-
D4V601          -GLNEI---------------------YTIR-R-----GL------------------K-
A0A4Q0U3M9      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A4R4H1Q2      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A6I0GII7      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A6I0KYU7      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A397WLT5      -GLNEI---------------------YTIR-R-----GL------------------K-
A6KY94          -GLNEI---------------------YTVR-R-----GL------------------K-
A0A173UQR8      -GLNEI---------------------YTVR-R-----GL------------------K-
A0A3R6HK75      -GLNEI---------------------YTVR-R-----GL------------------K-
A0A412B7D1      -GLNEI---------------------YTVR-R-----GL------------------K-
A0A412VNY9      -GLNEI---------------------YTVR-R-----GL------------------K-
A0A414LTU9      -GLNEI---------------------YTVR-R-----GL------------------K-
I9Q4U4          -GLNEI---------------------YTVR-R-----GL------------------K-
A0A6A2J529      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A3R6GM96      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A015XH67      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A078RZN2      -GLNEI---------------------YTIR-R-----GL------------------K-
A0A4R4I3T9      -GLNEI---------------------YTIR-R-----GL------------------K-
A6L0K5          -GLNEI---------------------YTIR-R-----GL------------------K-
A7ACT5          -GLNEI---------------------YTIR-R-----GL------------------K-
A0A373ISF0      -RLNET---------------------YTVR-K-----GL------------------K-
U6RF62          -RLNET---------------------YTVR-K-----GL------------------K-
A0A662ZZD5      -GLNET---------------------YTVR-K-----GL------------------K-
A0A3A5TI83      -GLNET---------------------YTVR-K-----GL------------------K-
A0A415NEB6      -GLNET---------------------YTVR-K-----GL------------------K-
A0A6I0I238      -GLNET---------------------YTVR-K-----GL------------------K-
A7AJ60          -GLNET---------------------YTVR-K-----GL------------------K-
A0A6A2JF01      -GLNET---------------------YTVR-K-----GL------------------K-
A0A6I0Y2Y2      -GLNET---------------------YTVR-K-----GL------------------K-
A0A6I2Q447      -GLNET---------------------YTVR-K-----GL------------------K-
A0A395YYT3      -GLNET---------------------YTVR-K-----GL------------------K-
A0A015UXN7      -GLNET---------------------YTVR-K-----GL------------------K-
A0A5M5W148      -GLNET---------------------YTVR-K-----GL------------------K-
A0A6I2NTL0      -GLNET---------------------YTVR-K-----GL------------------K-
A0A016E4F9      -GLNET---------------------YTIR-K-----GL------------------R-
A0A4Q5CFJ7      -GLNES---------------------YTVR-K-----GL------------------R-
A0A6H9P0U9      -GLNET---------------------FTIR-K-----GL------------------K-
A0A108TH71      -GLNET---------------------FTIR-K-----GL------------------K-
I8VXH0          -GLNET---------------------FTIR-K-----GL------------------K-
A0A412S0N6      -GLNET---------------------YTIR-K-----GL------------------K-
A0A412IIJ0      -GLNET---------------------FTIR-K-----GL------------------K-
A0A0P0FM97      -GLNET---------------------FTIR-K-----GL------------------K-
R6KTP3          -GLNET---------------------FTIR-K-----GL------------------K-
A0A139LU87      -GLNET---------------------FTIR-K-----GL------------------K-
A0A1C6B3Y5      -GLNET---------------------FTIR-K-----GL------------------K-
E2NMQ4          -GLNET---------------------FTIR-K-----GL------------------K-
A0A412YDB9      -GLNET---------------------FTVR-R-----GL------------------K-
R7DY01          -GLNET---------------------FTVR-R-----GL------------------K-
A0A414LGK8      -GLNEV---------------------FTVR-K-----GL------------------K-
A0A415IPQ4      -GLNET---------------------FTIR-R-----GL------------------K-
A0A3E5BRW7      -GLNDI---------------------FTVR-R-----GL------------------K-
K9DXS6          -GLNDI---------------------FTVR-R-----GL------------------K-
A0A1M6KFV3      -GLNES---------------------FTVR-R-----GL------------------K-
A0A1Q6G7L3      -GLNES---------------------FTVR-R-----GL------------------K-
A0A413H235      -GLNES---------------------FTVR-R-----GL------------------K-
A0A1M5B2J8      -HLEMN---------------------YLVE-G-----RF------------------H-
A0A255RCT5      -HLDMN---------------------YLVD-G-----RF------------------H-
A0A1Y4GLF5      -QLGTT---------------------YYLP-G-----KF------------------H-
A0A1H3XSC0      -HLDMN---------------------YTVP-G-----RF------------------H-
A6LE40          -RLDMN---------------------YFVP-G-----KF------------------H-
A0A4Y1VPX5      -RLDMN---------------------YFVR-G-----KF------------------H-
B3JI46          -RLDMN---------------------YFVR-G-----KF------------------H-
R6NN15          -HLEVD---------------------YSTE-G-----SF------------------Y-
A0A358R8U0      -HLDMN---------------------YHIP-G-----RF------------------Q-
R6WSB6          -HLDMN---------------------YHIP-G-----RF------------------Q-
A0A401LPX7      -HLEMN---------------------YQTD-G-----RF------------------H-
A0A6I0J0P8      -HLEMN---------------------YQTD-G-----RF------------------H-
A0A6I1BFM0      -HLEMN---------------------YQTD-G-----RF------------------H-
A0A6G0GNY9      -HLEMN---------------------YQTD-G-----RF------------------H-
A0A3A5Z900      -HLEMN---------------------YQTD-G-----RF------------------H-
A0A285TGL6      -HLEMN---------------------YQTD-G-----RF------------------H-
A0A3A5RFX4      -HLEMN---------------------YQTD-G-----RF------------------H-
A0A1Q6IUW9      -HLEMN---------------------YQTD-G-----RF------------------H-
A0A3R6NPG7      -HLEMN---------------------YQTD-G-----RF------------------H-
A0A413XDP6      -HLEMN---------------------YQTD-G-----RF------------------H-
K6AP24          -HLEMN---------------------YQTD-G-----RF------------------H-
A0A6I2NHV3      -HLEMN---------------------YQTD-G-----RF------------------H-
A0A662ZYI7      -HLEMN---------------------YQTD-E-----RF------------------H-
A0A078RYI7      -HLEMN---------------------YQTD-G-----RF------------------H-
C7XEQ8          -HLEMN---------------------YQTD-G-----RF------------------H-
D7INX6          -HLEMN---------------------YQTD-G-----RF------------------H-
K5ZG55          -HLEMN---------------------YQTD-G-----RF------------------H-
A0A3N2N9B8      -KLDMD---------------------YYSH-G-----RF------------------H-
A0A3N2NMI0      -NLDVN---------------------YFRK-G-----RF------------------H-
A0A359I8H7      -GLDVN---------------------YSTP-G-----RF------------------H-
A0A3N2KA63      -GLDVN---------------------YSTP-G-----RF------------------H-
A0A4Q0IMT7      -GLDVN---------------------YSTP-G-----RF------------------H-
A0A3B9FAU3      -NLDMN---------------------YTME-G-----RW------------------H-
A0A3C1E5L7      -NLDMN---------------------YTME-G-----RW------------------H-
A0A4Q0UAV1      -DLNNM---------------------YYVD-N-----GL------------------H-
A0A354SN68      -HLEVS---------------------YSIS-D-----RL------------------K-
A0A3N2N595      -KLDMN---------------------YFKD-G-----TF------------------H-
A0A0A2DUD9      -ELWTS---------------------YEAP-G-----AF------------------H-
A0A3P1ZBJ5      -HLDID---------------------YSVE-G-----FF------------------H-
R5FHS9          -GLNVS---------------------YLTD-S-----TF------------------Y-
A0A413TW79      -KLDVN---------------------YSEG-G-----TF------------------H-
A0A3E5E9M7      -KLDVN---------------------YSED-G-----TF------------------H-
A0A3E4SK73      -KLDVN---------------------YSED-G-----TF------------------H-
A0A415GGC6      -KLDVN---------------------YSED-G-----TF------------------H-
A0A413DBH9      -KLDVN---------------------YSED-G-----TF------------------H-
A0A1Y4PQK7      -HLDMS---------------------YYAP-G-----RF------------------H-
A0A1Y4IH41      -HLDMS---------------------YYAP-G-----RF------------------H-
A0A3A6AAP4      -HLDMS---------------------YYAP-G-----RF------------------H-
A0A6I0ZRD2      -HLDMS---------------------YYAP-G-----RF------------------H-
A0A1Y4DYA7      -HLNIN---------------------YYTK-G-----VF------------------Y-
A0A1Y3X4I9      -HLNIN---------------------YSTD-G-----TF------------------Y-
A0A1Y4FNK8      -HLDIN---------------------YYTD-G-----GF------------------Y-
A0A355FD59      -HIDVD---------------------YQIN-G-----PF------------------H-
A0A359CEZ9      -HIDVD---------------------YQIN-G-----PF------------------H-
A0A353Q7B4      -HIDVD---------------------YQIN-G-----PF------------------H-
F8X3A5          -HLDVN---------------------YQIK-D-----AF------------------Y-
A0A1M3KVR9      -HLDVN---------------------YQIK-D-----SF------------------Y-
A0A4Y9IJS3      -HLDVN---------------------YQIK-D-----SF------------------Y-
A0A495WI87      -HLNMD---------------------YHVD-G-----GF------------------Y-
A0A354M4S6      -HLNMD---------------------YHVD-G-----GF------------------Y-
R7DH52          -HLNMD---------------------YHVD-G-----GF------------------Y-
A0A4Q5E7L5      -RLDMN---------------------YFFP-G-----KF------------------H-
A0A4P8LP09      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A4R4GZU7      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A016CWA4      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A1C6H117      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A0M1W0V2      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A139KA16      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A174VQ92      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A1Q6HCG0      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A1Y4JYM9      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A3A5QW67      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A3A5RQE6      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A3A6BP07      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A3E5E153      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A3Q9IP20      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A412WV15      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A413ICP6      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A414KYB9      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A5B3FWR2      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A6I0WNS4      -RLDMN---------------------YFVP-G-----KF------------------H-
E5WX00          -RLDMN---------------------YFVP-G-----KF------------------H-
K0X3P3          -RLDMN---------------------YFVP-G-----KF------------------H-
A0A415TAH7      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A078T2W6      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A6I1AQV4      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A5C6L2P1      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A412MJT7      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A3E4WKT5      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A3A5YY33      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A078TAH2      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A1E9CFZ7      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A373FYU5      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A3A5TZ72      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A3A5XBP2      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A3A6MEG9      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A3E4JP35      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A3E4KP40      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A3E4NX82      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A3E4XFU8      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A412RG70      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A412TD37      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A413GAA4      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A414M7I4      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A496BTA0      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A496D2V6      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A4Q5G1P5      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A5C6KCA6      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A5M5AHM5      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A6I0KZV6      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A6I0Y5K7      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A6I1BFB8      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A6I2P5W5      -RLDMN---------------------YFVR-G-----KF------------------H-
E5UZA2          -RLDMN---------------------YFVR-G-----KF------------------H-
A0A069SMG6      -RLDMN---------------------YFVR-G-----KF------------------H-
C3RFN5          -RLDMN---------------------YFVP-G-----KF------------------H-
A0A3A5Z014      -HLDMN---------------------YFVP-G-----KF------------------H-
A0A6I0ING7      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A6I2P894      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A078S3Q8      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A069SJV7      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A3E5DXI5      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A3E5EM98      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A3E5F453      -RLDMN---------------------YFVP-G-----KF------------------H-
I9T3G6          -RLDMN---------------------YFVP-G-----KF------------------H-
A0A3E4SYU0      -RLDMN---------------------YFVP-G-----KF------------------H-
A6LGY1          -RLDMN---------------------YFVP-G-----KF------------------H-
K5ZSH4          -RLDMN---------------------YFVP-G-----KF------------------H-
A0A6A2RTB3      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A6I0VY00      -RLDMN---------------------YFVR-G-----KF------------------H-
A0A1M4YZ07      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A4Q5E5M7      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A0P0FQW1      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A5M5C0W6      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A6I0H151      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A6I0HI59      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A642LZ22      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A6I0IP89      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A642NJ89      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A6I0HI52      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A6I0YVB5      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A6G0G4T5      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A6I0HFG9      -RLDMN---------------------YFVP-G-----KF------------------H-
A0A416GA42      -DLDVC---------------------YQVK-G-----FW------------------R-
A0A1T3IYP5      -GADKS---------------------YKIH-S-----GL------------------R-
A0A3P1Z8V4      -GLEVD---------------------YTCR-E-----GL------------------H-
A0A060RD97      -DLNVS---------------------YSYM-G-----RF------------------R-
A0A3C1ITV0      -RLNVT---------------------YKSK-N-----WI------------------GY
R7HN19          -RLNVT---------------------YKSK-N-----WI------------------GY
A0A350IHV0      -GLEAS---------------------YVEK-Q-----FL------------------R-
R5RVP0          -GLETT---------------------YVEK-Q-----FL------------------R-
R6A0L2          -NLDVD---------------------YTTK-E-----KL------------------H-
R7LG80          -DLDVD---------------------YLMP-V-----SL------------------H-
A0A2L2WX98      -HLDVD---------------------YTIK-E-----SL------------------H-
A0A285T4L1      -HADVD---------------------YRVE-E-----GL------------------R-
G5GD56          -GLDVD---------------------YTTS-A-----GL------------------H-
R5KD55          -GLDVS---------------------YTTR-G-----TF------------------Y-
A0A174QNT3      -HLDIN---------------------YVVR-N-----GL------------------R-
A0A4S2FGS1      -HLDVE---------------------YTLR-N-----GL------------------R-
R9I0H0          -HLDVD---------------------YTIR-D-----GL------------------R-
K5BUT9          -HLDVD---------------------YAKD-G-----IL------------------R-
A0A174FPA3      -HLDVG---------------------YAKD-G-----IL------------------R-
R6S9Y6          -HLDVG---------------------YAKD-G-----IL------------------R-
A0A642LIH6      -HLDVG---------------------YAKD-G-----IL------------------R-
C9KX15          -HLDVG---------------------YAKD-G-----IL------------------R-
A0A6H0KRK1      -HLDVS---------------------YEKD-G-----FF------------------R-
R6DAG6          -HLDVS---------------------YEKE-G-----FF------------------R-
A0A3L8AAP1      -HLDVS---------------------YEKE-G-----FF------------------R-
A0A4S2AYX2      -HLDVS---------------------YEKE-G-----FF------------------R-
A0A4Y9H477      -HLDVS---------------------YEKE-G-----FF------------------R-
A0A0E2M2Y7      -DLDVS---------------------ISKD-G-----FW------------------R-
A0A0K2J6Z0      -DLDVS---------------------ISKD-G-----FW------------------R-
B2RKZ8          -DLDVS---------------------ISKD-G-----FW------------------R-
A0A212GC82      -DLDVS---------------------ISKD-G-----FW------------------R-
A0A254MU12      -DLDVS---------------------ISKD-G-----FW------------------R-
R6CQ93          -HADVD---------------------YRVE-K-----GL------------------R-
A0A3D1NQW3      -GLTVQ---------------------YETK-D-----GL------------------R-
B0MT10          -GLTVQ---------------------YETK-D-----GL------------------R-
R7JGW9          -GLTVQ---------------------YETK-D-----GL------------------R-
A0A3D2BF46      -NLHVN---------------------YVVK-H-----GL------------------R-
A0A358R538      -GLTTD---------------------YSVR-D-----RL------------------R-
A0A1Y4AAB8      -RLTTG---------------------YSKR-S-----GL------------------R-
A0A1Y3WWY9      -NLTEA---------------------YSIH-E-----HL------------------R-
A0A1Y4U5L4      -NLTEA---------------------YSIH-E-----HL------------------R-
A0A1Y3VCJ1      -NLTVN---------------------YTVD-G-----RF------------------Q-
A0A1Y3QTW7      -HLTVN---------------------YSVR-D-----GL------------------R-
R6XWY7          -HLTVN---------------------YSVR-D-----GL------------------R-
A0A4Y1X9Y9      -HLTVN---------------------YSVR-D-----GL------------------R-
A0A4Y1WM66      -HLTVN---------------------YSVR-D-----GL------------------R-
A0A174AVF1      -HLTVN---------------------YSVR-D-----GL------------------R-
A0A656Q4F4      -HLTVN---------------------YSVR-D-----GL------------------R-
A0A1Q6EIY0      -HLTVN---------------------YSVR-E-----GL------------------R-
A0A5B5VN71      -HLTVN---------------------YSVR-E-----GL------------------R-
E4M8L3          -HLTVN---------------------YSVR-E-----GL------------------R-
I3YQ50          -HLTVN---------------------YSVR-E-----GL------------------R-
R5UEY8          -HLTVN---------------------YSVR-E-----GL------------------R-
A0A1H4D866      -DLTVS---------------------YSVR-E-----RL------------------R-
A0A5B3G4Y7      -NLTVN---------------------YSVS-E-----RL------------------R-
A0A374A9J5      -NLTVN---------------------YSVS-D-----GL------------------R-
A0A5B3GQN5      -NLTVN---------------------YSVS-D-----GL------------------R-
A0A1Q6E9S3      -NLTVN---------------------YSVS-D-----GL------------------R-
D4IJ36          -NLTVN---------------------YSVS-D-----GL------------------R-
A0A414Q925      -HLDIS---------------------YKEW-D-----GL------------------R-
A0A415PUS9      -HLDIS---------------------YKEW-D-----GL------------------R-
A0A108TCU0      -HLDIS---------------------YKEW-D-----GL------------------R-
A0A413BA42      -HLDIS---------------------YKEW-D-----GL------------------R-
S3Y344          -HLDIS---------------------YKEW-D-----GL------------------R-
A0A4Q5G8Y8      -HLDIS---------------------YKEW-D-----GL------------------R-
A0A412TGL3      -HLDIS---------------------YKEW-D-----GL------------------R-
A0A413VJ33      -HLDIS---------------------YKEW-D-----GL------------------R-
A0A414L0W6      -HLDIS---------------------YKEW-D-----GL------------------R-
A0A412DP39      -HLDIS---------------------YKEW-D-----GL------------------R-
A0A413ZSE8      -HLDIS---------------------YKEW-D-----GL------------------R-
B0NP84          -HLDIS---------------------YKEW-D-----GL------------------R-
R6AK43          -HLDIS---------------------YKEW-D-----GL------------------R-
A0A412N2D9      -HLNVS---------------------YKEW-D-----GL------------------R-
A0A1Y4JYS9      -HLNVS---------------------YKEW-D-----GL------------------R-
R6LHA4          -HLNVS---------------------YKEW-D-----GL------------------R-
A0A3E5HPT8      -HADVS---------------------YMVR-D-----GL------------------R-
C6IJ48          -HADVS---------------------YMVR-D-----GL------------------R-
Q8A3U2          -HADVS---------------------YMVR-D-----GL------------------R-
A0A3R6S1H6      -NLNIS---------------------YRVE-A-----GL------------------R-
A0A3R6SD81      -NLNIS---------------------YRVE-A-----GL------------------R-
A0A354WXN6      -HLDIN---------------------YSIK-E-----GL------------------R-
R5IP14          -DLDVG---------------------YVMQ-G-----GL------------------R-
A0A316SZX7      -KLDVN---------------------YTED-M-----GL------------------Q-
A0A1Y4AIY1      -HLDVS---------------------YTEK-R-----GL------------------R-
A0A0J6CIR2      -NLDIS---------------------YTIK-D-----GL------------------R-
A0A3D8HG59      -KLDIS---------------------YTQK-R-----GL------------------R-
A0A3R6S408      -KLDIS---------------------YTQK-R-----GL------------------R-
F3ZRU7          -SLNTT---------------------YSVR-Q-----GL------------------R-
A0A1C5Q1F3      -KLDIF---------------------YSVK-G-----KF------------------R-
R7A239          -KLDIF---------------------YSVK-G-----KF------------------R-
A0A3R6HIK7      -HLDVS---------------------YQVK-R-----GL------------------R-
K5ZVW7          -HLDVS---------------------YQVK-R-----GL------------------R-
A0A1Y4D5Z0      -HLDIS---------------------YTVK-Q-----GL------------------R-
A0A413VXJ7      -HLDIS---------------------YKIK-E-----GL------------------R-
I9RSN9          -HLDIS---------------------YKIK-E-----GL------------------R-
U6RJK5          -HLDIS---------------------YKIK-E-----GL------------------R-
A0A1Q6GA32      -HLDIS---------------------YKIK-E-----GL------------------R-
I9RPU6          -HLDMS---------------------YKVK-N-----GL------------------R-
I8YFS5          -HLDMS---------------------YKVK-N-----GL------------------R-
A0A6H9LTF8      -HLDMS---------------------YKVK-N-----GL------------------R-
I8Y597          -HLDMS---------------------YKVK-N-----GL------------------R-
A0A1Q6GBF5      -HLDMS---------------------YKVK-N-----GL------------------R-
I8YFZ3          -HLDMS---------------------YKVK-N-----GL------------------R-
A0A6H9M1J1      -HLDMS---------------------YKVK-N-----GL------------------R-
A0A1Q6GDH2      -HLDMS---------------------YKVK-N-----GL------------------R-
U6RSB0          -HLDMS---------------------YKVK-N-----GL------------------R-
I9GXM2          -HLDMS---------------------YKVK-N-----GL------------------R-
I9SIK1          -HLDMS---------------------YQVK-N-----GL------------------R-
A0A6H9LZ74      -HLDMS---------------------YQVK-N-----GL------------------R-
I9TP59          -HLDMS---------------------YQVK-N-----GL------------------R-
R5S343          -SLEQI---------------------YTTK-R-----GL------------------C-
A0A1M6K7I9      -SLNMS---------------------YKVR-I-----GL------------------R-
A0A5M6A8C8      -SLNMS---------------------YKVR-I-----GL------------------R-
A0A6H9LT84      -HLDMS---------------------YTVK-N-----GL------------------R-
A0A6H9LUV5      -CLDMS---------------------YKIR-N-----GL------------------R-
A0A3R5ZMK1      -HLDVS---------------------YTVK-D-----GL------------------R-
A0A3E4ZTK7      -HLDVS---------------------YTVK-E-----GL------------------R-
A0A1Y3ZIA4      -HLDVS---------------------YTVK-D-----GL------------------R-
K5Y1A4          -HLDVS---------------------YTVK-D-----GL------------------R-
A0A4Q5CIT0      -HLDVS---------------------YTVK-D-----GL------------------R-
A0A3R6K8X4      -HLDVS---------------------YTVK-D-----GL------------------R-
A0A414GI87      -HLDVS---------------------YTVK-D-----GL------------------R-
A0A415BDM7      -HLDVS---------------------YTVK-D-----GL------------------R-
A0A412DM15      -HLDVS---------------------YTVK-D-----GL------------------R-
A7AEU7          -HLDVS---------------------YTVK-D-----GL------------------R-
A0A1Q6I3T6      -HLDVS---------------------YTVK-D-----GL------------------R-
A0A414XX40      -HLDVS---------------------YTVK-D-----GL------------------R-
A0A3R6BKI7      -HLDVS---------------------YTVK-D-----GL------------------R-
A0A414LPI6      -HLDVS---------------------YTVK-D-----GL------------------R-
A0A412M2W1      -HLDVS---------------------YTVK-D-----GL------------------R-
K5ZX55          -HLDVS---------------------YTVK-D-----GL------------------R-
A0A5F0U645      -DLDIS---------------------YSIR-E-----GL------------------R-
K5ZBN2          -DLDIS---------------------YSIR-E-----GL------------------R-
A0A0J6CKW3      -DLDIS---------------------YSIR-E-----GL------------------R-
A0A0F5IQM7      -DLDIS---------------------YSIR-E-----GL------------------R-
A0A496CDT3      -DLDIS---------------------YSIR-E-----GL------------------R-
A0A6G1ZKM3      -DLDIS---------------------YSIR-E-----GL------------------R-
S0GLB0          -DLDIS---------------------YSIR-E-----GL------------------R-
A0A3R6NLC1      -DLDIS---------------------YSIR-E-----GL------------------R-
A0A416WYC9      -DLDIS---------------------YSIR-E-----GL------------------R-
A0A0F5IT40      -NLDIS---------------------YTIK-D-----GL------------------R-
A0A496CX20      -NLDIS---------------------YTIK-D-----GL------------------R-
A0A5F0UBI0      -NLDIS---------------------YTIK-D-----GL------------------R-
A0A6G1ZHG0      -NLDIS---------------------YTIK-D-----GL------------------R-
S0GSI7          -NLDIS---------------------YTIK-D-----GL------------------R-
K5YB65          -NLDIS---------------------YTIK-D-----GL------------------R-
A0A0F5IWP9      -NLDIG---------------------YTVK-E-----GL------------------R-
A0A0F5IZT8      -NLDIG---------------------YTVK-E-----GL------------------R-
A0A417LKQ2      -NLDVS---------------------YTVK-E-----GL------------------R-
A0A416TME1      -NLDVS---------------------YTEK-D-----GL------------------R-
A0A416XPE8      -NLDVS---------------------YTEK-D-----GL------------------R-
A0A3B0C2S4      -NLDVS---------------------YFQK-G-----NI------------------K-
L8JI02          -DFGIS---------------------YFSK-E-----SF------------------R-
A0A4Q5WS95      -RLYAP---------------------VFES-G-----RF------------------G-
A0A501VZX6      -KLYAP---------------------VFEE-G-----KF------------------K-
A0A399SH26      -HLYAP---------------------VYED-T-----KF------------------K-
A0A501W1A9      -HLYAP---------------------IFEE-S-----RF------------------R-
A0A0E3ZGV6      -KLYAP---------------------VYEE-T-----KL------------------R-
A0A1I2N4S1      -KLYAP---------------------IYEE-D-----RF------------------K-
A0A2T5YE44      -KLYAP---------------------IYEE-D-----RF------------------K-
A0A1V9FHD0      -HLYAP---------------------VSEA-ADFGSLKM------------------H-
A0A4V4H170      -QLYAP---------------------VYEA-PDYKQGKI------------------H-
A0A1V9F098      -QLYAP---------------------IYEA-AG-NKGKI------------------K-
A0A4R2VU64      -YLYAP---------------------VYED-AG-NKGKL------------------K-
A0A4S8HY23      -HLYAP---------------------VFEA-PDFKKRKI------------------N-
A0A1V9F383      -LLYAP---------------------INEG-PEYSMGKF------------------N-
G8TRZ6          -HLYAP---------------------IYEG-IDFSQWKF------------------N-
A0A543WA52      -ALYAP---------------------VYED-S-----DL------------------K-
A0A1M5BA90      -HLYAP---------------------IFED-G-----PI------------------V-
A0A512B879      -SLYAP---------------------VFEA-T-----PI------------------A-
A0A559PPI3      -NLYAP---------------------VYEE-KDFFGLNI------------------K-
A0A1T5CS78      -DLYAP---------------------IYED-G-----RI------------------K-
A0A0Q9Z8F1      -NLYAP---------------------IYED-A-----GI------------------K-
A0A2N0U0M7      -NLYAP---------------------IYED-T-----GI------------------K-
A0A2N3U785      -SLYVN---------------------YYVE-G-----HI------------------K-
A0A0D3L8Q3      -DLDVT---------------------YYGD-G-----RI------------------K-
A0A0E3ZG78      -SLFIG---------------------YYIE-G-----RV------------------N-
A0A1I6BRK6      -DLVTR---------------------YYVE-E-----RI------------------T-
A0A243WAB1      -NLVAN---------------------YYVE-G-----KF------------------V-
A0A6G8C8X6      -GLFTS---------------------YYVE-G-----KV------------------K-
A0A5B6TJH8      -DLFTN---------------------YYIE-G-----QF------------------Q-
A0A519U664      -DLFTS---------------------YYVE-G-----KV------------------V-
A0A519UDD1      -GLFTS---------------------YYIE-G-----QV------------------K-
A0A519MA34      -DLFTS---------------------YYVE-G-----KI------------------I-
A0A519UCX0      -DLYTS---------------------YYVK-G-----RA------------------I-
A0A4R5DL69      -QLYIS---------------------YFVS-G-----NI------------------K-
A0A1M4YED3      -NLYTE---------------------IKEE-T-----QW------------------G-
A0A2H3NSN0      -RTAAD------------------------------------------------------
A0A2P6C324      -EDVAD------------------------------------------------------
A0A1M6XHU0      -VATAE------------------------------------------------------
A0A5S9C8G0      -VATVE------------------------------------------------------
G2SF81          -VATAE------------------------------------------------------
A0A5S9EYW1      -VATAE------------------------------------------------------
D0MHQ9          -VATAE------------------------------------------------------
A0A126PFG0      -QLSTL---------------------YQQR-D-----HL------------------G-
A0A3M1N7Z3      -RLNYE---------------------VYSI-G-----KV------------------G-
                                                                            

A0A1T5MMH4      NH--ELFGN---------S-PILV-SYKIENP--AFFNQPFFLEKE---SPET----FSL
A0A2W4R1L8      NY--EFFGN---------L-PFTV-DYTITRP--AFYGVPIFVDLG---STEA----VRL
A0A2E5CV79      ----KYYPR---------GEKYRRILKEIMSL--GIYSPEIEKEEH--------------
A0A2D4ZVH1      EVEFDQYGN---------KFPILWRAYPVDST-----------------ST---------
A0A0K8QSK7      DP--EVYTA---------A-PFVV-EWDRSHP--QMIGTRIRLTFA---GDGK----IRY
A0A1V6CN82      TA--ENYTD---------A-AFRV-EWDRNHP--QLIGFDFRISVH---PDRS----ITL
A0A1M4XZ45      IA--ERYEE---------V-PFQV-IWDEDHP--QIINADFYLTIQ---PDGK----LRV
A0A399D319      VS--ERYKE---------V-PFQV-VWDEEHP--QVIDADFFLTIE---PNGK----LKI
A0A1M6GR99      YY--NAYNE---------S-PFKVFIFKEHP---QLVGPVFDVILN---SDGS----YAL
A6EBM4          QT--DLYPQ---------Q-PLQIDILKIDSL--QSGRQLILFDPI---DHEK----FTL
A0A1M6TTV4      SD--ERYGN---------S-PFQV-LYNELSS--ELLDRRIYIEFV---GDNH----FYL
A0A4Q8RX32      NE--NLYTS---------S-PFEV-IIDKNHL--QMTNVVFNVEVL---SASE----FVL
K0X1U5          KK--EYYRN---------S-PFTV---DIPESMVDTLSSGFVVKVQTGGSDDK----IKV
R5EXK3          KK--EYYRN---------S-PLTV---EIPESMVDTLSSGFVVKVQTGDSDDK----IKV
A0A401UAP7      DY--ELYKN---------S-PFKVTPIEVNNS---YYNLNHTIDKK---SEAQ----FEI
A0A1W2GF52      VD--ERYGN---------S-PFEV-QYDLTNS--ALLDKRFDIEIL---NETD----FYI
A0A2G5L7B8      YD--ERYGN---------S-PFIV-DVQVSDP--SILNRRIDVEIL---SDDH----FVM
A0A523GAC0      ED--EKYRS---------P-PFKV-EYTFLDN--WVYDQQFTVAIS---NEDE----FIL
L8JW09          ND--EKFKT---------S-PFIV-DYNLKNP--QLLDRRIFVNIV---DEKT----YTI
A0A364XUP5      NH--ELFGN---------T-PYHI-EYKNVDD--GLYNIPLHLTET---DGNS----FSI
A0A1M5RLA9      ND--ELFQN---------A-PFLV-RYKAQNE--SSFNVPIHLDDS---GSDE----FTL
A0A385SFR9      ND--ELFQS---------A-PFVV-RYKAQNE--SSFNAPIHLDDT---GNDE----FTL
A0A5M4A9J4      EK--ELYNN---------A-PFRI-EWLSRHQ--QLVGATFEFDAQ---PHSG----RFI
A0A5M4B1C7      TS--ELYHK---------S-PFVV-KWNKGHP--QLIGATFEFTVD---DKGH----TSE
A0A0D3LFR6      DD--EKYRS---------A-PFKV-DYLLKDE--RFFNQKIYVNIH---DLQE----YTL
M7N6D4          DD--EKYRS---------S-PFEV-SYLVKDE--SFFNRRFFVRIH---NSEE----YTL
A0A4D7K1D4      NE--ERYRN---------K-PFRV-DYQVKSA--DLHNRLFNVHIS---SKEH----YTL
A0A5C7MX19      FISEELYKN---------C-PFEL-KMDVKDL--DILRVPIYINII---DEEK----FSI
A0A1Q3ZMZ7      TS--QIYQS---------S-SLGYKSLLIKDS--SIIGQPVYLILQ---DENL----IRY
A0A2D8JJW3      DTVSFLFNN---------E-IIDV-PIHIKEGCGTLIENISETIQI---KNEK----NAL
A0A2W2AFF7      KT--PLYED---------V-PFHFVFIPLYEDSVSKDMYTFSVKI----NGDN----IAL
R7PCR1          PI--SLFSI---------R-PFNV-VFQAPFSKALAFDVKIL-------DENS----FEL
A0A2N5YXE2      YT--ELYGN---------T-PFEV-NYRINNT--VILDQKVNIEFVDYKCHLY----YKI
A0A1G9E2A9      NS--EAYHD---------S-PFRV-EYKLKSG--AIQDRSIELEVL---NERE----YRL
A0A098LL25      YE--ERYNN---------S-PFKV-IGEIKHP--DFLDFKFDITFL---DKDK----FLL
A0A6C0GJI1      EE--ERYKN---------S-PFIV-NFDATSN--VPYDRPFDVQLL---NNSQ----YEL
A0A2T2YJE8      NE--ELYKN---------S-PFKI-TYQLTNE--AYYDRRYNVTLL---DATR----FNL
A0A127B287      EV--ELYKD---------S-PFKV-AFDSSRF--DLYDQKIYVTFD---SRTR----YTV
A0A3M9N829      DA--ELYKD---------S-PFAV-NYDTSAF--DLFDQQIFIAFS---SPSR----YEV
A0A0P0CSF9      DA--ELYKD---------S-PFQV-SYDNESF--NLYDQKIYVKFT---SPSR----FDL
A0A5M8QQB8      DA--ELYKD---------S-PFEV-LYDSVDF--NLYDQKIYVKFQ---SPSR----FDL
A0A3M9MNC3      DA--ELYKS---------S-PFEV-VYDSTNF--SLFDQKVYIHFN---SPSK----FDI
A0A5B6TAX2      DA--ELYKD---------S-PFEV-SYDSTNF--DVYDQKIYVKFE---SPSK----FDV
A0A5N1IQ33      AS--EVYKT---------S-PFRV-EYRIKDN--SFYNRKFNLNFL---DANR----FRL
A0A512AYT3      SE--ELYKN---------S-PFKV-IYEIKDD--GFYNKNFDVNFL---DENR----FTL
A0A5M6CYN7      SE--ELYNN---------S-PFKI-TYDIKDG--RFYNKKINVDFL---DANR----FRL
A0A369QP10      NE--ELYRS---------S-PFHI-SYEMSNE--AYYNIKFGVSIL---DATR----YNL
A0A126PDF2      ES--ELYGI---------S-PFQI-AYTIKDK--DLYNQKISLAFT---SPTR----YSI
A0A2Z3GKA1      ES--ELYGI---------S-PFRI-AYTIKDK--ELYNQKISLEFT---SPTR----YSI
A0A502GZP7      ES--ELYGN---------S-PFHI-AYVVRDK--ELYNQKISLVFV---SPTR----YSI
A0A519SBU8      ET--EMYNT---------S-PFHV-RYKVSDP--QFYSRKFQVSFP---APNQ----YVV
A0A4Q3JNZ3      EA--ELYNS---------T-PFHV-QYKITDP--ELYSHKFLLNFL---DSNR----YTV
A0A519Q9V3      EA--ELYNS---------A-PFHV-KYKIADQ--GLYNHKFLINFL---TPSK----YEV
A0A0M3RW20      ES--ELYKA---------S-PFHI-EYAIKDP--GYYGIQFNIQFL---NKDK----FIL
A0A495VFX4      ES--ELYKT---------S-PFHV-EYYITNL--NLYGVRFNVQFL---SDEK----FIL
A0A1S9B3W0      ET--ELYGV---------S-PFHV-TYTVREP--SQFNLKFSVKLL---DAQR----FKL
A0A1W1VRL3      ES--ELYTR---------S-PFQV-TYKIKNP--AFYNRKFNVNFS---SPTQ----FRL
A0A1M6R305      ET--ELYGV---------S-PFRV-DYE--GD--ILYNTKFSVVFT---SPQK----FRI
A0A4Z0PHK3      EN--ELYGV---------S-PFNV-EYKIKDP--SFYNTKFSLTFT---GPQQ----FRL
A0A2M9B9H9      EN--ELYGI---------S-PFKV-SYDIKDP--NFYNSKFNLNFT---GGKQ----FRL
A0A4Z0QCY9      ET--ELYGI---------S-PFKV-SYTIKDP--NYYNTKFNLNFT---GPQQ----FRL
A0A418R9X5      ES--ELYSL---------S-PVRI-EYKAGKG--AMFNQKIGLQLL---ENDR----FSL
A0A428JSJ3      ES--ELYNL---------S-PVRV-EYTANKG--AAFNQKIGLELL---DNDQ----FKL
A0A428KI59      ES--ELYNL---------S-PVRV-EYKAGKG--AMFNQKIGFQLL---ENDR----FRL
W8F1I6          ES--ELYNL---------S-PIRV-EYKAGKG--ALFNQKIGFQLL---ENDR----FRL
A0A246FQC0      ES--ELYAS---------S-PFIV-KYKPINN--AVFDLKIGINLL---SATT----FQL
A0A372E5P8      ET--EIYGA---------S-PFEV-SYEATAN--AAFDQKIALRFL---SPTT----FEL
A0A1H3EMW1      ET--EIYGI---------S-PFEV-SYQATAD--ATFDQKLALRFL---SPTT----FEL
A0A1H9ZSN3      ET--EIYGS---------S-PFEV-SYEALAD--AAFDRKIALRFL---SPTT----FEL
A0A5N1J2M4      DQ--EVYTD---------S-PFNL-IFKVNNP--ELYDKPVEVEFL---NKDR----FRL
A0A519S476      ES--ELYNN---------A-PFHV-RYKIADA--ELYGHKFQVSFP---TPDT----YQI
A0A4Q3JRW8      EA--ELYNN---------S-PFYV-RYKITDN--ELYNHKFLVNFL---PSNR----YQI
A0A519M923      EA--ELYSN---------S-PFRI-EYKVTDN--ELYGHKFQVSFP---TVSQ----YQV
A0A4Z0ENW1      EN--ELFGS---------C-PYQV-KYTISDP--VYYNHKFDVEYI---DTKH----YRL
A0A519UDB4      ET--ELFGN---------S-PFKV-IYTISDV--SYYNRKFNIEYI---DAKT----YRL
A0A3S0QKV1      ET--ELYGN---------S-PFRV-EYTVREP--IQFNKKFSVRLL---EGKR----FRL
A0A328BL48      ET--ELYRT---------A-PFRV-EYAVREP--LQFGQKFSVEVL---DQNR----FRL
A0A5R8WLY4      ET--ELYRT---------A-PFRV-EYTVREP--LQFGQKFNVEIL---DQNR----FRL
A0A1I5WSL8      EA--ELYGT---------S-PFKV-IYKITDP--SLYNRKFDLRFI---NKQR----FIL
A0A0U3JVM7      ES--ELYGI---------A-PFRV-KYHITDP--SLYNHKFDLKFV---GPQR----FAL
A0A1G1SSV2      ES--ELYGT---------S-PFRV-KYNITDP--SLYNRKFELRFT---GPSR----FKL
A0A1G1SXV7      ES--ELYRT---------S-PFRV-KYSITDP--SLYNRKFELRFT---APGR----FRL
A0A6G8CBJ6      ES--ELYKR---------S-PFKV-AYAIKDP--AFYNRKLNVSFI---SPTQ----FRL
A0A0W8EDI5      AS--ELYNA---------T-PFRI-DYDPADQ--ILYNRKFDIVFS---DAKR----FSL
A0A3B7RBP8      AN--ELYTD---------T-PFRV-QYSTKDG--FLFNKKIYINFI---DEQH----FLL
A0A3R9P8H7      ET--EMYNT---------S-PFKV-VYTPTDD--AAYDQKIAVQFM---SPTT----FRL
A0A238WIA7      ET--ELYKT---------S-PFKV-EYESKNG--SLFNTRFNLKFL---SPNR----VQL
A0A212UCJ7      ET--ELYRA---------S-PFKV-EYQTKGG--GQYNTKFGLRFL---TPQQ----IEL
A0A4Z0MQE1      ET--ELYRA---------A-PFKV-EYEVRAGGAGQFNSKFGLHFL---SPQQ----IEL
A0A4Z0PCF4      ET--ELYRT---------S-PFKV-DYETKAGGAGQLNTKFGLRFL---SPQQ----VEL
A0A5D6VDG1      ES--ELYGI---------S-PFQV-NYTITDP--SLYNTRFNVLFT---SSTK----FQL
A0A6H1CVS0      EN--ELYGT---------S-PFHV-DYTITDP--ALYNTRFSVLFT---SATK----FQL
A0A243WHR7      EN--ELYGL---------S-PFKV-NYKIKDG--SLYNTRFDLTFS---NPQQ----FRL
A0A5B8A0P6      ES--ELYGN---------S-PFKV-EYNIKNG--VFYNTPINIQFV---DNKH----FKI
A0A076HRT9      ES--ELYGT---------S-PFRV-QY--DGE--VLYNTKFNLRFK---DAQF----FHL
A0A4Z0PVM7      EN--ELYGV---------S-PFKV-AYIIKDP--NFYNSKFNLNFT---GPQQ----FRL
A0A1M6DHW8      EN--ELYGT---------S-PFEV-EYRIKDA--SLYNTKFNLVFT---GSQR----IRL
A0A4Q5LC61      EN--ELYGT---------S-PFKV-EYNIKDP--GLYNTKFNLIFT---GPQR----IRL
A0A2U1FKU2      KE--SLYAN---------S-PLSIKITNRDST--EGYSFRIQIK-----DEKT----FRL
A0A0A2F954      NE--SLYGN---------S-PVSIQITDRDST--ENYSFRIRIN-----DAHS----FQL
A0A0A2FW91      NE--SLYGN---------S-PVSIQITDRDST--ENYSFRIRIN-----DAHS----FQL
A0A2D2N2N1      NE--SLYGN---------S-PVSIQITDRDST--ENYSFRIQIN-----DAHS----FQL
Q7MWZ2          NE--SLYGN---------S-PVSIQITDRDST--ENYSFRIQIN-----DAHS----FQL
T2NDT6          NE--SLYGN---------S-PVSIQITDRDST--ENYSFRIQIN-----DAHS----FQL
W1R7P9          NE--SLYGN---------S-PVSIQITDRDST--ENYSFRIQIN-----DAHS----FQL
A0A1R4AFZ0      NE--SLYGN---------S-PVSIQITDRDST--ENYSFRIQIN-----DAHS----FQL
A0A1R4DVZ7      NE--SLYGN---------S-PVSIQITDRDST--ENYSFRIQIN-----DAHS----FQL
A0A2A8CVM9      --------------------PLLY-------------------------GEDG----QAR
A0A5M4B212      TS--ELYRN---------L-PFHV-EWDRNHP--QLLDANFDLHIL---PDNR----IEM
A0A3D1KEX9      PV--TLFKH---------N-PIKV---EFLSP--YFEDISFEVELL---PSKQ----LKV
A0A358Y7S2      TQ--NLYRE---------T-GFSLMVYSLNDS--SLCGTEMHVS-----VEND----LIL
A0A1X7J248      DD--ERYRF---------T-PFTV--SYDKSC--AAYGEKFFVDII---DKTN----FKI
E4TQD2          NE--ERYRF---------S-PFTV--SYEKSC--ANYDQKFYVDII---DKEN----FKL
A0A2J6HHN3      NS--ELYKS---------A-PFKV-YYELIDS--TFYAESLDITI----HDDH----LNV
A0A1Y3WMT8      NK--VEYYG---------NSPITV-DVPESML--DTLVSGFVVKVQTNKGSDK----IKV
A0A1Y4GQU1      SK--KEYYG---------NSPITV-DVPESML--DTLVSGFVVKVQTDKSSDK----IKV
A0A6A0R272      SY--ELYRK---------S-PINL-NLLSASD--EITPLEIDLEFK---DENH----FII
A0A1V5W8T5      TS--ELYNK---------T-PFFV-EYQDVQS--AIFNKNIYLDYNK--KTDK----ITI
A0A2T8HKA9      NI--ELYKD---------S-PIRVTFTKLDPE--AHASMTIIPKDS---NHVD----FLL
A0A2I0QZ80      TE--QRYRQ---------G-NLEISPLLLKDS--SLLNTPINITT----EGNK----IFL
A0A3E1F1A3      TE--TLYKQ---------N-SVSIDPVLLKDS--SLFGVPIYLSV----DEEK----VLM
A0A2U2XBJ3      TE--TLYKQ---------G-VVRIMPLIIKDS--SLFGTPIFLSS----MEDK----IIM
A0A4Q4KU94      TE--TLYKQ---------G-TIRIKPLIIKDS--SLFGTPIFLSA----FDDK----VIM
A0A3B8INU3      DD--EKYKE---------S-PFEA-TITVRNP--AVFDKKVMVTIL---DNDR----YEI
A0A2W1NDY9      IE--EKFKQ---------S-PYHLIFYELKDS--SLINVPIYLK-D---GQDG----LYL
A0A5C8AQR5      TE--EMYRT---------S-SFNVQPYSLNDS--ALCNVPIYVEYM---GNNR----IRL
A0A1G0CI31      TE--EKYLQ---------S-SFNVQPFQLKDS--SLCDIPIWIE-L---KGNK----VQL
A0A556N0M0      TE--EKYHQ---------S-TFTVLPYALRDS--SLCDVPIGVETT---DNRR----VKL
F2IKD6          TE--EKYHQ---------N-TFTILPYSLSDS--SLCDIPIWIETL---ENRK----IRL
A0A1I7BM74      TE--ERYTQ---------S-QFQVQLFKLNEP--DLYNLPIYFYKD---NSNQ----YKI
A0A2G2FJ17      TE--KRYKQ---------S-TFYIKQSHIKDS--SVFHIPIYIKPK---AQGL----VEL
A0A2E3R1D0      IEAETVPGT---------NRPLPI-------------------------LRD--------
A0A2T2USC0      DSMETNPYT---------GEQLSV-------------------------LTGP----KDP
A0A2T2V0F3      DTMETHPRT---------GEPLAV-------------------------LTG--------
A0A2T2S682      DTMGTHPRT---------GKPLDV-------------------------LTT--------
D5H561          LEQGEARRVLSSQGVSPFGRLMDR-------------------------AWA--------
A0A2H3NWA9      DEM--YPEG---------EGPPIM-------------------------YTA--------
A0A2A8CVB6      LALGRHPET---------GRPIQM-------------------------LSD--------
A0A2P6C1S6      QRMGTHPDT---------GQPLQI-------------------------LRG--------
A0A2T2UTM4      QDLGTHPET---------GEPLQI-------------------------LRG--------
A0A414ZBF2      KR--ELYNS---------T-PFTV----VFQD--AEPGQEISLTATAIDGNRA----LLS
A0A1Q3Q573      FITEDLYQS---------A-PFEI-LPEQIAP--EFYGNPVYIRLV---NKNS----MVV
A0A662BAY3      SR--EIYKE---------S-PFEV-IWDYEHP--QLIYADFLLEIL---PDGK----LLI
A0A4U3L369      TI--ETFEK---------T-PYSV-HLVAMRD--SIAPFTLHWKEV---NPTS----YAL
A0A357YNR3      SN--SLYGN---------ESPVLVRMSDKDLN--NLIDKVSIDVVVYPTGNYN----FSV
A0A5E8AX52      TE--ERYRN---------S-PFVV-SYKLHNT--GFFDRPIDIEII---SESE----FEL
F4KK08          EK--DLYKQ---------S-PVSIRFVNADPD--EKISLRIKSDKEAHNQVIL----YDI
A0A6B5PK86      TE--EKYKL---------S-SVNVQPYHLNDS--TLVGTPVTITY----VNQL----VNL
A0A2G2F510      TE--EKYLS---------S-SYYIQPYELYDS--TLINKEVRVDY----DGEN----ISL
A0A316JZ08      TE--ELYLA---------S-SFNIQPYELVDS--TLIGQEIGITT----RNDQ----VIL
A0A496LCF9      NV--PLYGR---------S-PISIEIINIYEE--GYYMYYSYKKR----DSHS----FTI
A0A5P2G2A9      IR--ELYKD---------K-PFGI-TLSNNAD--PIKGYKFEISSW---DEKG----IAL
A0A3C0ZQC7      -------------------------------------------------SERI----LII
A0A419VXB7      DF--ILYGN---------E-PCHV-EFEPDAF--NLKGVPVHISPI---NDRE----FKI
A0A0B0BTJ4      YS--YLTAE---------SSPLKL----TADT--IRYTFNIHIKSIEDADGSF----KAL
A0A3B9CNN6      YS--YLTAE---------SSPLKL----TADT--IRYTFNIHIKSIEDADGSF----KAL
R5X290          YS--YLTAE---------SSPLKL----TADT--IRYTFNIHIKSIEDADGSF----KAL
A0A1Q6E6I7      YS--YLTAE---------SSPLKL----TADT--IRYTFNIHIKSIEDADGSF----KAL
C3J7R8          TE--MLYKD---------T-PLEVRFVGNSSD--VYCKLEVSSVDA---SHVS----LLC
A0A1G8BVM8      FK--DLYTS---------S-PIEV-EYMDDVA--KQGMFTITVTLL---KNNK----AKL
A0A1I1FXP9      FS--EMYKS---------S-PFRV-EYEVKNP--AFYDIPVDVLFI---DEKQ----FSL
A0A3N4H5N3      KK--EISPF---------SLPVEIEVHEINND--FVGGGELLQIHLK--EENK----FEL
A0A2P8EAX2      KR--EISPY---------NVSINIVVHEFNEE--FLLEGEVFTIKVL--NEKK----FEI
A0A4V2F6N9      KK--ELSPY---------NVPVNLIVHEFNEE--FLSGVEVFAITIL--GDKK----FEI
A0A3B9FXJ0      NT--DMYYN---------G-PFWV-DIDVQDS--TVLGDVIELRPI---GDQK----IRC
R5GSU5          QS--TLYKK---------R-PFEA-TFLRPAE--IDEDITFKVDLI---DNQK----FRI
A0A2A3UE91      NN--ELYDS---------S-PYLI-KINAKKG--TVYGSQIKVELNKQLTGGV----LKI
A0A0A2G557      SK--KLYKE---------T-PIRL--TLLNTS--DTLSGSFSLSFI---EENK----VSL
A0A2N2WFW8      NF--ELYDG---------A-PFHI-QYQIVDS--LSYGTPYSLTV----GDST----FVI
A0A1F3IU95      NF--ELYDD---------V-PFDI-KYEIVDS--TFYGVPLLIEV----HDTG----FVI
A0A3D0VUF6      NF--ELYDD---------V-PFDI-KYEIVDS--TFYGVPLLIEV----HDTG----FVI
A0A1T4PT95      SK--KLYKD---------S-PIHLTLLEFPED----HSGSFILSFE---GSDK----VRL
A0A6I6JYY3      TS--ERYRE---------V-PFTV-EWDEAHP--QLTNSEFLLQID---ANGK----LHL
A0A2A4PYG9      DS--EIYTA---------S-PYTV-EVRNVGP--GLLGKPIYISFP---STKK----IYT
A0A1F3K695      TN--ELYRM---------S-PFTV-EANILDS--RIYEIPIYIDFI---SSKE----TKA
A0A353KZR1      TN--ELYRM---------S-PFTV-EANILDS--RIYEIPIYIDFI---SSKE----TKA
A0A2N2WYB5      ST--ELYKR---------S-PFKV-EWKTLNP--SIFNTPIYIDFT---DDKN----GII
A0A1F3K4G0      ST--ELYRR---------S-PFQI-EWKMITG--KLYDIPVYIEFD---GSEK----ALI
A0A356H8Y3      ST--ELYRR---------S-PFQI-EWKMITG--KLYDIPVYIEFD---GSEK----ALI
A0A351HSA6      ST--ELYRR---------S-PFQI-EWKMITG--KLYDIPVYIEFD---GSEK----ALI
A0A1F3Q014      NN--ELYTS---------S-PYSV-DYKIINP--KISGVKIYIDFV---DSTH----GTI
A0A2A4YXP3      TN--ELYRS---------S-PIKV-EHQVKDS--SILGQHFYVKFI---DTHK-------
A0A2D5KD44      RN--EIYKN---------A-PFNV-EVLYKEP--SLSSTKIDISFA---NSSS----GKL
A0A1F3R158      TF--ELYKN---------S-PINI-EYYIKDS--SVIGISHFVEIT---NNNK-------
A0A2M8ADX2      TF--ELYKN---------S-PLDV-NYDIKDS--SIIGLPFYIELT---QNDK-------
A0A1J5B2H0      NF--ELYKS---------S-PFEI-KYSIKNP--AIYGIPIYINFN---DDKQ----IKI
A0A1V5N756      NT--EMYRS---------N-HYNV-HYVVKKP--VIYNVPINISFL---SNSN----IHI
A0A651GU15      TR--QLYRV---------P-QPKLNLVAITDS--SILDKQIFIRNL---ADGR----YEL
A0A3Q9FR88      DS--ELFGD---------AVPFTFEYPNNVQP--TLKDLPFFLEFSN--GGKD----FII
A0A553GEX3      NS--ELFGD---------AVPFTFEYPNNIQP--ALKDLPFLLEFSN--GGKN----FII
A0A150ADJ9      DS--ELFGK---------NLPFSITFPSGKLP--FLQDKPILLNFSG--DGKS----YQL
A0A1B1FWQ4      DS--ELFED---------GVPFTLTYPSGKQP--ALKNTPFYLQFSN--EGKE----YVI
A0A1S1Z228      DS--ELFGD---------GVPFTLTYPSGKQP--AFKDIPLFLQFLN--GGDQ----YQV
A1ZKR2          DA--EYYKN---------P-PFKVIDHQVKSD--AFLDKNINIEII---DDQR----FQL
A0A1Q3GX01      EA--EYYTN---------A-PFKVVDYKIKAP--VYYDKKFNIRIK---NQNE----FEL
A0A349DQI4      EA--EYYTN---------A-PFKVVDYKIKTP--GYYDKKFNIKLK---SQKE----FEL
A0A4P5TMD1      VE--ERYKT---------S-PFEI-VPTVNEP--ALYDIPIYFIFK---SARE----FQI
A0A2N3IIZ0      DN--EMHGF---------S-PIEV-QAVVLNE--NLYNQKFYIESE---DGHS----YNI
A0A1F3SJM1      TE--EKYLS---------S-SFHVQPYELRDS--SLVYEGTEVAVAY--NNGK----VVL
A0A2G2EB96      TE--EKYLS---------S-AFNIQPYQLSDS--SLINQEIAV-TSS--GNSK----VKL
A0A2G6PRA9      TE--EKYLS---------S-SFNIQPYELSDS--SIINQEVAV-VSK--GRNK----VEL
A0A497D5Z2      TS--EMYRN---------P-PFRV-QWEEGHP--QVINADFYVSFL---PGGK----LEL
A0A662B170      TS--EMYRN---------P-PFRV-QWEEGHP--QVINADFYVSFL---PGGK----LEL
A0A2A5FYT6      AT--ENYAN---------H-PYSV-GFQVKDS--SIFGRKIYIQFD---DEFK----AIA
A0A2E6SYP1      NT--ENYRS---------S-KYKI-SYQIKDK--SVLNKLIQIEFV---KGCA----LLS
A0A2E5RLE8      NT--ENYHS---------N-PFSI-SYQLKKR--EAVKSPIMVNFS---NGSA----IIS
A0A2E7TQF6      NT--ENYHS---------N-PFSI-SYQLKKR--EAVKSPIMVNFS---NGSA----IIS
A0A2E6GVY9      NT--ENYQS---------N-PFSI-SYQLKKR--KAVNYPLMINFK---NGSA----VIS
A0A350JJ90      NH--ERYLS---------S-DFEV-IYEIHDP--IILDRRIYIEFE---TPTS----GTI
A0A3M1CDV2      NH--ELYKN---------S-PYLA-DINIKNE--NIYGKKIYVDFNDNLQTGK----IKI
A0A6C1QGZ7      NH--ELYRN---------S-PFTV-DIIVKDP--SIYGIPVYLDFV---SQEN----III
A0A4P5U6G4      VE--EKYKS---------S-PFEI-LPLVKTN--SIYDLPINFEFI---NNKS----FKI
A0A2E2TFD1      NY--ELYMS---------S-PYIV-DYDIISA--EAFAHKYYIYFP---NTTQ----IHL
A0A2E4ELE6      TF--EHYKS---------C-PFEV-KFEIKSP--EAFGKDYYVYFE---SEKE----LIL
A0A522EYA6      EN--EHYGT---------T-VYTA-ETEVKSD--IIYGTKIYVYFD---SETS----GEI
A0A2E3XZI5      SR--LLYKK---------N-TYKLENFYIKDS--SIISKKIYLKF----EKNY----FSL
A0A6I7QXV0      VVHSELYRS---------S-PFTITIDEIKDP--AIYEREIYINII---DRNT----FTL
A0A2M7NLQ9      FNYFERFQD---------S-PFEVTEYEVYDA--SFYNRHLDIQII---DEEE----FVL
I4AFR0          FNYFERFQD---------S-PFEVTDYEVYDN--SFYNHPLNIQII---DEEE----FVL
A0A2N2Y3E5      ET--EQYRN---------S-PFTV-VFRNEGF--KHFDVPIALDFE---NITD----GWL
A0A2D9D7T6      TK--DLYRS---------N-LVSVEPVKLLDS--TLCGVHFDIKE----KKGK----LEI
A0A1F3PPL5      SN--EMYKS---------S-PFEV-KVKINNG--AIYDKKIYIDFE---NPTT----YHL
A0A357QK06      SN--EMYKS---------S-PFEV-KVKINNG--AIYDKKIYIDFE---NPTT----YHL
A0A662AEA4      ST--ELYRT---------S-PFIV-KTKIKNP--SIYNTPIFVNFN---NKNS----FSI
A0A0S2HYK8      SD--EIYQS---------S-PFEI-QYKIKDS--KAFGIPVFISFK---DKKN----VVF
A0A2N5ZWN6      ST--ETYNN---------S-SYSV-NYEIQNP--SIYGEPIHIQFI---DENN----AKI
A0A2E0FJ09      KH--EKYNG---------S-LFLVEDFQLLNS--SLVNVPIYVLLK---PDKT----IHL
A0A1F3FZ62      NF--DVYRN---------T-PFII-EQKVFNP--SIYGINFDIEFK---GNNK----YIL
A0A1F3K211      NF--DVYRN---------T-PFII-EQKVFNP--SIYGINFDIEFK---GNNK----YIL
A0A1V6I2U9      ST--ELYGS---------T-PFEI-KYNIINT--EIYDQNIDLEF----KDYK----CHI
A0A2H0B957      VS--ELYKA---------T-PFTV-DFHITKG--NLYNIPIYVSFS---LNGD----AAI
A0A1F3CFW6      EN--ELYKA---------N-PFSI-DYKNTKR--NLYNVPIYVSFD---KNGD----SNI
A0A2M7E2T8      EN--ELYKA---------N-PFSI-DYKNTKR--NLYNVPIYVSFD---KNGD----SNI
A0A2M7NC69      EN--ELYKA---------N-PFSI-DYKNTKR--NLYNVPIYVSFD---KNGD----SNI
A0A1F3KLL5      ST--ETYRT---------S-SYII-EVRNVEP--EMYNNQIYISFL---NKNS----FTL
A0A359D1M1      ST--ETYRT---------S-SYII-EVRNVEP--EMYNNQIYISFL---NKNS----FTL
A0A0F2NS19      EY--ELYKN---------S-PFKV-FFEVKDS--SVLGKKFYLEKT---NNEK----FNL
A0A2A5H8X6      EY--ELYKN---------S-PFKV-FFEVKDS--SVLGKKFYIEKT---NNEK----FNL
A0A2H0GAU8      NN--ELYVG---------S-PMKV-NYAIKDS--SIVGIPFFIEIT---KNNK----FNL
A0A2M8FTK1      NN--ELYVG---------S-PMKV-NYAIKDS--SIVGIPFFIEIT---KNNK----FNL
A0A2A5B3B0      IN--ELYRS---------T-PIKV-SYVIKDS--TILGQSFFVEFI---DDYK----FRL
A0A5C6RXM7      EH--ELYKS---------A-PIDV-EFNIKDS--SIINHTFNVVIN---DINQ----FEL
A0A1F3C1M2      KN--ELYKN---------A-PFTI-EFNIKNN--IVYDIPIYIEFI---DKLN----FNL
A0A1F3DS87      KN--ELYKN---------E-PFSI-EFNIKNN--IIYDVPIYIEFI---DKIN----YNL
A0A6A0R6K9      TN--EIYSN---------N-PFDV-NILWKDS--TMGSRKVMIDFVSKEKGTL----SWH
A0A2E7CT70      TS--DLYKT---------S-PFEIKDLKIRDS--IIIGLPIYIQK----KGDY----FIL
A0A2D5V560      TR--FLYNQ---------S-PXSFENFSIKDM--SIISKPIYLLF----DGNY----FSL
A0A2D7K5A8      TR--FLYNQ---------S-PFIFENFSVKDE--SILSKAIYLLY----DGTY----FSL
A0A2E1XQ82      TR--FLYNQ---------S-PFIFENFSVKDE--SIFSKPIYLSF----DGTY----FSL
A0A5C8A5B4      KQ--EQYAY---------P-PFFVKLDSMAIQVID-------VPIEVEVDRAARTYRVK-
A0A4Y9ITE2      KK--KLKYD---------NTPVEIVIPPMFSDTVS-------EPVIFKLTATKDGKVDIK
A0A5M8NYX7      KN--EL-YN---------QTPLWVILKNQIG------------------WG---------
A0A3D5KRY6      KR--DL-YK---------NDPLTLVLPSDFIQLEN-------VPIHIKIIS---------
A0A1V5IPN7      ------------------------------------------------------------
A0A0E3V905      KR--EI-YT---------DSPIELIVESGKPELYK-------KPLEVSMLS---------
A0A553ETH6      ID--EK-YQ---------NSPFRVKFIVKDGNVYD-------KRIYVRLIN---------
A0A640Q161      ------------------------------------------------------------
A0A640QU49      ------------------------------------------------------------
A0A1Q3PII2      TT--EL-YE---------KTPYKITLLKPRT--AK-------PTTY--------------
A0A351BXT2      ------------------------------------------------------------
A0A2K8Z965      KR--EL-YE---------DSPIELIIEQPISALYK-------SPLDITLPG---------
A0A418M8U8      KR--EI-YK---------ASPVDVFVEFGKPELYE-------EPMLLTFID---------
I2GTA4          KR--EI-YK---------ASPVEVFIEFGKPELYE-------APMLLTFID---------
A0A2K8ZAJ2      KK--HI-YQ---------ESPIRLIVEKPTSQLYM-------EELKFLFVD---------
A0A368JPA3      KR--EI-YE---------EAPIRIVLTDPTPNLYR-------ADLEIGIIS---------
A0A5N1JI29      KR--EI-YE---------EAPIRIVLTDPTPNLYR-------ADLEIGIIS---------
A0A3P1BT12      KR--EI-YD---------DAPLRIILKEPTANLYR-------ADLEIGIIS---------
A0A3P1CI15      KR--EI-YE---------EAPIRLVLSDPTPNLYR-------ADLEISIIS---------
A0A4R8CUK1      QR--EI-YD---------NTPVRLVLDSPTPNLYR-------ADLHIGILS---------
A0A3D0MYJ7      -----------------------LDTLNTIKDIDK-------SLYP--------------
A0A662AH13      -----------------------IDSFNVID--KP-------DSFY--------------
A0A5C7QA01      KD--NL-KS---------LHIKQFDLPEAYL--DQ-------PLHL--------------
A0A3D3LS70      -----------------------IDSFKNSD--SK-------TDFY--------------
A0A1G1TM36      AQ--DL-YG---------KSPVQLTFLHTLR--GQ-------HVLN--------------
A0A1G7ZF38      TT--EL-YD---------KTPYKVRFLKSRP--AK-------PESY--------------
C6VS52          TT--EL-YE---------KAPYRVRFIQKQP--PR-------PETY--------------
A0A2A4G4B1      NT--ELFLD---------K-PFKLEWLSPINDSYT-------FDFAL-------------
A0A0P7X1V8      --------------------------------------------------------PVIW
A0A5C8KAD6      ST--NAYTS---------S-PIRIKLK--NPE-------------DIKQTVQV-------
A0A5N1J695      SI--PAYAS---------S-PVIIKVK--NPE-------------RISEVPQV-------
A0A1H4ADG3      SK--PLYKK---------SLPFTTSITGFSTD-------------NLDPSQLS-------
A0A5B8VUR8      SE--PLYKE---------SLPFKISIEGFTTD-------------NLDPKQLR-------
A0A3N2M1H3      PV--TLYGH---------TLPYIVDMQGIEEQ-GG-------ASFKMELSADG--N-IKM
A0A4S2G8T2      PV--TLYGH---------TLPYIVDMQGIEEQ-GG-------ASFKMELSADG--N-IKM
A0A1T5K9D4      NI--ELYRN---------A-PIRIFFSREDNPIGY-------FTIKATPRDSK--T-IEL
A0A077ENE7      DY--ELYKK---------S-PVQVKVEGISSE-GS-------YNFTVIPLDGN--S-VII
A0A6I5UW06      DY--ELYKK---------S-PVQVKVEGISSE-GS-------YNFTVIPLDGN--S-VII
T0NN57          EY--ELYKK---------S-PIYAKVLGKRAE-DS-------YSFVITPIDSR--S-VII
X5K347          EY--ELYKK---------S-PIYAKVLGKRAE-DS-------YSFVITPIDSR--S-VII
A0A212K7W5      NK--PLYKN---------S-PVIVSIDSTNVN-ES-------FSFYIELLPQN--K-IRL
F5IU11          NR--SLYKN---------S-PVIVSTGPVNVN-ES-------FSFQIELLSQN--K-IRL
A0A6I1IYY4      NT--SLFAE---------S-PVEVTFFD-PYH-SF-------VSMNVTPLDVK--N-YTI
K0XJ09          YD--QLYAE---------S-PIRVNFLD-AYT-AP-------VSMEIKPLNGN--R-FLL
R5EUZ0          YD--QLYAE---------S-PIRVNFLD-AYT-AP-------VSMEIKPLNGN--R-FLL
W0EQS0          YK--SLYAE---------S-PIRVNFID-PYT-AP-------VFMKIRPLDDT--H-YLL
A0A1Y3WE15      NK--QLYAE---------S-PIRVDFLD-DYT-AP-------VSMKIKPVDEN--R-FLL
A0A1Y4GUK3      NK--QLYAE---------S-PLRAHFLD-AYT-LP-------VSMKVSPIDEN--H-YAL
A0A352Z1R7      DF--KLLDF---------S----------STA-KT-------PSYRIEMTGADTFT----
A0A3N2N6F7      PV--SLYGD---------SMVLSVSLPDISVN-RG-------LRMRMTILEDG--K-VEV
A0A4P7VVU7      NI--TLYGD---------SCPVSVDFLSIPSK-QS-------ASMELDIRDDG--K-IDI
A0A2V1ILM4      NI--TLYGD---------SCPVSVNFLSIPSK-QS-------ASMELDIRDDG--K-IDI
A0A3N2L0E8      NI--TLYGD---------SCPVSVDFLSIPSK-QS-------ASMGLDIRDDG--K-IDI
A0A3N2LFC5      NI--TLYGD---------SCPVSVDFLSIPSK-QS-------ASMELDIRDDG--K-IDI
A0A0A2F501      KE--VLYGQ---------ELPYRVKFLGLKDT-DN-------ASLTLTILANG--Q-FAI
R5B7P0          RN--VLYGT---------SLPISADLLDVDEN-VG-------VGFTVS-ENGG--R-VTL
R5B0L5          KD--LLYGS---------SLPIDVDFSTLADG-ES-------GSVIVKINKKG--V-IVL
A0A6I1TEC0      RN--VLYGN---------DLPVTVQFLTIGEE-HY-------GSMTVYLKGGD--K-FEL
A0A3R5XWG1      RN--VLYGN---------DLPVTVQFLTIGEE-HY-------GSMTVYLKGGD--K-FEL
A0A646GTR1      RN--VLYGN---------DLPVTVQFLTIGEE-HY-------GSMTVYLKGGD--K-FEL
A0A5P0Y910      RN--VLYGN---------DLPVTVQFLTIGEE-HY-------GSMTVYLKGGD--K-FEL
A0A414YFM3      RN--VLYGN---------DLPVTVQFLTIGEE-HY-------GSMTVYLKGGD--K-FEL
A0A6A7UIA7      RN--VLYGN---------DLPVTVQFLTIGEE-HY-------GSMTVYLKGGD--K-FEL
A0A6A7VPS3      RN--VLYGN---------DLPVTVQFLTIGEE-HY-------GSMTVYLKGGD--K-FEL
A0A374THP7      KE--ALYGG---------DLPVTVDFIGFTDD-QS-------GSFQLQLKGDG--S-YVI
A0A6G1VND1      KE--ALYGG---------DLPVTVDFIGFTDD-QS-------GSFQLQLKGDG--S-YVI
A0A0A2EVS5      RS--TLYGS---------ELPIVVSIDRFYGA-LE-------WSLSVTVRGDG--M-VEV
A0A1T4NAJ7      RS--TLYGS---------ELPIMVSIDRFYGA-LE-------WSLSLTVRGDG--M-VEV
A0A255T941      RV--ELYGT---------S-PVEVMMRK-QSK-YP-------FSFVIKLNDEH--S-FTL
A0A3N2KCL3      DV--VAYGS---------NLPVRVEMPGFAEN-GS-------ASFRVEVDGDG--K-VSV
A0A4P7VSV0      DV--VAYGS---------NLPVRVEMPGFAEN-GS-------ASFRVEVDGDG--K-VSV
A0A2V1IJY1      DV--VAYGS---------NLPVRVEMPGFAEN-GS-------ALFRVEVDGAG--K-VSV
A0A4P7VXK7      DV--VAYGS---------NLPVRVEMPGFAEN-GS-------ALFRVEVDGAG--K-VSV
A0A1Y4CHN5      DR--VLYGQ---------NLPVSVSFLDLNDN-ES-------ASFTIKPAADG--T-LGF
A0A1M6I2S6      DV--GLYKS---------N-PVAVSYRH-QDE-TP-------VSFKIDFSSKE--E-FTI
A0A1Y3V692      DV--GLYKS---------N-PVAVSYRH-QDE-TP-------VSFKIDFSSKE--E-FTI
F3PXM2          RV--ELYRS---------A-PVAVRFCG-KAE-RP-------VAFDLELTSRN--D-FLL
A0A3E4ZNL4      QI--ELYKN---------S-PVWVTYLA-NNK-KD-------VSFAIEINGSN--Q-FHL
A0A174AHH7      RI--ELYKS---------S-PILVTYLV-DNK-KN-------VSFDIEVDTQN--K-FYL
A0A174JCE8      RI--ELYKS---------S-PILVTYLV-DNK-KN-------VSFDIEVDTQN--K-FYL
A0A3E4JMC4      RI--ELYKS---------S-PILVTYLV-DNK-KN-------VSFDIEVDTQN--K-FYL
A0A412SND6      RI--ELYKS---------S-PILVTYLV-DNK-KN-------VSFDIEVDTQN--K-FYL
A0A414IEQ9      RI--ELYKS---------S-PILVTYLV-DNK-KN-------VSFDIEVDTQN--K-FYL
A0A415UKN5      RI--ELYKS---------S-PILVTYLV-DNK-KN-------VSFDIEVDTQN--K-FYL
A0A6I0U0V8      RI--ELYKS---------S-PILVTYLV-DNK-KN-------VSFDIEVDTQN--K-FYL
A0A6I2PDH7      RI--ELYKS---------S-PILVTYLV-DNK-KN-------VSFDIEVDTQN--K-FYL
A0A0M1W8D8      RI--ELYKS---------S-PILVTYLV-DNK-KN-------VSFDIEVDTQN--K-FYL
A0A3R6GKX5      RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
A7V4S1          RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
B0NU19          RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
D4V601          RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
A0A4Q0U3M9      RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
A0A4R4H1Q2      RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVDAQN--K-FYL
A0A6I0GII7      RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
A0A6I0KYU7      RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVDAQN--K-FYL
A0A397WLT5      RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
A6KY94          RI--ELYKS---------S-PILVTYLF-DDK-KS-------VSFDIEVGAQN--K-FYL
A0A173UQR8      RI--ELYKS---------S-PILVTYLF-DDK-KS-------VSFDIEVGAQN--K-FYL
A0A3R6HK75      RI--ELYKS---------S-PILVTYLF-DDK-KS-------VSFDIEVGAQN--K-FYL
A0A412B7D1      RI--ELYKS---------S-PILVTYLF-DDK-KS-------VSFDIEVGAQN--K-FYL
A0A412VNY9      RI--ELYKS---------S-PILVTYLF-DDK-KS-------VSFDIEVGAQN--K-FYL
A0A414LTU9      RI--ELYKS---------S-PILVTYLF-DDK-KS-------VSFDIEVGAQN--K-FYL
I9Q4U4          RI--ELYKS---------S-PILVTYLF-DDK-KS-------VSFDIEVGAQN--K-FYL
A0A6A2J529      RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
A0A3R6GM96      RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
A0A015XH67      RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
A0A078RZN2      RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
A0A4R4I3T9      RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
A6L0K5          RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
A7ACT5          RI--ELYKS---------S-PILVTYLF-DNK-KS-------VSFDIEVGAQN--K-FYL
A0A373ISF0      NV--GLYKA---------N-PVAVTFGE-VME-KP-------VSFTIRIDSKD--A-FTI
U6RF62          NV--DLYKA---------N-PVAVTFGE-VME-KP-------VSFTIRIDSKD--A-FTI
A0A662ZZD5      DV--ELYKS---------S-PLAVTYRH-LDE-TP-------VGFTIDISSKE--T-FVI
A0A3A5TI83      DV--ELYKS---------S-PLAVTYRH-LDE-TP-------VGFTIDISSKE--T-FVI
A0A415NEB6      DV--ELYKS---------S-PLAVTYRH-LDE-TP-------VGFTIDISSKE--T-FVI
A0A6I0I238      DV--ELYKS---------S-PLAVTYRH-LDE-TP-------VGFTIDISSKE--T-FVI
A7AJ60          DV--ELYKS---------S-PLAVTYRH-LDE-TP-------VGFTIDISSKE--T-FVI
A0A6A2JF01      DV--ELYKS---------S-PLAVTYRH-LDE-TP-------VGFTIDISSKE--T-FVI
A0A6I0Y2Y2      DV--ELYKS---------S-PLAVTYRH-LDE-TP-------VGFTIDISSKE--T-FVI
A0A6I2Q447      DV--ELYKS---------S-PLAVTYRH-LDE-TP-------VGFTIDISSKE--T-FVI
A0A395YYT3      DV--ELYKS---------S-PLAVTYRH-LDE-TP-------VGFTIDISSKE--T-FVI
A0A015UXN7      DV--ELYKS---------S-PLAVTYRH-LDE-TP-------VGFTIDISSKE--T-FVI
A0A5M5W148      DV--ELYKS---------S-PLAVTYRH-LDE-TP-------VGFTIDISSKE--T-FVI
A0A6I2NTL0      DV--ELYKS---------S-PLAVTYRH-LDE-TP-------VGFTIDISSKE--T-FVI
A0A016E4F9      TI--GLYKC---------N-PIAVTYRH-LDE-IP-------ISFTINLPSKK--E-FTI
A0A4Q5CFJ7      TI--GLYKC---------N-PIVITYRH-LDE-TP-------VSFTINLPSKK--E-FTI
A0A6H9P0U9      NV--DLYKV---------S-PVTITFCD-KIE-VP-------LSFTIKFSSKE--A-FAI
A0A108TH71      NV--DLYKV---------S-PVTITFCD-KIE-VP-------LSFTIKFSSKE--A-FAI
I8VXH0          NV--DLYKV---------S-PVTITFCD-KIE-VP-------LSFTIKFSSKE--A-FAI
A0A412S0N6      NV--DLYKV---------S-PVTITFCD-KIE-VP-------LSFTIKFSSKE--A-FAI
A0A412IIJ0      NV--DLYKV---------S-PVTITFCD-KIE-VP-------LSFTIKFSSKE--A-FAI
A0A0P0FM97      NV--DLYKV---------S-PVTITFCD-KTE-VP-------LSFTIKFSSKE--A-FAI
R6KTP3          NV--DLYKV---------S-PVTITFCD-KTE-VP-------LSFTIKFSSKE--A-FAI
A0A139LU87      NV--DLYKV---------S-PVTITFCD-KIE-VP-------LSFTIKFSSKE--A-FAI
A0A1C6B3Y5      NV--DLYKV---------S-PVTITFCD-KIE-VP-------LSFTIKFSSKE--A-FAI
E2NMQ4          NV--DLYKV---------S-PVTITFCD-KIE-VP-------LSFTIKFSSKE--A-FAI
A0A412YDB9      KV--DLYKA---------A-PFTVTFRD-QPE-AP-------LSFTIEFSSKD--T-FTI
R7DY01          KV--DLYKA---------A-PFTVTFRD-QPE-AP-------LSFTIEFSSKD--T-FTI
A0A414LGK8      KV--DLYKA---------A-PFTVTFRD-QPE-AP-------LSFTIEFSSKN--T-FTI
A0A415IPQ4      SV--DLYKG---------S-PVTITFCD-KIE-VP-------LSFTIEFSSKE--A-FTI
A0A3E5BRW7      NV--DLYQS---------T-PVTVTFFD-KVE-TP-------LSFTIEFSSKD--M-FTI
K9DXS6          NV--DLYQS---------T-PVTVTFFD-KVE-TP-------LSFTIEFSSKD--M-FTI
A0A1M6KFV3      NV--DLYKS---------A-PVAVTFLD-KME-AP-------LSFTIEFSSKD--T-FAI
A0A1Q6G7L3      NV--DLYKS---------A-PVAVTFLD-KVE-AP-------LSFTIEFSSKD--T-FAI
A0A413H235      NV--DLYKS---------A-PVAVTFLD-KVE-AP-------LSFTIEFSSKD--T-FAI
A0A1M5B2J8      KN--TIYGD---------QLPVAVTLTDFPDN-QS-------AAFQLHLGKDG--H-YTI
A0A255RCT5      KV--TIYGD---------QLPVAVSFADFPDN-QS-------ASFRLHLGTNG--R-YTL
A0A1Y4GLF5      RV--VAYGK---------NLPVTVTLCDLPED-ET-------GSFTVEIRPGR--S-FGL
A0A1H3XSC0      RQ--VAYGP---------TLPVNVSINGLSEN-ES-------VGFTLQVQPDS--T-VRL
A6LE40          RK--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDG--T-LFL
A0A4Y1VPX5      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
B3JI46          RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
R6NN15          AQ--VRYGQ---------NLPVTVSFAGLADN-ET-------AALTVEPAQSK--G-IKL
A0A358R8U0      DR--VAYGA---------SLPLTVSLPELTEN-ES-------ARFTLKVRPGG--E-VEL
R6WSB6          DR--VAYGA---------SLPLTVSLPELTEN-ES-------ARFTLKVRPGG--E-VEL
A0A401LPX7      KQ--TVYGN---------QLPVHVVIPNLSEN-ES-------ATFELYLAKDG--A-VEL
A0A6I0J0P8      KQ--TVYGN---------RLPVQVVIPTLSEN-ES-------ATFELHLAKDG--A-VEL
A0A6I1BFM0      KQ--TVYGN---------RLPVQVVIPTLSEN-ES-------ATFELHLAKDG--A-VEL
A0A6G0GNY9      KQ--TVYGN---------RLPVQVVIPTLSEN-ES-------ATFELHLAKDG--A-VEL
A0A3A5Z900      KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
A0A285TGL6      KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
A0A3A5RFX4      KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
A0A1Q6IUW9      KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
A0A3R6NPG7      KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
A0A413XDP6      KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
K6AP24          KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
A0A6I2NHV3      KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
A0A662ZYI7      KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
A0A078RYI7      KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
C7XEQ8          KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
D7INX6          KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
K5ZG55          KQ--TVYGN---------QLPVQVVIPNLSEN-ES-------ATFELHLAKDG--A-VEL
A0A3N2N9B8      DE--VAYGT---------TLPIELSIVNAPAD-AS-------AEMNVDISPEG--K-ASI
A0A3N2NMI0      NI--VAYGT---------GLPIQLEIVNFPTD-AS-------ATLELNISADK--K-VTI
A0A359I8H7      EK--TLYGS---------NLPVNVKFHDLEEQ-QC-------AGFRIELGKDG--N-VVL
A0A3N2KA63      EK--TLYGS---------NLPVNVKFHDLEEQ-QC-------AGFRIELGKDG--N-VVL
A0A4Q0IMT7      EK--TLYGS---------NLPVNVKFHDLEEQ-QC-------AGFRIELGKDG--N-VVL
A0A3B9FAU3      KN--ILYGR---------SLPANVRMMGLGDH-ES-------AAMQMELQPNG--V-VKL
A0A3C1E5L7      KN--ILYGR---------SLPANVRMMGLGDH-ES-------AAMQMELQPNG--V-VKL
A0A4Q0UAV1      NK--LLYNN---------SPVTAVNMAPEDKK-LK-------GYYSFTITMVSATR-FTL
A0A354SN68      EI--TLYGK---------NLPIKVSFLEATSM-DN-------LSFEIQLEKGG--K-AIL
A0A3N2N595      KE--IAYGY---------TLPICAELIDFSAY-GT-------LKFDLMVNGDG--N-VTI
A0A0A2DUD9      DH--LLYGT---------NLPLNLRFTDLSEQ-ES-------AECILSQLPSG--E-LQL
A0A3P1ZBJ5      DI--TLYGR---------TLPFQVRFLSLNEE-QG-------ARLSINYQQDG--S-FEL
R5FHS9          KG--VLYGQ---------NMPYTVSMPDVQDE-DV-------VKFTVKMEGTR----FVL
A0A413TW79      PV--ALYGR---------TLPVTVHFYSLNDM-QS-------ASLDVEVKHGNLFSIVHV
A0A3E5E9M7      PV--ALYGR---------TLPVTVHFYSLNDM-QS-------ANLDVEVKHGNLFSIVHV
A0A3E4SK73      PV--ALYGR---------TLPVTVHFYSLNDM-QS-------ANLDVEVKHGNLFSIVHV
A0A415GGC6      PV--ALYGR---------TLPVTVHFYSLNDM-QS-------ASLDVEVKHGNLFSIVHV
A0A413DBH9      PV--ALYGR---------TLPVTVHFYSLNDM-QS-------ANLDVEVKHDDLFSIVHV
A0A1Y4PQK7      DR--LLYGM---------ALPFQANITGLQEN-ES-------VGFTVNVYKDG--H-VQL
A0A1Y4IH41      DR--LLYGM---------TLPFQANIAGIQEN-DF-------AGFTVNVYKDG--R-VQL
A0A3A6AAP4      DR--LLYGM---------TLPFQANIAGIQEN-DF-------AGFTVNVYKDG--R-VQL
A0A6I0ZRD2      DR--LLYGM---------TLPFQANIAGIQEN-DF-------AGFTVNVYKDG--R-VQL
A0A1Y4DYA7      NH--ILYGQ---------NCPYEVEFFDLQDN-DV-------ASFTIFPVSGN--KGVEL
A0A1Y3X4I9      KQ--VLYGQ---------ACPYEVEFFDLLDN-EG-------ASLTILPVSGN--KGVEL
A0A1Y4FNK8      KK--VLYGG---------TCPYSVSFNDLQDN-ES-------VSFTVNPSSIG--Q-VKL
A0A355FD59      RK--TLYGS---------ELPVRVVFTDLTDK-EN-------AKLTLRVSEDS--T-VVL
A0A359CEZ9      RK--TLYGS---------ELPVRVVFADLTDK-EN-------AKLTLRVSEDS--T-VVL
A0A353Q7B4      RK--TLYGS---------ELPVRVVFTDLTDK-EN-------AKLTLRVSEDS--T-VVL
F8X3A5          KK--VLYGP---------DLPITVSFTDLADN-ES-------AELIIKLLADG--T-FEC
A0A1M3KVR9      KK--VLYGP---------DLPITVSFADLADN-ES-------VELVIKLLADG--T-FEC
A0A4Y9IJS3      KK--VLYGP---------DLPITVSFADLADN-ES-------AELVIKLLADG--T-FEC
A0A495WI87      RE--VLYGR---------TLPINVSIDTPNDN-ES-------SALTVKILADS--T-VEL
A0A354M4S6      RE--VLYGR---------TLPINVSIDTPNDN-ES-------SALTVKILADS--T-VEL
R7DH52          RE--VLYGR---------TLPINVSIDTPNDN-ES-------SALTVKILADS--T-VEL
A0A4Q5E7L5      QQ--VAYGL---------TLPVNVTMSDLSEN-ES-------AGFTLEIHPDS--T-LLL
A0A4P8LP09      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVRPDS--T-LLL
A0A4R4GZU7      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVRPDS--T-LLL
A0A016CWA4      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVRPDS--T-LLL
A0A1C6H117      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A0M1W0V2      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A139KA16      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A174VQ92      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A1Q6HCG0      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A1Y4JYM9      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A3A5QW67      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A3A5RQE6      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A3A6BP07      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A3E5E153      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A3Q9IP20      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A412WV15      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A413ICP6      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A414KYB9      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A5B3FWR2      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A6I0WNS4      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
E5WX00          RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
K0X3P3          RQ--VAYGL---------TLPVDVTISDFPEN-ES-------AGFTLEVQPDS--T-LLL
A0A415TAH7      RQ--VAYGL---------TLPVDVTISDFPEN-ES-------ARFTLEVQPDS--T-LLL
A0A078T2W6      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLKIQPDG--T-LYL
A0A6I1AQV4      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A5C6L2P1      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A412MJT7      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A3E4WKT5      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A3A5YY33      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A078TAH2      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A1E9CFZ7      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A373FYU5      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A3A5TZ72      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A3A5XBP2      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A3A6MEG9      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A3E4JP35      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A3E4KP40      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A3E4NX82      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A3E4XFU8      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A412RG70      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A412TD37      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A413GAA4      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A414M7I4      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A496BTA0      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A496D2V6      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A4Q5G1P5      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A5C6KCA6      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A5M5AHM5      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A6I0KZV6      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A6I0Y5K7      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A6I1BFB8      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A6I2P5W5      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
E5UZA2          RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A069SMG6      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
C3RFN5          RK--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
A0A3A5Z014      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
A0A6I0ING7      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
A0A6I2P894      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQSDG--T-LFL
A0A078S3Q8      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
A0A069SJV7      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
A0A3E5DXI5      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
A0A3E5EM98      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
A0A3E5F453      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
I9T3G6          RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
A0A3E4SYU0      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
A6LGY1          RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
K5ZSH4          RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
A0A6A2RTB3      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A6I0VY00      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEIQPDG--T-LYL
A0A1M4YZ07      RQ--VAYGL---------TLPVDVTINDLPEN-ES-------AGFTLEVQPDG--T-LFL
A0A4Q5E5M7      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDS--T-LLL
A0A0P0FQW1      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDS--T-LLL
A0A5M5C0W6      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDS--T-LLL
A0A6I0H151      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDS--T-LLL
A0A6I0HI59      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDS--T-LLL
A0A642LZ22      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDS--T-LLL
A0A6I0IP89      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDS--T-LLL
A0A642NJ89      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDS--T-LLL
A0A6I0HI52      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDS--T-LLL
A0A6I0YVB5      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDS--T-LLL
A0A6G0G4T5      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDS--T-LLL
A0A6I0HFG9      RQ--VAYGL---------TLPVDVTISDLPEN-ES-------AGFTLEVQPDS--T-LLL
A0A416GA42      PT--DLYGV---------S-PVTVHFVQGDDL-AC--------SFRLRLLPGR---KVEL
A0A1T3IYP5      DY--ELYKK---------S-PVHVKIEGKTQE-SS-------YSFIITPFDSK---TVIL
A0A3P1Z8V4      NV--ALYRD---------R-PFTVHFDRPSKR-YT--------RMEAVINPDN---TVTL
A0A060RD97      KL--DIYGE---------ETPIVVKNVAESEQ-SNNP-----VSFTVTPKNSE---AFQL
A0A3C1ITV0      VT--DWYDK---------T-PICVEYKNLPDH-VGEQPLNS-VTFVAEKEGQS---QLTV
R7HN19          VT--DWYDK---------T-PICVEYKNLPDH-VGEQPLNS-VTFVAKKEGQS---QLTV
A0A350IHV0      SR--ELFTS---------S-PIALVQTGDNHA-SA-------YSFELTKTGDS---TFVI
R5RVP0          SR--EKFTD---------S-PIALVLAGDNNA-SA-------FSFEIVNEKDS---TFVI
R6A0L2          SI--TLYGK---------ELPFQVLFQKQYKG-KRG------QHIDVVKKGSN---TVTL
R7LG80          KV--ALYKN---------ERPIEVLFHDSLPS-ENPIPKNMIVSLKIKKLDQN---TVEI
A0A2L2WX98      EV--SLYRN---------R-PFRIEFSSECQR-PE--------KFEVVKTGDR---KFAL
A0A285T4L1      MN--ELYNQ---------S-PINVSFINVMPE-RY-------ISFTVTPKNAK---QVLL
G5GD56          SV--ALYTD---------R-PFEIAFQQKAE--NL-------VRFEAKIQADG---TVKL
R5KD55          DK--TLYGK---------TLPVKVVFRDIPKD-ET-------ASLHIRLKKDG---SIKM
A0A174QNT3      HD--HIFGE---------L-PFEINFLDNYP--GY-------TELKVSVVNDK---QCRI
A0A4S2FGS1      HD--NLFGD---------L-PFEVRFLDICP--GF-------TKFTVSVINEK---GVRL
R9I0H0          RD--NLFGD---------L-PFEVRFLDIYP--GF-------TELTVSIINEK---GVRI
K5BUT9          DT--PLYAE---------S-PVDVHFIDPYN--QP-------VSFNITPLNTT---KFRI
A0A174FPA3      DA--PLYAE---------S-PVEVHFIDPYN--QP-------VSFNITPLNTT---KFRI
R6S9Y6          DA--PLYAE---------S-PVEVHFIDPYN--QP-------VSFNITPLNTT---KFRI
A0A642LIH6      DA--PLYAE---------S-PVEVHFIDPYN--QP-------VSFNITPLNTT---KFRI
C9KX15          DA--PLYAE---------S-PVEVHFIDPYN--QP-------VSFNITPLNTT---KFRI
A0A6H0KRK1      NT--SLYAE---------S-PVEVNFIDPYH--AY-------YHTKVTPLDVK---NYTI
R6DAG6          NT--SLYAE---------S-PVEVNFIDPYH--DY-------YRTKVTPLDVK---NYTI
A0A3L8AAP1      NT--SLYAE---------S-PVEVNFIDPYH--AY-------YRTKVTPLDVK---NYTI
A0A4S2AYX2      NT--SLYAE---------S-PVEVNFIDPYH--AY-------YRTKVTPLDVK---NYTI
A0A4Y9H477      NT--SLYAE---------S-PVEVNFIDPYH--AY-------YRTKVTPLDVK---NYTI
A0A0E2M2Y7      HE--SLYGK---------S-PVSIRITDRDST-ES-------YSFKIDIKDSR---SFQL
A0A0K2J6Z0      HE--SLYGK---------S-PVSIRITDRDST-ES-------YSFKIDIKDSR---SFQL
B2RKZ8          HE--SLYGK---------S-PVSIRITDRDST-ES-------YSFKIDIKDSR---SFQL
A0A212GC82      HE--SLYGK---------S-PVSIRITDRDST-ES-------YSFKIDIKDSR---SFQL
A0A254MU12      HE--SLYGK---------S-PVSIRITDRDST-ES-------YSFKIDIKDSR---SFQL
R6CQ93          MN--ELYNL---------S-PVQVSFFNVLPE-RY-------FSFVVTPKDET---SVEL
A0A3D1NQW3      PQ--DLYGQ---------S-PIAVEFINDNDR-QG-------FRFEVSLRPDS---IVKL
B0MT10          PQ--DLYGQ---------S-PIAVEFINDNDR-QG-------FRFEVSLRPDS---IVKL
R7JGW9          PQ--DLYGQ---------S-PIAVEFINDNDR-QG-------FRFEVSLRPDS---IVKL
A0A3D2BF46      TE--NLYRR---------S-PIDVTFIDDNER-QA-------LAFELTPVDNE---KFSL
A0A358R538      AR--DLYGQ---------S-PLRVRFIDETED-LS-------AELTVTPLPDG---RLRL
A0A1Y4AAB8      TQ--DLYGR---------S-PIEADFVDEGEN-QS-------FSFRARPLAGG--EQVEL
A0A1Y3WWY9      DR--DLYGQ---------S-PIDVDFINGDDN-QS-------LSMTVTPRGEQ---QIEI
A0A1Y4U5L4      DR--DLYGQ---------S-PIDVDFINGDDN-QT-------LSMTITPRGEQ---QIEI
A0A1Y3VCJ1      DR--DLYGQ---------S-PVEVVFVNDNDN-LT-------LSLEVTPVDDQ---NIRL
A0A1Y3QTW7      TL--DLYGR---------S-PIEVDFIDDDN--QR-------LSLEVTELEDG---RIKL
R6XWY7          TL--DLYGR---------S-PIEVDFIDDDN--QR-------LSLEVTELEDG---RIKL
A0A4Y1X9Y9      TL--DLYGR---------S-PIEVDFIDDDN--QR-------LSLEVTELEDG---RIKL
A0A4Y1WM66      TL--DLYGR---------S-PIEVDFIDDDN--QR-------LSLEVTELEDG---RIKL
A0A174AVF1      TL--DLYGR---------S-PIEVDFIDDDN--QR-------LSLEVTELEDG---RIKL
A0A656Q4F4      TL--DLYGR---------S-PIEVDFIDDDN--QR-------LSLEVTELEDG---RIKL
A0A1Q6EIY0      TA--DLYGR---------S-PIEVDFINDNSK-QK-------LSLEVTPLRNG---KIEL
A0A5B5VN71      TA--DLYGR---------S-PIEVDFINDNSK-QK-------LSLEVTPLRNG---KIEL
E4M8L3          TA--DLYGR---------S-PIEVDFINDNSK-QK-------LSLEVTPLRNG---KIEL
I3YQ50          TA--DLYGR---------S-PIEVDFINDNSK-QK-------LSLEVTPLRNG---KIEL
R5UEY8          TA--DLYGR---------S-PIEVDFINDNSK-QK-------LSLEVTPLRNG---KIEL
A0A1H4D866      RR--DLYAQ---------S-PVEVTFVNDSDN-QS-------LSMEITPLEGD---KVRL
A0A5B3G4Y7      RR--DLYGQ---------A-PIDVKFINDNDN-QS-------LAMEITPIDDD---KIRL
A0A374A9J5      RR--DLYGQ---------A-PIDVKFINDNDN-QS-------LAMEITPIDDD---KIRL
A0A5B3GQN5      RR--DLYGQ---------A-PIDVKFINDNDN-QS-------LAMEITPIDDD---KIRL
A0A1Q6E9S3      RR--DLYGQ---------A-PIDVKFINDNDN-QS-------LAMEITPIDDD---KIRL
D4IJ36          RR--DLYGQ---------A-PIDVKFINDNDN-QS-------LAMEITPIDDD---KIRL
A0A414Q925      KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
A0A415PUS9      KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
A0A108TCU0      KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
A0A413BA42      KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
S3Y344          KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
A0A4Q5G8Y8      KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
A0A412TGL3      KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
A0A413VJ33      KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
A0A414L0W6      KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
A0A412DP39      KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
A0A413ZSE8      KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
B0NP84          KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
R6AK43          KK--ELYTS---------T-PFAVTFLDATPS-QQ-------ISLTVTMSDNG---KVTL
A0A412N2D9      KK--ELYTS---------T-PFTVNFLDADPA-QK-------ISLTVTMTDNG---KVTL
A0A1Y4JYS9      KK--ELYTS---------T-PFTVNFLDADPA-QK-------ISLTVTMTDNG---KVTL
R6LHA4          KK--ELYTS---------T-PFTVNFLDADPA-QK-------ISLTVTMTDNG---KVTL
A0A3E5HPT8      PR--ELYTD---------S-PVRVAFLEAGLD-EV-------CSLSVIPKNKQ---QVEL
C6IJ48          PR--ELYTD---------S-PVRVAFLEAGLD-EV-------CSLSVIPKNKQ---QVEL
Q8A3U2          PR--ELYTD---------S-PVRVAFLEAGLD-EV-------CSLSVIPKNKQ---QVEL
A0A3R6S1H6      EI--ELYKE---------S-PVVLRFPDAEET-SS-------LQMVVTPLDDK---TVML
A0A3R6SD81      EL--ELYKE---------S-PVVLRFPDAEET-SS-------LQMVVTPLDDK---TVML
A0A354WXN6      TV--DLYTQ---------S-PINLTFPEAEGE-QV-------FSLKATPLDDK---KVLL
R5IP14          DR--SLYKD---------S-PLAVSFITKDNN-SQ-------FSFDIVPISDQ---EVLL
A0A316SZX7      TI--DLYRN---------T-PIEVSFVDDDDK-SY-------SGFTAKK-KGK---EIYL
A0A1Y4AIY1      TV--ELYRQ---------S-PVILSFPDASET-QS-------FSLTAIPLSKE---KVRL
A0A0J6CIR2      TE--ELYTQ---------S-PIAVRFPEAEAS-QS-------FSLVATPLSAG---EILL
A0A3D8HG59      TT--ELYTQ---------S-PVHLEFPDAEPN-QQ-------FRLVATAIDEG---KVAL
A0A3R6S408      TT--ELYTQ---------S-PVHLEFPDAEPN-QQ-------FRLVATAIDES---KVAL
F3ZRU7          KK--DLYGN---------N-PFEVVFLEASTE-QP-------IQLK-GKLKEN---QVQF
A0A1C5Q1F3      DW--DLYTT---------S-PVTLTFPEALET-SS-------FSFKVTPLNDK---EVLL
R7A239          DW--DLYTT---------S-PVTLTFPEALET-SS-------FSFKVTPLNDK---EVLL
A0A3R6HIK7      MV--ELYTH---------S-PVVLSFPETEES-QS-------FALKVTPLSKE---KVRL
K5ZVW7          TV--ELYTH---------S-PVVLSFPETEES-QS-------FALKVTPLSKE---KVRL
A0A1Y4D5Z0      TV--ELYRE---------S-PVVLSFPEAGEG-QS-------FSLTVTPMSDK---EVVL
A0A413VXJ7      NK--ELYTH---------S-PIILSFPEAEER-QS-------ILVTVTPIDSA---RVRL
I9RSN9          NK--ELYTH---------S-PIILSFPEAEER-QS-------ILVTVTPIDSA---RVRL
U6RJK5          NK--ELYTH---------S-PIILSFPEAEER-QS-------ILVTVTPIDSA---RVRL
A0A1Q6GA32      NK--ELYTH---------S-PIILSFPEAEER-QS-------ILVTVTPIDSA---RVRL
I9RPU6          ND--ELYTH---------A-PVTVSFPEAEER-QV-------ITVVVTPVDSV---TVRL
I8YFS5          ED--ELYTH---------S-PITVLFPESEER-QV-------IEMTVTPVDSA---TVRL
A0A6H9LTF8      ED--ELYTH---------S-PITVLFPESEER-QV-------IEMTVTPVDSA---TVRL
I8Y597          ED--ELYTH---------S-PITVLFPESEER-QV-------IEMTVTPVDSA---TVRL
A0A1Q6GBF5      ED--ELYTH---------T-PVTVSFPEAEER-QV-------IKVAVVPVDSV---TVRL
I8YFZ3          ND--ELYTH---------A-PVTVSFPEAEER-QV-------IRVVVTPVDSI---MVRL
A0A6H9M1J1      ND--ELYTH---------A-PVTVSFPEAEER-QV-------IKVVVTPVDSA---TVRL
A0A1Q6GDH2      ND--ELYTH---------A-PVTVSFPEAEER-QI-------ITVVVTPVDSV---TVRL
U6RSB0          ND--ELYTH---------A-PVTVSFPEAEER-QV-------ITVVVTPVDSV---TVRL
I9GXM2          ND--ELYTH---------A-PVTVSFPEAEER-QI-------IKVVVTPVDSV---TVRL
I9SIK1          ND--ELYTH---------A-PVTVSFPEAEER-QV-------IKVVVTPVDSA---TVRL
A0A6H9LZ74      ND--ELYTH---------A-PVTVSFPEAEER-QV-------IKVVVTPVDSA---TVRL
I9TP59          ND--ELYTH---------A-PVTVSFPEAEER-QV-------IKVVVTPVDSA---TVRL
R5S343          TV--DLYGI---------S-PIRVRFLDRGED-EA-------ATCAVTFMTCE---RVLL
A0A1M6K7I9      TI--ELYTQ---------S-PIKVAFPDAEDN-QY-------IHVCVTPLSEN---KVRL
A0A5M6A8C8      TI--ELYTQ---------S-PIKVAFLDAEDN-QY-------IRVCVTPLSEK---KVRL
A0A6H9LT84      DD--ELYTH---------S-PITVSFPESEER-QV-------IEMKVTPVDSV---TVKL
A0A6H9LUV5      ED--ELYTH---------S-PIVVVFPESEER-QV-------IKTAITPIDSV---TVRL
A0A3R5ZMK1      TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVVL
A0A3E4ZTK7      TV--ELYTQ---------S-PVLLSFPDAEEA-QA-------FSLRAKPISAE---EVVL
A0A1Y3ZIA4      TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLQAVPVSGK---EVML
K5Y1A4          TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLQAVPVSGK---EVML
A0A4Q5CIT0      TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVVL
A0A3R6K8X4      TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVIL
A0A414GI87      TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVVL
A0A415BDM7      TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVVL
A0A412DM15      TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVIL
A7AEU7          TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVIL
A0A1Q6I3T6      MV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVVL
A0A414XX40      MV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVIL
A0A3R6BKI7      TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVVL
A0A414LPI6      TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVVL
A0A412M2W1      TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVVL
K5ZX55          TV--ELYTQ---------S-PVQLSFPDAEEA-QA-------FSLKAVPVSGK---EVVL
A0A5F0U645      TV--ELYSH---------S-PVVVRFPEANEN-LE-------FGLTVVPVSDK---EVSL
K5ZBN2          TV--ELYSH---------S-PVVVRFPEANEN-LE-------FGLTVVPVSDK---EVSL
A0A0J6CKW3      TV--ELYSH---------S-PVVVRFPEANEN-LE-------FGLTVVPVSDK---EVSL
A0A0F5IQM7      TV--ELYSH---------S-PVVVRFPEANES-LE-------FGLTVVPVSDK---EVSL
A0A496CDT3      TV--ELYSH---------S-PVVVRFPEANEN-LE-------FGLTVVPVSDK---EVSL
A0A6G1ZKM3      TV--ELYSH---------S-PVVVRFPEANEN-LE-------FGLTVVPVSDK---EVSL
S0GLB0          TV--ELYSH---------S-PVVVRFPEANEN-LE-------FGLTVVPVSDK---EVSL
A0A3R6NLC1      TV--ELYSH---------S-PVVVRFPEINEN-LE-------IGLTVVPVSDK---EVSL
A0A416WYC9      TV--ELYSH---------S-PVVVRFPEINEN-LE-------IGLTVVPVSDK---EVSL
A0A0F5IT40      TE--ELYTQ---------S-PIAVRFPEAEAS-QS-------FSLVATPLSAG---EILL
A0A496CX20      TE--ELYTQ---------S-PIAVRFPEAEAS-QS-------FSLVATPLSAE---EILL
A0A5F0UBI0      TE--ELYTQ---------S-PIAVRFPEAEAS-QS-------FSLVATPLSAG---EILL
A0A6G1ZHG0      TE--ELYTQ---------S-PIAVRFPEAEAS-QS-------FSLVATPLSAG---EILL
S0GSI7          TE--ELYTQ---------S-PIAVRFPEAEAS-QS-------FSLVATPLSAG---EILL
K5YB65          TE--ELYTQ---------S-PIAVRFPEAEAS-QS-------FSLVATPLSAG---EILL
A0A0F5IWP9      TV--ELYTQ---------S-PIAVQFPEAEAT-QA-------FSLNVTPLTET---EVML
A0A0F5IZT8      TV--ELYTQ---------S-PIAVQFPEAEAT-QA-------FSLNVTPLTET---EVML
A0A417LKQ2      TV--ELYTQ---------S-PVAVQFPETEAV-QA-------FSLTVTPLSEK---EVML
A0A416TME1      TV--ELYTQ---------S-PVAVQFPEAEAT-QA-------FSLVVTPLSEK---EVLL
A0A416XPE8      TV--ELYTQ---------S-PVAVQFPEAEAT-QA-------FSLVVTPLSEK---EVLL
A0A3B0C2S4      TT--EIWNP---------P-FAITKLIAEDSIGQPRVYDISLDAFEARITNMDGAT----
L8JI02          AE--EKYGD---------F-PFIVELDSTISQMIDVPVYIEPLPGGSYRIEAVGRD----
A0A4Q5WS95      DR--SAYTS---------S-PVVITAFNLDQVRTTPN-----IPFTYDAAAR--------
A0A501VZX6      TT--SAYIT---------S-PVQIEVKHPE----ALK-ETAKVYFHYNRASK--------
A0A399SH26      EV--AAYTS---------S-PVIVTHYNPDAILATED-EPQKIYFTYNPDLE--------
A0A501W1A9      TV--SAYTS---------S-PIKVILKSFD----KVQ-EQPAVYFTYDEAKK--------
A0A0E3ZGV6      SV--PAYTS---------S-PITITLKDPE----KAT-ENPMIFFTYDESSK--------
A0A1I2N4S1      SI--PAYNT---------S-PITISLKSPE----TAV-EYPAVYFTYDQATQ--------
A0A2T5YE44      SI--PAYTT---------S-PITISLKSPE----TAA-EYPAVYFTFDQATQ--------
A0A1V9FHD0      AT--SAYLS---------S-PITIVAQDPDQVKETGD-TDVLFSVNYFPGPNGKAS----
A0A4V4H170      AT--SAYTS---------S-PITITARKPDDLKETGE-VDVQFTVNYFSDNNGGEF----
A0A1V9F098      PT--SAYNS---------S-PVTIIARKPDELKSTGD-SVVHFQVNYYDDNNAGEF----
A0A4R2VU64      AT--SAYTS---------S-PITIMARKPDDLKETGD-SDVYFMVNYYANNNAGEF----
A0A4S8HY23      VT--SAYTS---------S-PITITARKPDELKETGE-VDVPFSVNYFSNNNAGEF----
A0A1V9F383      ET--SAYVS---------S-PVSIVAKDPDELIETGD-TDIVMSVNYYTDKERRAA----
G8TRZ6          ET--SAYIS---------S-PVSIVARNPDELTETGD-TDIAIAVNYYSPKEMQVA----
A0A543WA52      NV--SAYIT---------S-PIRVELKNPQDVPIVTEGKPTRFYISLAGDKN--------
A0A1M5BA90      SR--SAYTS---------S-PVTIELEYPNNIQ---D--TDRIDFVYNKGNN--------
A0A512B879      SY--SAFTS---------S-PVTVELADPDMIV---E-VVERIDFTYNKIKK--------
A0A559PPI3      SV--SAYNS---------S-PIQIKLKNPDEIVIEKD-VPAEHYFTVDFSKK--------
A0A1T5CS78      AI--SAYTS---------S-PIKVIVKEPNRISISNE-EPEKHFFNYNFNEE--------
A0A0Q9Z8F1      TI--SAYTS---------S-PIKVIVEDPNKISLSED-EPEKHFFKYNANDE--------
A0A2N0U0M7      TI--SAYTS---------S-PIRVIVQDPNRISISAD-EPEKHFFKYNANDE--------
A0A2N3U785      TE--EIYGS---------S-LPIKVVVSDLKQPAFGKTL------RVQIKDK--------
A0A0D3L8Q3      DP--ELYGN---------K-LPFRVVTNKLDSLAYGKVI------KVHLKGN--------
A0A0E3ZG78      DI--EIYGS---------E-VPIKVLVNDLAPPAYRKSF------VIHIKSD--------
A0A1I6BRK6      DR--EIYGE---------A-LPFRIVRNGLDSTMTGKSI------IIHLKKN--------
A0A243WAB1      NR--EIYGR---------E-LPAKLLIDKLDSTAIGKSI------TLHLHPD--------
A0A6G8C8X6      DR--EIYGR---------A-LPIKVLLNGLDSTAAGQSF------AVYLKGG--------
A0A5B6TJH8      DI--EIYGK---------E-LPIKLVVESLHNSGYNKEL------IIHTKDN--------
A0A519U664      DK--EIYGQ---------S-VPIKVLRSNVDSTAAGKSF------VVFLKAD--------
A0A519UDD1      DI--EQYGR---------N-LPIKVLLTTADSTAAGKSF------IVRVRPD--------
A0A519MA34      DK--EIYGQ---------S-VPIKVLRNNVDSTAAGKSF------TVFLKAD--------
A0A519UCX0      DK--EIYGQ---------S-VPIKVLRNNMDSTAAGKSF------TVFLKAD--------
A0A4R5DL69      TA--EIYDK---------S-PVILHLIDPKSDQIKRTEVTYKI-----------------
A0A1M4YED3      LR--SAYNT---------S-PVKVIAQNPADLKRTEEIDLSVNATTNVVTVD--------
A0A2H3NSN0      ------------------------------------------------------------
A0A2P6C324      ------------------------------------------------------------
A0A1M6XHU0      ------------------------------------------------------------
A0A5S9C8G0      ------------------------------------------------------------
G2SF81          ------------------------------------------------------------
A0A5S9EYW1      ------------------------------------------------------------
D0MHQ9          ------------------------------------------------------------
A0A126PFG0      AR--DLYGR---------S-PVQFTLVPTHSVPRQHVL-------DIVLKDQ--------
A0A3M1N7Z3      -R--SLVFP---------H-PFQISF----SSPRAESLFWQGGRVRVIFDAE--------
                                                                            

A0A1T5MMH4      -VW-GEGTQKI-------------------SGRY-GAPVH-I-----SGIE-LTLRKNEN
A0A2W4R1L8      -RI-NQDGDQV-------------------SGKY-GEPID-L-----NGLT-VTIHRNPA
A0A2E5CV79      ------------------------------------------------------------
A0A2D4ZVH1      ------------------------------------------------------------
A0A0K8QSK7      -QA-EGENVRVHDFVTGENIRTIPNVNIDETRLL-GERFS-G-----NDYS-FAIRVKEN
A0A1V6CN82      -SG-FGEGVGVYNYSENRGAGYFPEVKIEQKVQS-GEEVVIP-----GQCS-FKINLNEG
A0A1M4XZ45      -EM-DQEDVAVYNYLDEKIVERLPQFSFSRDISA-GTKLK-A-----EQFS-ITILLNEK
A0A399D319      -DM-EEEVISAYSYTEEEVVKRIPGYSFSRTIDP-GTKIT-S-----DEFS-FTILLNEL
A0A1M6GR99      -KV-EKQDAMVYNYNTGHKIGERKDLEFSINGNV-GQVVE-T-----DDFK-ILVTINEN
A6EBM4          -TW-TIGKEDIRK-----------------NFRF-NSRIK-V-----GNVS-FMIRNTAQ
A0A1M6TTV4      -SL-DHDQTEGRP-----------------KYKF-GEMIS-H-----RLGE-LTIQKTSN
A0A4Q8RX32      -SA-KNEECMLYDFQKERNDREVANFEMSQKFNF-GKTIE-S-----EYFK-FTVLLKEG
K0X1U5          ---------------------------LLKKGFF-TTLAE-M-----EATS-FPIKVDYG
R5EXK3          ---------------------------LLKKGFF-TTLVE-M-----EATS-FPIKVDYG
A0A401UAP7      -TL-SDGEKL--------------------TGNF-GKVVQ-M-----EGFK-VLIESAKG
A0A1W2GF52      -SS-EYLGGRIGE-----------------KQQF-GNPIV-T-----KDFS-FTLEKTNF
A0A2G5L7B8      -DF-ELHGTSHRT-----------------RYPF-GKKIN-T-----AFGE-LIVSKTIF
A0A523GAC0      -GY-PDHTQIPDQ-----------------SCRF-SQ--T-I-----QNEH-FALRLTMN
L8JW09          -NF-SGDEQEKAM-----------------KYNF-GEHAN-L-----PDIE-FIIYLTNY
A0A364XUP5      -KV-GESQRKI-------------------TGKF-NEPIN-L-----DASV-VTIKRNPN
A0A1M5RLA9      -QV-GDEGQKT-------------------TGRY-NSKVS-L-----NGVD-LYIEKNEA
A0A385SFR9      -QV-GDEGQKA-------------------AGRY-NSKVS-L-----NGVD-LYIEKNEA
A0A5M4A9J4      LNV-TGEKPRTWDFRHRQAIHQYSDYSVTLPVRL-NEVIE-R-----SEFA-FRIIPVNG
A0A5M4B1C7      LKV-KGEKPAIYNYENKTVLQKPEEIDKTIPFSI-NKTTT-D-----SQFS-FCVVPKNG
A0A0D3LFR6      -SY-FQGENEVSN-----------------RYRF-GQAVE-T-----GSFN-LTLTLLEG
M7N6D4          -SY-QLGDQEISG-----------------RHRF-GQTVE-T-----DPLT-FSLSLRNG
A0A4D7K1D4      -TY-ELGEVTQRF-----------------EANF-GKPLV-V-----NGGI-ITLFLTEH
A0A5C7MX19      -NH-IYKDGEFER-----------------IYRF-GQDIY-S-----PSFK-GVVIKKVP
A0A1Q3ZMZ7      -----QSKGKTYTF----------------PFVF-GKLIS-T-----PHFE-VIINGDKE
A0A2D8JJW3      NNL-SLHSDNTVFDLSGVVIP---------DGDF-KDGCD-L-----PKYR-QLHVLNTR
A0A2W2AFF7      -KC-SGKKCNNVDW----------------KGKF-GQTVS-L-----PIGK-LQVIKNPL
R7PCR1          KNL-QFEDFDSEFNY---------------KGTF-GRPFS-T-----PVGK-IVLNKNSQ
A0A2N5YXE2      -------GNQDYEY----------------LISP-EEWQS-V-----FGME-VFIHFPSK
A0A1G9E2A9      -KY-ELNGEEIQG-----------------NFLF-DKSYE-N-----QHFR-FEI--HKT
A0A098LL25      -SY-KKNDEEIKS-----------------EHYF-GEKIS-T-----DNYS-FTLY--PT
A0A6C0GJI1      -TY-KQGSNDVSN-----------------TYTF-GQAVN-L-----DNFR-FTI--DTT
A0A2T2YJE8      -SY-LEGDQEITE-----------------EHTI-GKPVE-K-----PGFS-FTL--TLR
A0A127B287      -QI-GEDGKK-SD-----------------VHTV-GSPIS-L-----SGNN-INVL--TN
A0A3M9N829      -YV-GEEGERLV-------------------ATV-GQPVN-I-----SGNN-ITI--TTT
A0A0P0CSF9      -YV-GENGNQSS-------------------YTV-GNPIT-V-----SGST-FSI--NPV
A0A5M8QQB8      -YV-GETGTPSS-------------------HAV-GEPVS-V-----VGSR-VTI--KTA
A0A3M9MNC3      -YI-GKEGKHSS-------------------HAV-GVPFA-L-----SGST-ITV--NSL
A0A5B6TAX2      -YV-GEEGSHTS-------------------HIV-GVPFK-F-----SGST-LTV--NPS
A0A5N1IQ33      -TY-LLNGQEAGG-----------------EYRF-GQPIS-T-----PQME-LTIY-RTS
A0A512AYT3      -SY-QVGEEEISG-----------------EYRF-GEKID-K-----KEIS-LTLY-PNN
A0A5M6CYN7      -SY-LVGEEEISG-----------------DYRF-GEKID-K-----KEIS-LTLY-PNN
A0A369QP10      -SY-VQGDQEVTE-----------------EHTI-GEPVQ-K-----PGFT-FTL--KLT
A0A126PDF2      -SY-SGPGTALDG-----------------EYDL-EKQVS-L-----PGLD-LKVT-PT-
A0A2Z3GKA1      -SY-SGPGAALDG-----------------EYNL-GQQVS-L-----PGLD-LKVT-PT-
A0A502GZP7      -DY-SGTAATLSG-----------------EYAV-GQQVT-L-----PGLD-LTVT-TT-
A0A519SBU8      -SV-KSGAETLTS-----------------TRAL-GQWAK-L-----PGID-LLVE-AAP
A0A4Q3JNZ3      -SV-KAHNQTLAG-----------------TYTV-GQWAT-F-----PGMQ-LLLE-AVP
A0A519Q9V3      -SV-KVHSQTLTG-----------------TYTV-GQWAA-F-----PGMQ-LLLE-AAP
A0A0M3RW20      -SY-ALRGNEIKE-----------------EKVV-GSAII-Q-----PGIN-LQLN-LT-
A0A495VFX4      -SF-NLKNEEYTR-----------------EYKV-GDAII-L-----PGIH-LKLV-KA-
A0A1S9B3W0      -SY-PAGAGETEG-----------------EYRF-GQPIT-T-----PGFT-LELQ-PT-
A0A1W1VRL3      -SY-LEGEQEVSG-----------------VYSV-GQPLN-L-----AGLD-LRLT-THG
A0A1M6R305      -SY-LQGGQEQTS-----------------EHTV-NQPFR-I-----GGMT-LRLR-PT-
A0A4Z0PHK3      -SY-LYQGQERTA-----------------DHAL-GQPVL-V-----PGME-LLLT-AT-
A0A2M9B9H9      -SY-LYLGQERSA-----------------TYTL-GQPVV-V-----PGMT-LVVT-AT-
A0A4Z0QCY9      -SY-LYQGQEKTG-----------------DYTL-GQPII-V-----PGME-LKVT-ST-
A0A418R9X5      -QL-PNG-ASATQ-----------------ALKF-GQPID-I-----AGFT-LYMY-KT-
A0A428JSJ3      -HL-PGN-GSETS-----------------ALTF-GQPFQ-A-----AGFT-LRVY-KT-
A0A428KI59      -QL-PGG-AAETG-----------------ELSY-GQPIE-A-----AGFT-LQVY-KT-
W8F1I6          -QL-PNG-GTETG-----------------ELSY-GQPIE-A-----AGFT-LQVY-KT-
A0A246FQC0      -IL-PDGLGGGEQ-----------------EYRF-DEPFT-A-----AGFR-LVIS-KA-
A0A372E5P8      -IL-PEDLGGTEQ-----------------QHTF-GQPFT-A-----AGFR-LTIR-QT-
A0A1H3EMW1      -TL-PEQLGGGEQ-----------------QHSF-GQPFT-V-----AGFR-LTVR-PT-
A0A1H9ZSN3      -TL-PEELGGTEQ-----------------QHTF-GQPFT-V-----AGFR-LTIR-KA-
A0A5N1J2M4      -TY-TLGNKTNTG-----------------EYGF-GEIIS-N-----NDLD-LKVL-K-T
A0A519S476      -SV-KAHGQTLTG-----------------TYPV-GTWAK-L-----PGVE-LVLE-AVP
A0A4Q3JRW8      -SV-KVRNQTLTG-----------------TYAV-GQWAS-F-----PGMQ-LLLE-DVP
A0A519M923      -SV-KAHNQALTG-----------------TYPV-GQWVT-F-----PGMQ-LRLT-PVA
A0A4Z0ENW1      -SI-TTANTTLGG-----------------NYEF-GQLVK-L-----PGIS-LQLL----
A0A519UDB4      -SV-NVGSNILTG-----------------NYAF-GQFVK-L-----PGIS-FRLLLTSP
A0A3S0QKV1      -SY-LMGQQEIDG-----------------EYQL-EQPVT-T-----PGFN-LRLV-P-T
A0A328BL48      -SY-AQGQAEQGG-----------------EYSF-GETLT-T-----PGFT-LTLV-R-T
A0A5R8WLY4      -SY-AQGQGEQGG-----------------EYRF-GEPLT-T-----PGFT-LNLT-R-T
A0A1I5WSL8      -EF-MGQGRPTSG-----------------EYAL-GQTID-L-----SGIT-LQIV-GTP
A0A0U3JVM7      -EF-TGQGRPLGG-----------------EYSL-GQEIK-L-----PGIT-LAVL-GTN
A0A1G1SSV2      -DF-VAQGRPLGG-----------------EYAL-GQQIT-F-----PGIQ-LQVL-ETE
A0A1G1SXV7      -EF-VGQGRPLGG-----------------EYAL-GQQIK-F-----PGIQ-LQVL-GTK
A0A6G8CBJ6      -SY-LEDKEEVSG-----------------DYAV-GQPIN-L-----PGIS-LKLT-TDS
A0A0W8EDI5      -VS-KAESGDVRV-----------------DGVF-NQPLK-I-----GNSF-IVLK-P-T
A0A3B7RBP8      -LY-RKNDVEQKV-----------------NGKI-NQTLN-I-----EGSS-ISVY-S-T
A0A3R9P8H7      -TL-PESLGGGVQ-----------------EHTI-GTPFT-A-----GGFR-MEVR-K-T
A0A238WIA7      -TY-LEGGQEVVK-----------------ETGF-DAPVE-T-----TGFR-LRLY-R-T
A0A212UCJ7      -TY-QENGQEVIQ-----------------KAIL-GNQIE-T-----LGFW-FRIY-P-T
A0A4Z0MQE1      -TY-QEGGQEKSQ-----------------KAAV-GDPIE-T-----AGFT-FKIL-Q-T
A0A4Z0PCF4      -TY-QEAGQEKTD-----------------KANI-NEVIE-T-----AGFR-FKIQ-Q-T
A0A5D6VDG1      -SH---EGHEATS-----------------EYAI-DVPIE-L-----PGIT-LYLS-K-N
A0A6H1CVS0      -SH---EGHETAA-----------------EYTI-DTPIE-L-----PGVT-LRLA-K-T
A0A243WHR7      -SY-QYKGQEISA-----------------EYRF-GQPIV-T-----PAME-LVLA-S-T
A0A5B8A0P6      -SY-NFQGQEVNR-----------------EHSV-GQTIS-T-----PDMV-LAIT-T-T
A0A076HRT9      -SY-QKDGQEQGG-----------------DYAL-NQPIR-L-----GGMT-LRIL-P-E
A0A4Z0PVM7      -SY-MYQGQEKTG-----------------DYTI-GQPVV-V-----PGLE-LRIT-T-T
A0A1M6DHW8      -SY-LYAGQERSG-----------------EYSL-GQPIV-L-----PGME-LLFI-G-T
A0A4Q5LC61      -NY-LYGGQEQSG-----------------EYSL-GQPIV-I-----PGME-MRIL-A-T
A0A2U1FKU2      THF-KRHAGRGLSGMEV-------------DGTF-GQPVA-T-----PVGE-LQIDQTPF
A0A0A2F954      THF-EQKERNGIGDIKI-------------DGSF-GRPIA-T-----PVGE-LKLDTTLF
A0A0A2FW91      THF-EQKERNGIGDIKI-------------DGSF-GRPIA-T-----PVGE-LKLDTTLF
A0A2D2N2N1      THF-EQKERNGIGDIKI-------------DGSF-GRPIA-T-----PVGE-LKLNTTLF
Q7MWZ2          THF-EQKERNGIGDIKI-------------DGSF-GRPIA-T-----PVGE-LKLNTTLF
T2NDT6          THF-EQKERNGIGDIKI-------------DGSF-GRPIA-T-----PVGE-LKLNTTLF
W1R7P9          THF-EQKERNGIGDIKI-------------DGSF-GRPIA-T-----PVGE-LKLNTTLF
A0A1R4AFZ0      THF-EQKERNGIGDIKI-------------DGSF-GRPIA-T-----PVGE-LKLNTTLF
A0A1R4DVZ7      THF-EQKERNGIGDIKI-------------DGSF-GRPIA-T-----PVGE-LKLNTTLF
A0A2A8CVM9      ------------------------------------------------------------
A0A5M4B212      -TV-RGKEAIRYDFQNEKELKPAREIEQTRTFPV-NSYVA-S-----DDYA-FRIIPAAD
A0A3D1KEX9      SDM-QIDDSDVDFKQ---------------VVSY-GQSFN-S-----PAGN-IRISQAEF
A0A358Y7S2      IDY-EKSGAKNKL-----------------KLKP-NSRFK-N-----PQFD-IMFKVK-N
A0A1X7J248      -ST-NQDGEEWVSQ------------------KF-GQEFI-V-----DGCK-YKLEITPH
E4TQD2          -TT-NPDEDQWINQ------------------KF-GEYFT-F-----NGCG-YKLETTPH
A0A2J6HHN3      -SY-MNLDGSMEDK----------------SFQP-YESVV-L-----PKVI-FSVEPVDT
A0A1Y3WMT8      ---------------------------LLKQGFF-TTLAE-T-----EATS-FPIRVDYG
A0A1Y4GQU1      ---------------------------VLKRGFF-ETLAE-T-----EATS-FPIKVDYG
A0A6A0R272      -SY-EKNGIRDTSI----------------NLTY-NQPFK-I-----FEES-YSIDRVYS
A0A1V5W8T5      -EY-SLDGEKSIKH----------------EIKR-NEWTQ-I-----QGLK-LYVNII-N
A0A2T8HKA9      -------------------------------MEN-DNIIH-S-----QRIK-LREETTTP
A0A2I0QZ80      -NF-TH-QNKAHHI----------------AIQP-NEILK-N-----NLFD-IKMKVN-D
A0A3E1F1A3      -RF-NH-KGVDYNY----------------KFIP-NSLVQ-T-----PFFK-MRVDIL-N
A0A2U2XBJ3      -NF-KF-NGGNYNY----------------KFAP-NSLLK-T-----PFFD-MRVIVD-N
A0A4Q4KU94      -NF-KY-NGGNYNY----------------KFSP-NSLLK-T-----PFFD-MRVSID-N
A0A3B8INU3      -RF-PWVGEDVQPE----------------EHRF-GETLS-V-----PHLD-LRLEST--
A0A2W1NDY9      -VF-NA-NQKKNEI----------------PVAH-DQLVD-N-----EYFK-FVFKIN-N
A0A5C8AQR5      -NY-EL-HGQKISI----------------NGSL-NDVIQ-N-----NHFK-IVVKTA-S
A0A1G0CI31      -SY-QV-GGKSYSM----------------LKPI-NSRFS-N-----QHFD-IAFKVD-N
A0A556N0M0      -TY-VL-NGQTYSK----------------TSEI-NKTIH-T-----RHFD-IAFKVE-N
F2IKD6          -SY-SL-LGRNYSK----------------VSAI-NQTIK-T-----SHFE-IGFKVN-N
A0A1I7BM74      -KY-NY-KGKEYIE----------------EVFL-NQAHK-N-----EFFH-IFIKSE-N
A0A2G2FJ17      -SM-QR-HGERLKW----------------DIES-NKLLA-T-----PYFD-LEIEIP-N
A0A2E3R1D0      --------------------------------------------------------DDPS
A0A2T2USC0      ------------------------------SDTS-EQSAS-E-----TVAG-LLMSPEEE
A0A2T2V0F3      --------------------------------------------------------PEGE
A0A2T2S682      --------------------------------------------------------PSGE
D5H561          --------------------------------------------------------WAGQ
A0A2H3NWA9      --------------------------------------------------------ETQE
A0A2A8CVB6      --------------------------------------------------------VEGN
A0A2P6C1S6      --------------------------------------------------------PEGE
A0A2T2UTM4      --------------------------------------------------------PEGK
A0A414ZBF2      DFV-LDENDFDEVV----------------TVQM-GDTTD-T-----PVGK-VVVAST--
A0A1Q3Q573      -SY-SF-NGDEFEK----------------EIKP-EQKLK-T-----PYFQ-ATISLK--
A0A662BAY3      -KV-EDEHAAIFDFLNSEIVTYVTNLSFSKEAAY-NEVIK-T-----DYFS-FIIKPKRE
A0A4U3L369      --F-DSKDKQVV------------------TGTY-GDTVH-Y-----NKFV-FYINRN-K
A0A357YNR3      -EY-NKN-----------------------NFHY-NLSPG-D-----STLK-F------P
A0A5E8AX52      -SF-EPAEQSGAS-----------------RHKF-GETIS-T-----PDYN-LLIEKTEN
F4KK08          -KS-SLIGKVQEPI----------------AATL-GDTIA-T-----PIGK-VVVEATPY
A0A6B5PK86      -NY-VH-EGKAYTV----------------KGKL-GEHLI-S-----QHFD-VVVKSE-N
A0A2G2F510      -SY-LK-NGETKVV----------------KGYV-NEHLK-N-----EDFD-VVVKVI-S
A0A316JZ08      -SY-SK-GGKNVKL----------------KGPL-NKHVT-N-----DDMN-VVVKSA-N
A0A496LCF9      TIY-DNTDNEIETI----------------EGTF-NEPIG-C-----KYFL-VKVIPNSD
A0A5P2G2A9      -IR-KIKDEDDSTF----------------FVKW-GDSIP-L-----SKGK-FVIYKQTF
A0A3C0ZQC7      WDR-AESGPEDILL----------------------------------------------
A0A419VXB7      -EV-KSKANLLGINTEVDFEG---------TGVF-GEKFE-N-----RYFS-FTLQKK--
A0A0B0BTJ4      LEY-RLPGQKTTEKTI--------------TGAF-GETIR-D-----TVGV-FRLERAVA
A0A3B9CNN6      LEY-RLPGQKTTEKTI--------------TGAF-GETIR-D-----TVGV-FRLERAVA
R5X290          LEY-RLPGQKTTEKTI--------------TGAF-GETIR-D-----TVGV-FRLERAVA
A0A1Q6E6I7      LEY-RLPGQKTTEKTI--------------TGAF-GETIR-D-----TVGV-FRLERAVA
C3J7R8          EES-SIEAARGTTS----------------QVQI-GVPQD-T-----PMGR-VLVTATEH
A0A1G8BVM8      -TY-NI-SETRDDG----------------EIIS-NDVVD-D-----ISLD-SVVAFSHG
A0A1I1FXP9      -KY-KL-GNVNYSR----------------NFNF-DKTYE-N-----QDVK-FKITKTPF
A0A3N4H5N3      -IL-EDEKKA--------------------EFEF-NEKIR-T-----NFGV-FSLVKKEE
A0A2P8EAX2      -EF-AKNKKT--------------------EFNF-GDKIK-T-----EFGV-FSLEKKSE
A0A4V2F6N9      -NF-KDNKKA--------------------EFNF-GDKIK-T-----EFGV-FSIEKKSE
A0A3B9FXJ0      -AY-EW-KGETWSQ----------------ELEY-NKPYS-T-----PAFS-ISVSRNGK
R5GSU5          FDV-RYKDEDCRIDK---------------VVAY-GQRIA-T-----PAGN-VYLTRKMN
A0A2A3UE91      GTQ-KL------------------------NFAL-NSWLK-T-----ADFD-INIYLN-P
A0A0A2G557      SNF-EGDFEQLSSAPKM-------------IVSL-GETIE-T-----PIGS-FFLTSN-T
A0A2N2WFW8      -ST-KTAGGTESET----------------EFRF-HETVS-L-----PQVN-FLLT---P
A0A1F3IU95      -T---EINGIQTDK----------------SFRF-HEPVS-L-----PQVN-FVLT---P
A0A3D0VUF6      -T---EINGIQTDK----------------SFRF-HEPVS-L-----PQVN-FVLT---P
A0A1T4PT95      SHF-KG----DFSK----------------TSPL-SDRVV-L-----FGET-IETPIG-S
A0A6I6JYY3      -KA-QGENAEVYSYSEDEVLKKISNFSFSKDMDP-GVRLT-A-----NEFS-FTILLNEK
A0A2A4PYG9      --S-YYVGEEQFNK----------------PIXI-GXWXA-L-----EHLE-VKIDVT-D
A0A1F3K695      --L-YKIGEENHEF----------------AIYS-NVWSN-I-----GLAE-IKLKID-D
A0A353KZR1      --L-YKIGEENHEF----------------AIYS-NVWSN-I-----GLAE-IKLKID-D
A0A2N2WYB5      TTY-VKKEGYDQK------------------IEL-NQWTA-I-----QGGE-IKVSIL-N
A0A1F3K4G0      --Y-YGDGGVNASY----------------PIEI-GKWSA-I-----RADS-IRCTVS-D
A0A356H8Y3      --Y-YGDGGVNASY----------------PIEI-GKWSA-I-----RADS-IRCTVS-D
A0A351HSA6      --Y-YGDGGVNASY----------------PIEI-GKWSA-I-----RADS-IRCTVS-D
A0A1F3Q014      -SY-SFDNETEQQH----------------NFIS-NKWMK-F-----PEMD-LFISIK-N
A0A2A4YXP3      --F-ELVVNKLVLG----------------EYQT-NTTIH-L-----PKVD-LKITLL-R
A0A2D5KD44      -SW-GEGKESSV------------------DFYA-GKSCH-L-----PFAE-VIVTVT-D
A0A1F3R158      --F-KLYENEKLIG----------------EFSD-REKIQ-T-----NLAE-FTVIFN-N
A0A2M8ADX2      --F-KLFENETFLG----------------EFIN-NQDIK-L-----SKVD-FKISID-G
A0A1J5B2H0      -SY-CISDNSKIEK----------------TFGL-TEKIV-F-----QDVD-LDVKVT-N
A0A1V5N756      -DF-EAEKKSN-QY----------------EFSI-LDTLK-T-----EYFD-MFVTLK-D
A0A651GU15      -HL----NNNAISD----------------PFLP-NDYVR-T-----RFFE-GRIDLAPP
A0A3Q9FR88      -TY-KI-GEQQIEI----------------AGKS-GQRFS-L-----GGRP-IIIRSK--
A0A553GEX3      -TY-KI-GEQENEI----------------EGKS-GQRFS-L-----GGQP-IIIRSK--
A0A150ADJ9      -TY-NQ-GKS--VV----------------EGIS-GKPLF-F-----EGAD-IIIEPN--
A0A1B1FWQ4      -TY-KV-GQTEKEI----------------KGSS-GESII-L-----GGQS-LIITPK--
A0A1S1Z228      -TY-KT-GDQENTI----------------SGKS-GEQII-L-----GGQP-LIVTPK--
A1ZKR2          -SY-VL-GTQTVKK----------------TYRF-DQPIV-T-----SYYS-FKVI---K
A0A1Q3GX01      -SF-QV-GTNLKKQ----------------IYKF-DQTIN-H-----SGLS-FKVI---K
A0A349DQI4      -SF-QT-GKVLNKQ----------------VYKF-NQTVK-Y-----PGFS-FKVI---K
A0A4P5TMD1      -EY-RI-LKVKYSF----------------NGKF-NQKTI-T-----PHFN-FIAKLT--
A0A2N3IIZ0      -EV-KNDKKTLAEY----------------KGKF-GEWLK-N-----KDVE-LLITQKMP
A0A1F3SJM1      -SY-LK-NGKKKTI----------------RGNL-NEHFV-N-----DDMD-VVIKST-N
A0A2G2EB96      -TY-VK-NGKQVIL----------------SGKL-NERIK-N-----EDFD-VVVKAT-D
A0A2G6PRA9      -SY-VK-GGEKQRV----------------EGML-NEHIQ-N-----SDFD-IVVKAA-D
A0A497D5Z2      -SV-DGENVPVYDYLNDKVIKRLPDLAWFGEGDA-GTPVG-T-----DNFS-FTVYADGN
A0A662B170      -SV-DGENVPVYDYLNDKVIKRLPDLSWFGEVDA-GTPVV-T-----DNFS-FTVYADGN
A0A2A5FYT6      -SY-TI-NDSVYSR----------------EAPI-NEIII-L-----PHVN-LRIKDV-D
A0A2E6SYP1      -FN-DD---PSSNT----------------IVPV-NTWTD-F-----EGLA-LKINIS-N
A0A2E5RLE8      -KV-DV---DSGTV----------------LIPV-NKWVS-I-----DGLE-LKINIS-N
A0A2E7TQF6      -KV-DV---DSGTV----------------LIPV-NKWVS-I-----DGLE-LKINIS-N
A0A2E6GVY9      -KM-DV---DSGSF----------------IIPV-NKWIS-I-----NGLE-LKINIS-N
A0A350JJ90      -NY-LV-GTKSFSE----------------KFAE-EDTIQ-T-----PHFS-FTIV---R
A0A3M1CDV2      -LL-SE--DNLIQI----------------PFHI-NTWTK-H-----EWLD-FFIRLN-E
A0A6C1QGZ7      -SF-TH-RGQSKKY----------------EIHV-NGPNS-L-----PEMD-IIINVH-N
A0A4P5U6G4      -SY-RI-GQQKFIY----------------NGSY-GKKIR-T-----PHFD-FTANT--D
A0A2E2TFD1      -SI-DEPIGDANYQ----------------VFKI-DGDIE-L-----PFVT-LSIKIL-D
A0A2E4ELE6      -TI-ENGKETVEKR----------------LSTN-KWE-D-L-----GFVE-LKFIII-D
A0A522EYA6      -TY-TV-GDQIKTH----------------KFKQ-GTAVS-A-----PEMN-FTITVL-N
A0A2E3XZI5      -VD-EE-NEKIYAE----------------YIEA-NKFFS-S-----KYIS-GILKIDWE
A0A6I7QXV0      -EY-EI-NRNRIRE----------------TLSF-DRFFE-N-----NYFI-LKASLT-E
A0A2M7NLQ9      -TY-QTATGEDFSK----------------IYKF-NTRIK-N-----QYFK-LIISLS-D
I4AFR0          -TY-ETPTGDNFSK----------------IYKF-NTRIK-N-----QYFT-LIISLN-N
A0A2N2Y3E5      -YF-QN-NSSAEKV----------------KIKT-GEWLN-F-----YGSW-LRIEIR-D
A0A2D9D7T6      -SY-TH-NGQSKKI----------------SGEL-NKPIK-T-----KSFE-IIVKAK-N
A0A1F3PPL5      -KI-NS-DDLEFE-----------------NLSV-GKWEN-I-----NGID-VKVTIT-N
A0A357QK06      -KI-NS-DDLEFE-----------------NLSV-GKWEN-I-----NGID-VKVTIT-N
A0A662AEA4      -QY-EI-NGNEYKY----------------ELKT-NTWNL-I-----CGGE-IKLNIN-N
A0A0S2HYK8      -EY-EY-NGETYSY----------------PGEA-GKWTD-L-----GILS-CKAEIL-R
A0A2N5ZWN6      -EF-EI-GDNIITK----------------DIEI-NEWNE-L-----GYFK-IFVTIN-N
A0A2E0FJ09      -KY-TV-DEETFEF----------------NESL-NESFS-T-----EHFI-CSIQIS-D
A0A1F3FZ62      -RY-LL-NEKLNIR----------------EFYF-NETVK-L-----PEME-FVLKLN-P
A0A1F3K211      -RY-LL-NEKLNIR----------------EFYF-NETVK-L-----PEME-FVLKLN-P
A0A1V6I2U9      -AY-TL-GNQKYEY----------------TIQP-EELQT-I-----YGMD-IYVHFP-S
A0A2H0B957      -KY-TY-NNQIVQK----------------SLKS-NAWTD-I-----GGFE-IILNIT-D
A0A1F3CFW6      -KY-KT-NNTNFEK----------------TIKK-NKWTD-I-----NGLE-IKIEVT-D
A0A2M7E2T8      -KY-KT-NNTNYEK----------------TIIK-NQWTD-I-----NGLE-IKIEVT-D
A0A2M7NC69      -KY-KT-NNTNYEK----------------TIIK-NQWTD-I-----NGLE-IKIEVT-D
A0A1F3KLL5      -EY-YI-NGVKSHY----------------SLKP-DRWNK-I-----NKTE-IKININ-N
A0A359D1M1      -EY-YI-NGVKSHY----------------SLKP-DRWNK-I-----NKTE-IKININ-N
A0A0F2NS19      -FQ-SE----KLIG----------------EFSS-NVPIE-L-----KEVT-LRIVFD-N
A0A2A5H8X6      -FQ-SE----KLIG----------------EFSS-NVPIE-L-----KEVT-LRIVFD-N
A0A2H0GAU8      -FE-NE----TLLG----------------EFEV-DTPIK-L-----KQVD-LKIQID-E
A0A2M8FTK1      -FE-NE----TLLG----------------EFEV-DTPIK-L-----KQVD-LKIQID-E
A0A2A5B3B0      -TQ-ND----KVIG----------------DFNV-NETIN-H-----PKVE-LKISLL-D
A0A5C6RXM7      -RD-GE----EILG----------------VFKS-GELIV-I-----DKID-FKIKIL-K
A0A1F3C1M2      -SF-TI-NEKTIEK----------------KFTI-GEWID-L-----DLIE-FKLTVN-N
A0A1F3DS87      -SY-EI-NDKKFER----------------KYTI-GEWID-L-----SLVE-LKLTVS-N
A0A6A0R6K9      -EG-EK-IVRQNVH----------------FNQK-VELPF-A-----HLVI-SINNYE-H
A0A2E7CT70      -TD-FD-NQKSYAK----------------FIKP-GDFFS-S-----NYIS-GKLIID-D
A0A2D5V560      -TD-EK-AEIIYAK----------------YILP-NKFFS-S-----EFIS-GKLKFS-S
A0A2D7K5A8      -TD-EN-EEIEYAN----------------YILP-NKFFS-S-----KFIS-GKLSFS-N
A0A2E1XQ82      -KD-KN-QEIEYAN----------------YILP-NKFFS-S-----KFLS-GKLSFS-N
A0A5C8A5B4      --------------AQGKNVRLYNVKTQEVLPEL-IEKYE-VDQVV-PMDS-MFVGDRLS
A0A4Y9ITE2      LKK-----------GRFSTIAETSGKTFP-------AKFD-T-----PYGD-FVFQKKDA
A0A5M8NYX7      -----------------SFILDKKGDTFS-----IEAQGA-D-----FQKT-FKIDEEIN
A0A3D5KRY6      -----------------KTKYEISCDEKIRIGGWSKHIQF-H-----KEQT-LGEAFKNE
A0A1V5IPN7      -----------------WESYPISGSAYP-----VGNLRR-I-----QIS----------
A0A0E3V905      -----------------NKAVKINEQVYP-----VNHAIE-T-----PYGR-LKIVTKKQ
A0A553ETH6      -----------------KTKYQISFDGED-----VSGAAE-Y-----KTGE-LVSTPQLN
A0A640Q161      -----------------AEFMPKDEEPSF-----VDALKA-N-----IVEA-LPFLPQDD
A0A640QU49      -----------------DDFMPAEDESSI-----VDDIKA-Q-----LTEW-LPFLPQEE
A0A1Q3PII2      ------------------HIERRTGNTFT-----VRTPSN-I-----YKGT-FGIPMALP
A0A351BXT2      --------------------------------------ID-E-----DKKK-FYYILNHG
A0A2K8Z965      -----------------DNTVTINEHVYP-----LNKSIE-T-----PYGR-LKIVSRKA
A0A418M8U8      -----------------SSSVEINEQVYP-----LNQRIK-T-----PQGR-FLIKTRRS
I2GTA4          -----------------SSSVEINEQVYP-----LNQRIK-T-----PQGR-FLIKTRRA
A0A2K8ZAJ2      -----------------SKMVKLNGHMYP-----VNQSIK-T-----PYGQ-LRIFVRKP
A0A368JPA3      -----------------PTTVRLNDWVYP-----ANQIIN-T-----PFGR-LQIFIKQP
A0A5N1JI29      -----------------PTTVRLNDWVYP-----ANQIIN-T-----PFGR-LQIFIKQP
A0A3P1BT12      -----------------PTTIRLNDWVYP-----ANQIIN-T-----PFGR-MQIFIKQP
A0A3P1CI15      -----------------PTTVRLNDWVYP-----ANQVIN-T-----PFGR-LKIFIKQP
A0A4R8CUK1      -----------------PTMVQLNDGVYP-----ANQSVT-T-----PFGR-LRMLVNEP
A0A3D0MYJ7      ------------------NLYIKNKENTY-----NLINED-G-----LRKR-LEGMASIT
A0A662AH13      ------------------NIFDPKFEIIE-----ENNNP---------------KPLKSV
A0A5C7QA01      ------------------KINQNNYQLLD-----ANTAEV-L-----LQAQ-LNKKVKIH
A0A3D3LS70      ------------------YLINRNKKVNS-----EHILQD-E-----LTEL-LGGIVSIS
A0A1G1TM36      ------------------IVLQDTASFAV-----RAADGT-L-----TRHA-FGRPISDS
A0A1G7ZF38      ------------------LIIRETDSTFR-----LQTSDH-Y-----YKGS-FGKKLSLP
C6VS52          ------------------HIVRQAGDFYI-----IEISGS-R-----FRGR-FSSPLALP
A0A2A4G4B1      --------------LDSENFSLSINGSEEMPLHF-NKEIG-Y-----ENVR-FRIIPLLD
A0A0P7X1V8      RAF--------------------------------------------PEDS-SIVTADTV
A0A5C8KAD6      ----------YFTYNNKTKKVKFDGMKY----PL-NEWVD-T-----PYGE-MKFSKNKN
A0A5N1J695      ----------YFTFNEGTHKIKFQEKEY----PL-DEWVR-T-----PYGI-MLFQRNEK
A0A1H4ADG3      ----------YEFTLNGKSGFTVSSDKHVWKGKW-SVPVV-L-----PIGQ-LTLEKNEL
A0A5B8VUR8      ----------YEFHIISTSGFEISSADHIWKGSW-DEPIQ-L-----PIGK-VTLVKNQA
A0A3N2M1H3      REF-------RKFTIDGKIELAGEATL--PKG---KESVK-T-----PIGI-VKVTPNPE
A0A4S2G8T2      REF-------RKFTIDGKIELAGEATL--PKG---KESVK-T-----PIGI-VKVTPNPE
A0A1T5K9D4      D--------------------LSSLGQKNVVVSY-GDKVK-I-----GDGS-FTIDKTRN
A0A077ENE7      KNW------------------NPENKDKEIKIAL-NKLTS-T-----PVGK-ILITPSKY
A0A6I5UW06      KNW------------------NPENKDKEIKIAL-NKLTS-T-----PVGK-ILITPSKY
T0NN57          KNW------------------SKNGNEKEIKVSI-NQSVK-T-----PFGE-VLIVPSKF
X5K347          KNW------------------SKNGNEKEIKVSI-NQSVK-T-----PFGE-VLIVPSKF
A0A212K7W5      ANL-------T---LNGEELDFPD-----EEINL-SESVN-T-----PLGS-IRINPTAF
F5IU11          SDL-------I---LNGEELDFTD-----KEINL-SEPVN-T-----PLGN-ITIHPTAF
A0A6I1IYY4      SNL-------V---VGGKKLSING-----NH-AY-GDTLQ-T-----EAGR-MIVNLKPE
K0XJ09          NQL-------K---IGTKKSDNEG-----QEFLF-GDTII-S-----AAGR-FIVEDIPD
R5EUZ0          NQL-------K---IGTKKSDNEG-----QEFLF-GDTII-S-----AAGR-FIVEDIPD
W0EQS0          KQF-------S---VGGVKSEDRE-----QEIAF-GDTLV-S-----EAGR-IVVEAVPE
A0A1Y3WE15      KQL-------S---IGGGKKSESE-----QEIAF-GDTLV-T-----NAGR-MVVTAVPE
A0A1Y4GUK3      KEL-------N---VGGKKTNEGN-----QQIAF-GDTLV-S-----DAGR-IVVESVPE
A0A352Z1R7      ----------V---KDDDDKLVGEG----SSGRL----MQ-A-----KGFS-LLLNDLKG
A0A3N2N6F7      SD--------M---YDHLGNELDV-----MTVTL-GDTVS-T-----SFGR-MVISAGPN
A0A4P7VVU7      SKM-------M---LNGVECDPSE-----MTVNI-GDTVA-T-----SFGP-ITINPGPA
A0A2V1ILM4      SKM-------M---LNGVECDPSE-----MTVNI-GDTVA-T-----SFGP-ITINPGPA
A0A3N2L0E8      SKM-------M---LNGVECDPSE-----MTVNI-GDTVA-T-----SFGP-ITINPGPA
A0A3N2LFC5      SKM-------M---LNGVECDPSE-----MTVNI-GDTVA-T-----SFGP-ITINPGPA
A0A0A2F501      SNL-------M---LNDNE--LQTQR---ITCSL-GDTIS-A-----PIGK-LVIVRSES
R5B7P0          NDF-------I---HKNEK--VGGKP---VVGHY-GDTLQ-T-----PVGR-IIVQKTKD
R5B0L5          SDL-------V---LNNIP--VDLPNS--GVAIP-GDTIR-T-----QSGN-LVVSLTGR
A0A6I1TEC0      TDF-------KGTSSNGTP--VETNKT--VTGKL-GKLVQ-T-----PLGK-VKLEAAPS
A0A3R5XWG1      TDF-------KGTSSNGTP--VETNKT--VTGKL-GKLVQ-T-----PLGK-VKLEAAPS
A0A646GTR1      TDF-------KGTSSNGTP--VETNKT--VTGKL-GKLVQ-T-----PLGK-VKLEAAPS
A0A5P0Y910      TDF-------KGTSSNGTP--VETNKT--VTGKL-GKLVQ-T-----PLGK-VKLEAAPS
A0A414YFM3      TDF-------KGTSSNGTP--VETNKT--VTGKL-GKLVQ-T-----PLGK-VKLEAAPS
A0A6A7UIA7      TDF-------KGTSSNGTP--VETNKT--VTGKL-GKLVQ-T-----PLGK-VKLEAAPS
A0A6A7VPS3      TDF-------KGTSSNGTP--VETNKT--VTGKL-GKLVQ-T-----PLGK-VKLEAAPS
A0A374THP7      SKI-------KGSNRDNLP--VDDSDE--ISGRL-GQIIH-T-----PLGK-IKVDKAPS
A0A6G1VND1      SRL-------KGITRDNLP--VDDSDE--ITGRL-GQIIH-T-----PLGK-IKVDKAPS
A0A0A2EVS5      SDM-------I---LDGEP--MGEGQI--FLGEL-VDSIP-T-----PMGI-VRVGLNSA
A0A1T4NAJ7      SDM-------I---LDGEP--MGEGQI--FLGEL-VDSIP-T-----PMGI-VRVGLNSA
A0A255T941      YDF-------K---MYTEDGKVEYDKE--VKGNI-GKVVM-T-----PIGQ-MTVHGTKT
A0A3N2KCL3      SDV-------K---SGDLK--SEER----VQGAM-NDTIM-T-----AVGP-MVVVAAEG
A0A4P7VSV0      SDV-------K---SGDLK--SEER----VQGAM-NDTIM-T-----AVGP-MVVVAAEG
A0A2V1IJY1      SDV-------K---SGDLK--SEER----VQGAM-NDTLM-T-----VVGP-MVVVAAEG
A0A4P7VXK7      SDV-------K---SGDLK--SEER----VQGAM-NDTLM-T-----VVGP-MVVVAAEG
A0A1Y4CHN5      SDF-------V---RNGEE--SDAE----ATGKL-NDTIE-T-----PVGR-IVVSTTPY
A0A1M6I2S6      SDV-------M---INGEE--LETE----FSGKM-GDSIR-M-----EVGT-FVINPTKY
A0A1Y3V692      SDV-------M---IDGEE--LETE----FSGKM-GDSIR-M-----EVGT-FVINPTKY
F3PXM2          SGF-------K---VEGEE--TGET----FSGKT-GDTLR-T-----SVGT-LLIDATPY
A0A3E4ZNL4      SEF-------V---VAGEE--TDEQ----FEGNI-GDSIQ-T-----SAGT-LAVSLTSQ
A0A174AHH7      SNF-------I---VAGKE--TGER----FEGNI-GDSIQ-T-----SAGT-LAISLTSQ
A0A174JCE8      SNF-------I---VAGKE--TGER----FEGNI-GDSIQ-T-----SAGT-LAISLTSQ
A0A3E4JMC4      SNF-------I---VAGKE--TGER----FEGNI-GDSIQ-T-----SAGT-LAISLTSQ
A0A412SND6      SNF-------I---VAGKE--TGER----FEGNI-GDSIQ-T-----SAGT-LAISLTSQ
A0A414IEQ9      SNF-------I---VAGKE--TGER----FEGNI-GDSIQ-T-----SAGT-LAISLTSQ
A0A415UKN5      SNF-------I---VAGKE--TGER----FEGNI-GDSIQ-T-----SAGT-LAISLTSQ
A0A6I0U0V8      SNF-------I---VAGKE--TGER----FEGNI-GDSIQ-T-----SAGT-LAISLTSQ
A0A6I2PDH7      SNF-------I---VAGKE--TGER----FEGNI-GDSIQ-T-----SAGT-LAISLTSQ
A0A0M1W8D8      SNF-------I---VAGKE--TGER----FEGNI-GDSIQ-T-----SAGT-LAISLTSQ
A0A3R6GKX5      SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A7V4S1          SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
B0NU19          SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
D4V601          SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A4Q0U3M9      SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A4R4H1Q2      SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A6I0GII7      SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A6I0KYU7      SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A397WLT5      SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A6KY94          SNF-------I---VAGEE--TGER----LEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A173UQR8      SNF-------I---VAGEE--TEER----LEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A3R6HK75      SNF-------I---VAGEE--TEER----LEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A412B7D1      SNF-------I---VAGEE--TEER----LEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A412VNY9      SNF-------I---VAGEE--TEER----LEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A414LTU9      SNF-------I---VAGEE--TGER----LEGII-GDSIQ-T-----SAGT-LAISLTSQ
I9Q4U4          SNF-------I---VAGEE--TEER----LEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A6A2J529      SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A3R6GM96      SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A015XH67      SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A078RZN2      SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A4R4I3T9      SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A6L0K5          SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A7ACT5          SNF-------I---VAGEE--TGER----FEGII-GDSIQ-T-----SAGT-LAISLTSQ
A0A373ISF0      SGL-------K---VAGVE--SENT----FAGRM-GDSIQ-T-----VAGT-LFISPTKF
U6RF62          SGL-------K---VAGVE--SENS----FAGRM-GDSIQ-T-----AAGT-LFISPTKF
A0A662ZZD5      SDM-------E---VNGKA--FGED----FSGKM-GDSIR-T-----EIGT-LVINFTKY
A0A3A5TI83      SDM-------E---VNGKA--FGED----FSGKM-GDSIR-T-----EIGT-LVINFTKY
A0A415NEB6      SDM-------E---VNGKA--FGEE----FSGKM-GDSIR-T-----EIGT-LVINFTKY
A0A6I0I238      SDM-------E---VNGKA--FGED----FSGKM-GDSIR-T-----EIGT-LVINFTKY
A7AJ60          SDM-------E---VNGKA--FGED----FSGKM-GDSIR-T-----EIGT-LVINFTKY
A0A6A2JF01      SDM-------E---VNGKA--FGED----FSGKM-GDSIR-T-----EIGT-LVINFTKY
A0A6I0Y2Y2      SDM-------E---VNGKA--FGED----FSGKM-GDSIR-T-----EIGT-LVINFTKY
A0A6I2Q447      SDM-------E---VNGKA--FGED----FSGKM-GDSIR-T-----EIGT-LVINFTKY
A0A395YYT3      SDM-------E---VNGKA--FGED----FSGKM-GDSIR-T-----EIGT-LVINFTKY
A0A015UXN7      SDM-------E---VNGKA--FGED----FSGKM-GDSIR-T-----EIGT-LVINFTKY
A0A5M5W148      SDM-------E---VNGKA--FGED----FSGKM-GDSIR-T-----EIGT-LVINFTKY
A0A6I2NTL0      SDM-------E---VNGKA--FGED----FSGKM-GDSIR-T-----EIGT-LVINFTKY
A0A016E4F9      SDV-------M---IDGEE--LGID----FSGKM-GDSIR-M-----EIGT-FVINLTKY
A0A4Q5CFJ7      SDV-------M---IDGEE--LGTD----FSGKM-GDSIR-M-----EIGT-FVINPTKY
A0A6H9P0U9      SEL-------E---ISGED--IGET----LSAQM-GDSIQ-T-----SAGI-MIVSPTQE
A0A108TH71      SEL-------E---ISGED--IGET----LSAQM-GDSIQ-T-----SAGI-MIVSPTQE
I8VXH0          SEL-------E---ISGED--IGET----LSAQM-GDSIQ-T-----SAGI-MIVSPTQE
A0A412S0N6      SEL-------E---ISGED--IGET----LSAQM-GDSIQ-T-----SAGI-MIVSPTQE
A0A412IIJ0      SEL-------E---ISGED--IGET----LSAQM-GDSIQ-T-----SAGI-MIVSPTQE
A0A0P0FM97      SEL-------E---ISGED--IGET----LSAQM-GDSIQ-T-----SAGI-MIVSPTQE
R6KTP3          SEL-------E---ISGED--IGET----LSAQM-GDSIQ-T-----SAGI-MIVSPTQE
A0A139LU87      SEL-------E---ISGED--IGET----LSAQM-GDSIQ-T-----SAGI-MIVSPTQE
A0A1C6B3Y5      SEL-------E---ISGED--IGET----LSAQM-GDSIQ-T-----SAGI-MIVSPTQE
E2NMQ4          SEL-------E---ISGED--IGET----LSAQM-GDSIQ-T-----SAGI-MIVSPTQE
A0A412YDB9      SDL-------K---VSDES--TGET----FSAQM-GDSIR-T-----SAGT-MILHPAQK
R7DY01          SDL-------K---VSDES--TGET----FSAQM-GDSIR-T-----SAGT-MILHPAQK
A0A414LGK8      SDL-------K---VSDES--TGET----FSAQM-GDSIR-T-----SAGT-MILHPAQK
A0A415IPQ4      SEF-------E---ISGES--IGET----FSAQI-GDSIR-T-----SAGI-IIISPTEK
A0A3E5BRW7      SEF-------E---ISEES--TRET----FSARP-GDSIH-T-----SVGT-MIISLTQE
K9DXS6          SEF-------E---ISEES--TGET----FSARP-GDSIH-T-----SVGT-MIISLTQE
A0A1M6KFV3      SEF-------E---VSGVD--TRET----FSAQT-GDSIH-T-----PAGT-MIISPTQA
A0A1Q6G7L3      SEF-------E---VSGVD--TREN----FSAQT-GDSIH-T-----PAGT-MIISSTQA
A0A413H235      SEF-------E---VSGVD--TREN----FSAQT-GDSIH-T-----PAGT-MIISSTQA
A0A1M5B2J8      SDL-------T---RNGTP--VEG-E---VNGQL-GDTIQ-S-----PFGK-MAVTATAH
A0A255RCT5      YEL-------T---RNGEH--VGG-E---VKGKL-GDTVQ-S-----PFGK-MSVTATAH
A0A1Y4GLF5      SDF-------T---RNGDD--MKSDK---ITGTL-ADTIA-T-----PLGR-MVVNATAN
A0A1H3XSC0      SDF-------T---RNGNE--FDD-E---ISGRL-SDTIT-T-----PLGI-LKIETTPY
A6LE40          SDF-------T---RNGTE--LDGKD---IKGSL-LDSIP-T-----PLGK-IIIHTTPN
A0A4Y1VPX5      SDF-------I---RNGTD--LEEKD---VKGSL-LDSIT-T-----PLGK-IIIHTTPN
B3JI46          SDF-------I---RNGTD--LEEKD---VKGSL-LDSIT-T-----PLGK-IIIHTTPN
R6NN15          TSF-------V---HNGEK--V--DGE--VVGTL-NDSLV-T-----PIGK-IVIRPAAA
A0A358R8U0      SEF-------V---RNGEE--IPSEKV--IKGNL-TDTLT-T-----PLGR-VEITPTPY
R6WSB6          SEF-------V---RNGEE--IPSEKV--IKGNL-TDTLT-T-----PLGR-VEITPTPY
A0A401LPX7      SSF-------T---RNGTE--IENDDI--VKGSL-NDSIQ-S-----PLGP-IVVIPSAA
A0A6I0J0P8      SSF-------T---RNGTE--TGDDNA--VKGKL-NDSIQ-S-----PLGP-IVITPSAT
A0A6I1BFM0      SSF-------T---RNGTE--TGDDNA--VKGKL-NDSIQ-S-----PLGP-IVITPSAT
A0A6G0GNY9      SSF-------T---RNGTE--TGDDNA--VKGKL-NDSIQ-S-----PLGP-IVITPSAT
A0A3A5Z900      SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
A0A285TGL6      SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
A0A3A5RFX4      SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
A0A1Q6IUW9      SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
A0A3R6NPG7      SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
A0A413XDP6      SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
K6AP24          SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
A0A6I2NHV3      SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
A0A662ZYI7      SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
A0A078RYI7      SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
C7XEQ8          SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
D7INX6          SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
K5ZG55          SSF-------T---RNGTE--IENDGF--VKGNL-NDSIQ-S-----PLGP-IVVIPSAA
A0A3N2N9B8      SEL-------R---YAGKE--FKGT----FTGSI-GDTIS-T-----PAGL-VVINPSAY
A0A3N2NMI0      REL-------K---QGELK--WEES----FTGSL-GDSIA-T-----PVGI-VIVNPSPA
A0A359I8H7      RKF----HLET---PDGDE--EIE-KE--VKAKIGAGPIE-T-----PVGK-VSIIANGN
A0A3N2KA63      SKF----HLET---PDGDE--EIE-KE--VKAKIGAGPIE-T-----PVGK-VSITANGN
A0A4Q0IMT7      SKF----HLET---PDGDE--EIE-KE--VKAKIGAGPIE-T-----PVGK-VSITANGN
A0A3B9FAU3      SNF-------M---RNGKP--VGS-PEVTVTGRT-STIIG-T-----PVGN-VLVTPTQY
A0A3C1E5L7      SNF-------M---RNGKP--VGS-PEVTVTGRT-STIIG-T-----PVGN-VLVTPTQY
A0A4Q0UAV1      SDF------------AGGA--GDT-KNLILSGEV-GRTYK-T-----PVGP-FRINTTEY
A0A354SN68      SHFKGDFGDEV---VNDEE--AEM-KT--ILSQE-GDTLL-T-----PIGK-IFLQKSNS
A0A3N2N595      SGM-------K---IGEKD--IIK-AD--FSGKL-NDTIK-T-----DAGP-IVILPTDY
A0A0A2DUD9      HSF-------V---LNGEK--TEVQDP--VTLVL-GKATE-T-----PLGK-VLVNKNQG
A0A3P1ZBJ5      TGF-------E---SANTK--KKD-KELRIKGRF-KQVVK-T-----PVGD-ILVTPTKN
R5FHS9          SKF-------I---RNKEE--LDG-ED--VTAKL-NQTVH-T-----PIGR-VTIKPSHY
A0A413TW79      SGT-------D---KAGNQ--VESDEE--VQGKL-GQTVR-T-----VMGY-VCVDQAPG
A0A3E5E9M7      SGT-------D---KAGNQ--VESDEE--VQGKL-GQTVR-T-----AMGY-VCVDQAPG
A0A3E4SK73      SGT-------D---KAGNV--VESDEE--VQGKL-GQTVR-T-----AMGY-VCVDQAPG
A0A415GGC6      SGT-------D---KAGNV--VESAVE--VQGKL-GQTVR-T-----AMGY-VCVDQAPG
A0A413DBH9      SGT-------D---KDGNQ--VESDEE--VQGKL-GQTVR-T-----AMGY-VCVDQAPG
A0A1Y4PQK7      SDF-------V---LKGES--LKEVKP--VTGKF-PCTLN-T-----PLGK-VTLETTSG
A0A1Y4IH41      SDF-------V---LKGEL--LKEVKP--VTGKF-PGTLN-T-----PLGK-VTLEATSG
A0A3A6AAP4      SDF-------V---LKGEL--LKEVKP--VTGKF-PGTLN-T-----PLGK-VTLEATSG
A0A6I0ZRD2      SDF-------V---LKGEL--LKEVKP--VTGKF-PGTLN-T-----PLGK-VTLEATSG
A0A1Y4DYA7      TDF-------I---HGGEE---SD-KR--IVVEF-NDTIS-T-----PVGR-LLIKPTHG
A0A1Y3X4I9      TDF-------V---RGEEE---SG-QA--VKALF-NDTVS-T-----PVGR-LLVKPMAG
A0A1Y4FNK8      TDF-------V---HNGED---VD-GE--VTATL-NDTAD-T-----PIGK-LSIKAMND
A0A355FD59      SDF-------V---WGDGS--KSS-KA--IDTRL-GTIVD-T-----PLGK-LSVMPTSH
A0A359CEZ9      SDF-------V---WGDGS--KSS-KA--IDTRL-GTIVD-T-----PLGK-LSVMPTSH
A0A353Q7B4      SDF-------V---WGDGS--KSS-KT--IDTRL-GTIVD-T-----PLGK-LSVMPTSH
F8X3A5          SDF-------A---CDNKD--IAN-NV--IKGKL-NDTID-T-----PLGK-IIVFPTSY
A0A1M3KVR9      SDF-------T---SDNKD--IAN-NV--IKGKF-NDTID-T-----PLGK-IIVVPTSY
A0A4Y9IJS3      SDF-------T---SDNKD--IAN-NV--IKGKF-NDTID-T-----PLGK-IIVVPTSY
A0A495WI87      SDF-------I---RNGEE--LPG-KL--VKGQL-TDTIM-T-----PVGK-VTVCPTPY
A0A354M4S6      SDF-------I---RNGEE--LPG-KL--LKGQL-RDTIM-T-----PVGK-VTVCPTPY
R7DH52          SDF-------I---RNGEE--LPG-KL--LKGQL-RDTIM-T-----PVGK-VTICPTPY
A0A4Q5E7L5      SDF-------T---RNGTD--LDG-KD--IKGRL-LDSIP-T-----PLGK-VIIHTTPN
A0A4P8LP09      SGF-------T---RNGTD--LEG-KD--IKGRL-LDSIT-T-----PLGK-IVVHTTPN
A0A4R4GZU7      SGF-------T---RNGTD--LEG-KD--IKGRL-LDSIT-T-----PLGK-IVVHTTPN
A0A016CWA4      SGF-------T---RNGTD--LEG-KD--IKGRL-LDSIT-T-----PLGK-IVVHTTPN
A0A1C6H117      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A0M1W0V2      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A139KA16      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A174VQ92      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A1Q6HCG0      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A1Y4JYM9      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A3A5QW67      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A3A5RQE6      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A3A6BP07      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A3E5E153      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A3Q9IP20      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A412WV15      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A413ICP6      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A414KYB9      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A5B3FWR2      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A6I0WNS4      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
E5WX00          SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
K0X3P3          SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A415TAH7      SDF-------T---RNGTE--LDG-KD--IKGRL-LDSIT-T-----PLGK-IIIHATPN
A0A078T2W6      SDF-------I---RNGTD--LDE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A6I1AQV4      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A5C6L2P1      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A412MJT7      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A3E4WKT5      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A3A5YY33      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A078TAH2      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A1E9CFZ7      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A373FYU5      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A3A5TZ72      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A3A5XBP2      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A3A6MEG9      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A3E4JP35      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A3E4KP40      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A3E4NX82      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A3E4XFU8      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A412RG70      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A412TD37      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A413GAA4      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A414M7I4      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A496BTA0      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A496D2V6      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A4Q5G1P5      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A5C6KCA6      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A5M5AHM5      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A6I0KZV6      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A6I0Y5K7      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A6I1BFB8      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A6I2P5W5      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
E5UZA2          SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A069SMG6      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
C3RFN5          SDF-------I---RNGTD--LDE-KD--IKGSL-FDSIP-T-----PLGK-IIINTTPN
A0A3A5Z014      SDF-------I---RNGTD--LDE-KD--IKGSL-LDSIP-T-----PLGK-IIINTTPN
A0A6I0ING7      SDF-------I---RNGTD--LDE-KD--IKGNL-LDSIP-T-----PLGK-IIINTTPN
A0A6I2P894      SDF-------I---RNGTD--LDE-KD--IKGNL-LDSIP-T-----PLGK-IIINTTPN
A0A078S3Q8      SDF-------I---RNGTD--LDE-KD--IKGNL-LDSIP-T-----PLGK-IIINTTPN
A0A069SJV7      SDF-------I---RNGTD--LDE-KD--IKGNL-LDSIP-T-----PLGK-IIINTTPN
A0A3E5DXI5      SDF-------I---RNGTD--LDE-KD--IKGNL-LDSIP-T-----PLGK-IIINTTPN
A0A3E5EM98      SDF-------I---RNGTD--LDE-KD--IKGNL-LDSIP-T-----PLGK-IIINTTPN
A0A3E5F453      SDF-------I---RNGTD--LDE-KD--IKGNL-LDSIP-T-----PLGK-IIINTTPN
I9T3G6          SDF-------I---RNGTD--LDE-KD--IKGNL-LDSIP-T-----PLGK-IIINTTPN
A0A3E4SYU0      SDF-------I---RNGTD--LDE-KD--IKGSL-LDSIP-T-----PLGK-IIINTTPN
A6LGY1          SDF-------I---RNGTD--LDE-KD--IKGSL-FDSIP-T-----PLGK-IIIHTTPN
K5ZSH4          SDF-------I---RNGTD--LDE-KD--IKGSL-FDSIP-T-----PLGK-IIINTTPN
A0A6A2RTB3      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A6I0VY00      SDF-------I---RNGTD--LEE-KD--VKGSL-LDSIT-T-----PLGK-IIIHTTPN
A0A1M4YZ07      SDF-------I---RNGTD--LDG-KD--IKGNL-LDSIP-T-----PLGK-IIIHTTPN
A0A4Q5E5M7      SDF-------T---RNGTE--LDG-KD--IKGNL-LDSIT-T-----PLGK-IIIHITPN
A0A0P0FQW1      SDF-------T---RNGTE--LDG-KD--IKGNL-LDSIT-T-----PLGK-IIIHITPN
A0A5M5C0W6      SDF-------T---RNGTE--LDG-KD--IKGNL-LDSIT-T-----PLGK-IIIHITPN
A0A6I0H151      SDF-------T---RNGTE--LDG-KD--IKGNL-LDSIT-T-----PLGK-IIIHITPN
A0A6I0HI59      SDF-------T---RNGTE--LDG-KD--IKGNL-LDSIT-T-----PLGK-IIIHITPN
A0A642LZ22      SDF-------T---RNGTE--LDG-KD--IKGNL-LDSIT-T-----PLGK-IIIHITPN
A0A6I0IP89      SDF-------T---RNGTE--LDG-KD--IKGNL-LDSIT-T-----PLGK-IIIHITPN
A0A642NJ89      SDF-------T---RNGTE--LDG-KD--IKGNL-LDSIT-T-----PLGK-IIIHITPN
A0A6I0HI52      SDF-------T---RNGTE--LDG-KD--IKGNL-LDSIT-T-----PLGK-IIIHITPN
A0A6I0YVB5      SDF-------T---RNGTE--LDG-KD--IKGNL-LDSIT-T-----PLGK-IIIHITPN
A0A6G0G4T5      SDF-------T---RNGTE--LDG-KD--IKGNL-LDSIT-T-----PLGK-IIIHITPN
A0A6I0HFG9      SDF-------T---RNGTE--LDG-KD--IKGNL-LDSIT-T-----PLGK-IIIHITPN
A0A416GA42      SQL------KYQAQELTE----------TKTFVL-NDTVQ-T-----AVGQ-LVVVPTGF
A0A1T3IYP5      KGW------DQSGK--------------DVKVAL-NQLVE-T-----PVGK-VFVTPSKN
A0A3P1Z8V4      TDF------EGIRGLSSEQENL------KLKVPF-GVKTK-T-----PIGT-LTLYKETP
A0A060RD97      SYI------DENETRV------------SIEKKF-GDTVL-I-----RNVL-IEIKPTI-
A0A3C1ITV0      KDF------KINGIKSDAP---------AQTVKL-GQPFK-T-----PVGT-VVLKATKE
R7HN19          KDF------KINGIKSDAP---------AQTVKL-GQPFK-T-----PVGT-VVLKATKE
A0A350IHV0      KNL------RVA----GEKMKYKG----KIKGSF-REELQ-T-----PVGK-IKIVPTMH
R5RVP0          KDL------AVV----GETIKHTE----KITGRL-RDTIS-T-----PVGK-IVIVPTEF
R6A0L2          KGM------TDRMGNDVPD----------VDVQL-GQMTQ-T-----PYGP-LCVVRGPG
R7LG80          KGF------RNKKGKKTDE---------KIKANF-GQTVK-T-----PAGR-LSVVRSKM
A0A2L2WX98      SNF------ERGKDKYKG----------KVSIAV-GETKK-T-----PLGN-LHLIADTY
A0A285T4L1      SDF------TGIPAANDK----------TYTMRL-NDTLT-I-----GSER-ILITGTDR
G5GD56          SDF------VCYNRSTGKKKIFKE----HLSVRP-GVMVK-T-----PIGD-LAINKTTF
R5KD55          SEF------VKNGKPQNSY---------DLTCHV-GQTVN-T-----PLGR-LTIERQPH
A0A174QNT3      SNI------EIEEETRDYD----------KIVAF-NDTLF-T-----PVGR-IIVTPKAE
A0A4S2FGS1      SQL------EIDGNAQSYE----------QAVAF-NDTLS-T-----PAGR-ILVLPHVE
R9I0H0          SQL------EIDGNAPSYE----------QVVAF-NDTLS-T-----PAGR-ILVLPHAE
K5BUT9          SDW------KVMGEKGEIQ---------EQELAY-NDTIR-T-----EAGR-IVVQLRPE
A0A174FPA3      SDW------KVAGEKGRMQ---------EQDLTY-NDTIR-T-----EAGR-IVVQLRPE
R6S9Y6          SDW------KVAGEKGRMQ---------EQDLTY-NDTIR-T-----EAGR-IVVQLRPE
A0A642LIH6      SDW------KVAGEKGRMQ---------EQDLTY-NDTIR-T-----EAGR-IVVQLRPE
C9KX15          SDW------KVAGEKGRMQ---------EQDLTY-NDTIR-T-----EAGR-IVVQLRPE
A0A6H0KRK1      LG---------------------------EKYAY-GDTIQ-T-----EAGR-IVVNLKPE
R6DAG6          LG---------------------------EKYAY-GDTIQ-T-----EAGR-IVVNLKPE
A0A3L8AAP1      SD---------------------------KKYAY-GDTVQ-T-----EAGR-IVVNLKPE
A0A4S2AYX2      SD---------------------------KKYAY-GDTVQ-T-----EAGR-IVVNLKPE
A0A4Y9H477      SD---------------------------KKYAY-GDTVQ-T-----EAGR-IVVNLKPE
A0A0E2M2Y7      SDF------KQQKLNRISEI--------KVEGSF-GRPIA-T-----PVGE-LQIDKTIF
A0A0K2J6Z0      SDF------KQQKLNRISEI--------KVEGSF-GRPIA-T-----PVGE-LQIDKTIF
B2RKZ8          SDF------KQQKLNRISEI--------KVEGSF-GRPIA-T-----PVGE-LQIDKTIF
A0A212GC82      SDF------KQQKLNRISEI--------KVEGSF-GRPIA-T-----PVGE-LQIDKTIF
A0A254MU12      SDF------KQQKLNRISEI--------KVEGSF-GRPIA-T-----PVGE-LQIDKTIF
R6CQ93          SEI------EGIPGAQE-----------TYKVQL-NDTLS-I-----GGEK-ILVTSTDH
A0A3D1NQW3      NYF------EIF---GPDKQKFKQ----EISAVF-GDTIS-T-----PVGQ-MIIRPTLY
B0MT10          NYF------EIF---GPDKQKFKQ----EISAVF-GDTIS-T-----PVGQ-MIIRPTLY
R7JGW9          NYF------EIF---GPDKQKFKQ----EISAVF-GDTIS-T-----PVGQ-MIIRPTLY
A0A3D2BF46      TKF------VNRTSADSDKDKDSEIYEVEMTGRF-NDTIT-T-----PCGL-LVVTPTLY
A0A358R538      SDF------DDGFLPKSERRT-------QIVVES-GDTAA-T-----PVGK-VVVERTPY
A0A1Y4AAB8      TDF------DDGYISDEERGR-------VVTAAY-GDTVS-T-----PLGR-MIIRKTLY
A0A1Y3WWY9      SQF------QDGFVSKQESRS-------VVTAQY-GDTIP-T-----PIGE-IVVHKTLY
A0A1Y4U5L4      SQF------QDGFVSKQESRS-------VVTAQY-GDTIP-T-----PIGE-IVVHKTLY
A0A1Y3VCJ1      SNF------HDPFISKQESED-------RVSARF-GDTVA-S-----PIGQ-IIVRKTLY
A0A1Y3QTW7      ADF------DDKYLTKQEKRR-------VIRGQY-GDTIP-T-----PLGQ-MVVHKTPF
R6XWY7          ADF------DDKYLTKQEKRR-------VIRGQY-GDTIP-T-----PLGQ-MVVHKTPF
A0A4Y1X9Y9      ADF------DDKYLTKQEKRR-------VIRAQY-GDTIP-T-----PLGQ-MVVHKTPF
A0A4Y1WM66      ADF------DDKYLTKQEKRR-------VIRAQY-GDTIP-T-----PLGQ-MVVHKTPF
A0A174AVF1      ADF------DDKYLTKQEKRR-------VIRAQY-GDTIP-T-----PLGQ-MVVHKTPF
A0A656Q4F4      ADF------DDKYLTKQEKRR-------VIRAQY-GDTIP-T-----PLGQ-MVVHKTPF
A0A1Q6EIY0      TDF------EDKFVTRQETKR-------VILAEY-GDTVA-T-----PVGQ-VVVHKTLF
A0A5B5VN71      TDF------EDKFVTRQETKR-------VILAEY-GDTVA-T-----PVGQ-VVVHKTLF
E4M8L3          TDF------EDKFVTRQETKR-------VILAEY-GDTVA-T-----PVGQ-VVVHKTLF
I3YQ50          TDF------EDKFVTRQETKR-------VILAEY-GDTVA-T-----PVGQ-VVVHKTLF
R5UEY8          TDF------EDKFVTRQETKR-------VILAEY-GDTVA-T-----PVGQ-VVVHKTLF
A0A1H4D866      TNF------EDRFVTKQETRS-------SITAAY-GDTIP-T-----PVGQ-VIVRKSLY
A0A5B3G4Y7      SGF------EDQFVTKHESRS-------VITAAY-GDTIP-T-----PVGQ-VVVQKSLY
A0A374A9J5      SEF------KDQFVTKHESRS-------VITAAY-GDTIP-T-----PVGQ-VVVQKSLY
A0A5B3GQN5      SEF------KDQFVTKHESRS-------VITAAY-GDTIP-T-----PVGQ-VVVQKSLY
A0A1Q6E9S3      SEF------KDQFVTKHESRS-------VITAAY-GDTIP-T-----PVGQ-VVVQKSLY
D4IJ36          SEF------KDQFVTKHESRS-------VITAAY-GDTIP-T-----PVGQ-VVVQKSLY
A0A414Q925      ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
A0A415PUS9      ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
A0A108TCU0      ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
A0A413BA42      ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
S3Y344          ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
A0A4Q5G8Y8      ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
A0A412TGL3      ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
A0A413VJ33      ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
A0A414L0W6      ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
A0A412DP39      ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
A0A413ZSE8      ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
B0NP84          ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
R6AK43          ADM------TLQ--NEEEEEEFDE----ILTVQP-GDTVN-T-----PVGK-MVVASTLF
A0A412N2D9      TDM------VLQ--NELEEEEFDE----SLTVQP-GDTVS-T-----PVGK-IAVQPTLF
A0A1Y4JYS9      TDM------VLQ--NELEEEEFDE----SLTVQP-GDTVN-T-----PVGK-IAVQPTLF
R6LHA4          TDM------VLQ--NELEEEEFDE----SLTVQP-GDTVS-T-----PVGK-IAVQPTLF
A0A3E5HPT8      ADF------SLD--------ELEQ----RKTVNL-NDTVD-T-----PLGK-LIVFAAEN
C6IJ48          ADF------SLD--------ELEQ----RKTVNL-NDTVD-T-----PLGK-LIVFTAEN
Q8A3U2          ADF------SLD--------ELEQ----RKTVNL-NDTVD-T-----PLGK-LIVFTAEN
A0A3R6S1H6      AGW------KGD--------DEEW----KQKVAL-KDTVE-T-----PVGK-VVVTPTLY
A0A3R6SD81      AGW------KGD--------DEEW----KQKVAL-KDTVE-T-----PVGK-VVVTPTLY
A0A354WXN6      HDF------KIA-NTEGKLVEAGK----PMEVLL-GDSVD-T-----PVGP-LKIEASLD
R5IP14          SDF------TSN---------EDW----SKKVQL-GDTVS-T-----PVGV-LVVNNTGI
A0A316SZX7      SDL------RTS--AQVSDIDRDL----TIKASL-YDTIS-T-----PIGK-LVIKPTPY
A0A1Y4AIY1      FDF------VTV-NEAGEPVEIKN----PQEVVL-NDTVT-T-----PVGR-IVVQPSLY
A0A0J6CIR2      SGF------STN------E---AK----SLKVAL-NDTVS-T-----PVGK-LVVTPTLY
A0A3D8HG59      SDF------EAD------SVDVSD----AVTVAL-NDTVQ-T-----PVGR-VVVTPTLF
A0A3R6S408      SDF------EAD------SVDVSD----AMTVAL-NDTVQ-T-----PVGR-VVVTPTLF
F3ZRU7          TDV------KTW---TGGEEVELP----HFSVQL-NDTVD-S-----PLG--LLLVKTTG
A0A1C5Q1F3      SDF------PEM-----EGVKPVE----QMKVHL-NDTVA-T-----PVGK-LVVTPTLY
R7A239          SDF------PEM-----EGVKPVE----QMKVHL-NDTVA-T-----PVGK-LVVTPTLY
A0A3R6HIK7      SDF------IMA-DSNGQRVEIKK----AQDVAL-NDTVQ-T-----PVGR-VVVVPSLY
K5ZVW7          SDF------ITA-DSNGQRVEIKK----AQDVAL-NDTVQ-T-----PVGR-VVVVPSLY
A0A1Y4D5Z0      SKF------ITR-NEEGKLVEIEK----AQRVAL-NDTVT-T-----PVGK-LVVVPSLY
A0A413VXJ7      SDL------KMS--VGDGEVTSNE----VLEVNL-HDTIQ-T-----PVGA-MVVMPTLY
I9RSN9          SDL------KMS--VGDGEVTSNE----VLEVNL-HDTIQ-T-----PVGA-MVVMPTLY
U6RJK5          SDL------KMS--VGDGEVTSNE----VLEVNL-HDTIQ-T-----PVGA-MVVMPTLY
A0A1Q6GA32      SDL------KMS--VGDGEVTSNE----VLEVNL-HDTIQ-T-----PVGA-MVVMPTLY
I9RPU6          SGF------SLA--VGGGGVHSEE----ALDVHL-NDTVS-T-----PIGP-MVITPTLY
I8YFS5          SDF------SLS--IAGEEIRSAE----VVDARL-NDTIS-T-----PVGT-MVVTPTLY
A0A6H9LTF8      SDF------SLS--IAGEEIRSAE----VVDARL-NDTIL-T-----PVGT-MVVTPTLY
I8Y597          SDF------SLS--IAGEEIRSAE----VVDARL-NDTIS-T-----PVGT-MVVTPTLY
A0A1Q6GBF5      SGF------SLA--VGGGIIHSEE----ILDVHL-NDTVS-T-----PIGT-MVVTPTLY
I8YFZ3          SGF------SLA--VGGGEVHSEE----VLDVRL-NDTVS-T-----PIGP-MVITPTLY
A0A6H9M1J1      SNF------SLA--VGEGEIHSEE----VLDVNL-NDTVS-T-----PIGP-MIITPTLY
A0A1Q6GDH2      SGF------SLA--VGGGGVHSEE----VLDVHL-NDTVS-T-----PIGP-MVITPTLY
U6RSB0          SGF------SLA--VGGGGIHSEE----VLDVHL-NDTVS-T-----PIGP-MVVTPTLY
I9GXM2          SDF------SLA--VGGGEISSEE----VLDVHL-NDTVS-T-----PIGP-MVITPTLY
I9SIK1          SGF------SLA--VGGGGVRSEE----VLDVHL-NDTVS-T-----PIGP-MVITPTLY
A0A6H9LZ74      SGF------SLA--VGGGVVRSEE----VLDVHL-NDTVS-T-----PIGP-MVITPTLY
I9TP59          SGF------SLA--VGEGEIHSEE----VLDVHL-NDTVS-T-----PIGP-MVITPTLY
R5S343          SGF------KEE----------NR----EIEAVL-NDTVD-T-----PSGR-AVVAPTGY
A0A1M6K7I9      SEL------LMI--VNNEEIQSVD----EPEVAL-GDTIK-T-----AIGN-IVVTPTLY
A0A5M6A8C8      SEL------LMI--VNNEEIQSVD----EPEVAL-GDTIK-T-----ALGN-IVVTPTLY
A0A6H9LT84      SDL------TLT--IGDEELRSTE----TIDVHL-NDTVS-T-----PVGT-VVITPSLY
A0A6H9LUV5      SDF------VLS--VNGEESHFAE----TVDVHL-NDTVS-T-----PIGT-VVVTPTLY
A0A3R5ZMK1      SGF------TLG----GQEVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
A0A3E4ZTK7      SDF------VID----DE--SAGE----SMTVAL-NDTVT-T-----PVGR-VVVVPSLY
A0A1Y3ZIA4      SGF------TLG----DQEVSDGK----PMKVAL-NDTVT-T-----PIGR-VVVVPSLY
K5Y1A4          SGF------TLG----DQEVSDGK----PMKVAL-NDTVT-T-----PIGR-VVVVPSLY
A0A4Q5CIT0      SGF------TLD----GQEVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
A0A3R6K8X4      SGF------TLG----GQEVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
A0A414GI87      SGF------TLG----GREVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
A0A415BDM7      SGF------TLG----GREVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
A0A412DM15      SGF------TLG----GQEVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
A7AEU7          SGF------TLG----GQEVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
A0A1Q6I3T6      SGF------TLG----GQEVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
A0A414XX40      SGF------TLG----GQEVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
A0A3R6BKI7      SGF------TLG----GQEVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
A0A414LPI6      SGF------TLG----GQEVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
A0A412M2W1      SGF------TLG----GQEVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
K5ZX55          SGF------TLG----GQEVADGK----PVKVAL-NDTVT-T-----PVGR-VVVVPSLY
A0A5F0U645      SGF------FSEELEEEGQVQEDQ----TLTVAL-NDTVS-T-----PIGK-VVVTPSLY
K5ZBN2          SGF------FSEELEEEGQVQEDQ----TLTVAL-NDTVS-T-----PIGK-VVVTPSLY
A0A0J6CKW3      SGF------FSEELEEEGQVQEDQ----TLTVAL-NDTVS-T-----PIGK-VVVTPSLY
A0A0F5IQM7      SGF------FSEELEEEGQVLEDQ----TLTVAL-NDTVS-T-----PIGK-VVVTPSLY
A0A496CDT3      SGF------FSEELEEEGQVLEDQ----TLTVAL-NDTVS-T-----PIGK-VVVTPSLY
A0A6G1ZKM3      SGF------FSEELEEEGQVQEDQ----TLTVAL-NDTVS-T-----PIGK-VVVTPSLY
S0GLB0          SGF------FSEELEEEGQVQEDQ----TLTVAL-NDTVS-T-----PIGK-VVVTPSLY
A0A3R6NLC1      SGF------TSEELEEEGQSLEDQ----TLTVAL-NDTVS-T-----PIGK-VVVTPSLY
A0A416WYC9      SGF------TSEELEEEGQTLEDQ----TQTVAL-NDTVS-T-----PIGK-VVVTPSLY
A0A0F5IT40      SGF------STN---------EAK----SLKVAL-NDTVS-T-----PVGK-LVVTPTLY
A0A496CX20      SGF------STN---------EAK----SLKVAL-NDTVS-T-----PVGK-LVVTPTLY
A0A5F0UBI0      SGF------STN---------EAK----SLKVAL-NDTVS-T-----PVGK-LVVTPTLY
A0A6G1ZHG0      SGF------STN---------EAK----SLKVAL-NDTVS-T-----PVGK-LVVTPTLY
S0GSI7          SGF------STN---------EAK----SLKVAL-NDTVS-T-----PVGK-LVVTPTLY
K5YB65          SGF------STN---------EAK----SLKVAL-NDTVS-T-----PVGK-LVVTPTLY
A0A0F5IWP9      SDF------STD---------ETK----MLKVVL-NDTVI-T-----SIGK-LVVTPTLY
A0A0F5IZT8      SDF------STD---------ETK----MLKVVL-NDTVI-T-----SIGK-LVVTPTLY
A0A417LKQ2      SDF------STD---------EGK----MQKIAL-NDTVT-T-----PVGK-LVVTPTLY
A0A416TME1      SDF------SMA---------EGK----MQKVVL-NDTVA-T-----PAGK-LVVTPTLY
A0A416XPE8      SDF------SMA---------EGK----MQKVVL-NDTVA-T-----PAGK-LVVTPTLY
A0A3B0C2S4      --------------TVVGLAEKDTVPIQL------------------PFN--ITFLENAQ
L8JI02          --------------VDVYNFLTNRTEDTFDEINL-REVVE-AGKPFRTHSLAFTIRPNEL
A0A4Q5WS95      -----------------------QVRIGAAAYPL-DQLVA-T-----PYGS-LTFSPNPR
A0A501VZX6      -----------------------QVIINNDEYST-GKWVQ-T-----PYGI-IRFSLNTR
A0A399SH26      -----------------------EVTVDGKSYPL-NKSIR-M-----PYGV-IKFIPNDH
A0A501W1A9      -----------------------QVIIDNKPYNL-NTWAK-T-----PYGE-LQFIENPQ
A0A0E3ZGV6      -----------------------EVIIDSKKYSI-GTWEK-T-----PYGV-MLFSENEK
A0A1I2N4S1      -----------------------KVQIDGKEYPL-STWVV-T-----PYGE-MLFEKNLL
A0A2T5YE44      -----------------------KVKIDGKEYPL-STWVV-T-----PYGE-MLFEKNLL
A0A1V9FHD0      --------------K-----EIKEVVIDKKAYPM-NTWCN-T-----PYGV-LKFEKNAR
A0A4V4H170      --------------RDVIK-KVREIVIGEKIYPI-KKWVS-T-----PWGE-LKFEHNDR
A0A1V9F098      --------------RNVDEPKVKEVVIGKKVFPI-NQWVS-T-----KYGE-LKFEKNER
A0A4R2VU64      --------------KELSNLKVKEVVIKKKTYPV-NQWVT-T-----PYGE-LKFVENQK
A0A4S8HY23      --------------NGLIKQKVKEVIIDNNAYPI-NTWCA-T-----PYGE-LKFENNNR
A0A1V9F383      --------------TNVYKDKVKEVVIENRKYPL-RVWCN-T-----RWGE-LKFIPNDR
G8TRZ6          --------------HNGYKDKVKEVVIENKKYPL-REWCQ-T-----RWGV-VKFMPNER
A0A543WA52      -----------------------KIKIDNKVFSL-NEWIS-D-----IRWGEIKFIPNPN
A0A1M5BA90      -----------------------TVAIEGKMYSL-NKWIS-T-----PFGV-ARITRNLN
A0A512B879      -----------------------TIDIAGKSYPL-DQWVT-T-----SFGT-AKFNINRY
A0A559PPI3      -----------------------NVKVDGRIYPL-NEWVD-S-----PFGK-IMFYPNKN
A0A1T5CS78      -----------------------NVVFSGKEYSL-NKWFE-I-----SNGQTIMFVKNDN
A0A0Q9Z8F1      -----------------------KVIFSGKEYSL-NEWFE-F-----SAGQTIMFVKNDH
A0A2N0U0M7      -----------------------KVVFSGKEYSL-NEWFE-F-----SAGQTIMFVKNDN
A0A2N3U785      -----------------NNFVLND-EEKETLHEF-GQKIV-L-----PYAT-FTVTAA--
A0A0D3L8Q3      -----------------NSYDI-EYNEKISSHKF-GQRVN-V-----GFGE-FTIVSD--
A0A0E3ZG78      -----------------STYNLDDNEGKMYTYKF-GQQIQ-K-----PYGV-FTVVPDSG
A0A1I6BRK6      -----------------NFFDLEDYKGITTSHRF-GQKIH-K-----AFGS-FTVITAGG
A0A243WAB1      -----------------NSFQLEDYDGTVTSHSF-GQQIA-K-----PYGL-FTIIAASG
A0A6G8C8X6      -----------------NSFTLDDYSGKVTTHSF-GQQIT-K-----PYGK-FTVVAATV
A0A5B6TJH8      -----------------NSFVLEEQDGKRSIHSF-GKRIQ-K-----PYAT-FTVLATYK
A0A519U664      -----------------NSFQLQDYTGTTNTYKL-GQQIK-K-----PYGS-FTIVAS--
A0A519UDD1      -----------------NAFDLDDYTGHITTHKF-GQQIR-K-----PYGT-FTVIAT--
A0A519MA34      -----------------NSFQLQDYTGAVTTHKF-GQQIE-K-----PYGS-FTIVAA--
A0A519UCX0      -----------------NSFQLQDYTGAVTTHRF-GQEIK-M-----PYGS-FTIVAS--
A0A4R5DL69      --------------------------------------TV-K-----ANDQ-FTLTDKVH
A0A1M4YED3      -----------------G--------------------KS-Y-----PMNK-FVTTPFGV
A0A2H3NSN0      --------------------------------------TT-D-----T--P-FQLFA---
A0A2P6C324      --------------------------------------TT-Q-----GV-Q-FTLLA---
A0A1M6XHU0      --------------------------------------TA-G-----AKER-FPILA---
A0A5S9C8G0      --------------------------------------TA-G-----AKDR-FPILA---
G2SF81          --------------------------------------TA-G-----AKDR-FPILA---
A0A5S9EYW1      --------------------------------------TA-G-----AKDR-FPILA---
D0MHQ9          --------------------------------------TA-G-----AKDR-FPILA---
A0A126PFG0      -----------------TSFYMAATNGNLTAHPF-GRPVS-D-----SIGT-WQLTPVPA
A0A3M1N7Z3      -----------------RKVEIWRAETLI---------VS-G-----KIGQ-WMALPGAS
                                                                            

A0A1T5MMH4      FL-----------DEND----------IDLFFIIN--SPDALLGYL-----ISGLSVE-P
A0A2W4R1L8      FT-----------SESG----------LNCFFVIN--SPEVLMNYL-----MRNLTVE-P
A0A2E5CV79      -------------------------------------YTEPYSDAI-----GEKFSQN-V
A0A2D4ZVH1      -------------------------------------SIDTVAMRY-----RELIRFS-E
A0A0K8QSK7      AP-----------SGLSGT--------Y--AIEFN--TVQQTGKLY-----ASRLTVA-Q
A0A1V6CN82      FF-----------PPVTDY--------F--FFRFH--TPDELINAY-----RSRMTVS-L
A0A1M4XZ45      FN-----------PNAANS--------Y--KFRFN--TKKSLVDKY-----RKSLEVT-L
A0A399D319      FD-----------SNASNN--------Y--KFRFN--SKKALLKRY-----REQLDVT-L
A0A1M6GR99      DS-----------LLSSDNRR------F--AFKLS--TIKQLVSHY-----EQKLEFN-I
A6EBM4          AA-----------PSSS----------Y--LFRFN--TPEDFLDRI-----REGLRIG-E
A0A1M6TTV4      FA-----------SQKNLVE-------F--YFIIN--SEDALINYF-----QKNIVVE-P
A0A4Q8RX32      VA-----------LEEVSAND------Y--FFDVK--GKTQLVGEL-----KEQLTIE-P
K0X1U5          EG-----------IVIDKTEFYKPGKKL--KFVAHVNGYDGEAEIL-----EKRLDID-L
R5EXK3          EG-----------IIIDKTQFYEPGKKL--KFVAHVNGYDGEAEIL-----EKRLDID-L
A0A401UAP7      YT-----------YEPKNT--------Y--SFMLN--DAQALRAYF-----TERLMVT-P
A0A1W2GF52      FD-----------DQKNLID-------F--YFVLN--SKESLINYL-----ESHVTVE-P
A0A2G5L7B8      FK-----------EQQNLID-------F--YFVIN--SREALIDYF-----QQNIIVE-P
A0A523GAC0      LP-----------LNEVDKDQL-----Y--SFKIN--SQNSLLLYL-----ENNITVE-P
L8JW09          F--------------DPKGDKN-----F--FFIIN--SKAAQIKYL-----GSNLTVE-P
A0A364XUP5      FK-----------ESDEEIE-------F--FFIIN--SRDVLMNYL-----IANLTVE-P
A0A1M5RLA9      FR-----------KGD-EIG-------Y--FFVLN--TRDALLGYL-----LRSLTAE-P
A0A385SFR9      FK-----------KGD-EIG-------Y--FFVLN--TRDALLGYL-----LRNLTAE-P
A0A5M4A9J4      AT-----------LPEGT---------Y--RFRFN--THGALVDYF-----RHSLTVA-T
A0A5M4B1C7      EP-----------IPSGT---------Y--RFSFH--NHNGLVNVF-----RKNLTIE-T
A0A0D3LFR6      TT-----------GDAINSN-------Y--YFIIN--SDQSLIDYL-----STNLTVT-I
M7N6D4          IN-----------KDIPESR-------Y--YFIIN--SDNALINYF-----RQNLSVS-I
A0A4D7K1D4      YS-----------RGEGFDD-------Y--SFKIN--NKESQINFI-----QQNLKVE-A
A0A5C7MX19      KF-----------QKQD----------FRGVFYVRKYDKSFVIADV-----INKVSIE-P
A0A1Q3ZMZ7      SF-----------SSSRDND-------L--YFIIQ--DPGLLTRQM-----MSSLKII-P
A0A2D8JJW3      DY-----------KPVGWRETFNSAISLFGLWPVSNQKKHDLVNYTFKDGDIRAAVER-L
A0A2W2AFF7      VK-----------ADEE-------------EYRVDVQSTDEAVEDY-----RKALTAN-V
R7PCR1          YI-----------SEFVGK-----------KISITRISVKDAAKIY-----VKRISAT-P
A0A2N5YXE2      KD-----------MEFELNPDNKSQ--Y--FFTIN--NTKTVLTNI-----ASNLEIQ-V
A0A1G9E2A9      RF-----------FTVPGSIRR-----Y--YFVIN--SRGALISYL-----AENLTVN-V
A0A098LL25      TF-----------WSTNETGAK-----Y--FFTMN--SKEALVKNL-----MDNVSVS-I
A0A6C0GJI1      AQ-----------YSSELDNNK-----Y--YFRIN--SAGALINYL-----ASNIRVD-V
A0A2T2YJE8      VP-----------LSADVIAQK-----Y--YFIVN--SNAAIRQYL-----TSNVAVN-I
A0A127B287      PS-----------FSANHIGES-----F--YFIVH--SSGALKRYL-----NDNLSVA-V
A0A3M9N829      SS-----------FSSAKVGET-----Y--YFIVH--SSQRLKRYI-----DENLSTA-I
A0A0P0CSF9      NN-----------FSSSNVGIV-----Y--YFIVN--SDQRLKGYI-----DTNLTTA-I
A0A5M8QQB8      PS-----------FSSASVGVE-----Y--YFVIN--SDQRLKGYI-----DGNLTTA-I
A0A3M9MNC3      PS-----------FTSVNVGET-----Y--YFIVH--SNQSLKGYI-----DNNLTTA-I
A0A5B6TAX2      SS-----------FTTSNVGET-----Y--YFIVH--SNQALKGYI-----DNNLTTA-I
A0A5N1IQ33      PA-----------TGAEELKVN-----Y--YFVIN--DDGAMARYF-----DENLVVE-I
A0A512AYT3      -N-----------FNEDAQGRK-----Y--FFVIN--SDGALNSYF-----NQNLSVE-I
A0A5M6CYN7      -N-----------FGEGTLDGK-----Y--YFVIN--SDGALNAYF-----NQNLSVE-I
A0A369QP10      AP-----------LNSDILAQK-----Y--YFTIN--STGAIRQYL-----TSNVAVN-I
A0A126PDF2      QY-----------FGPASLIAK-----Y--HFTIQ--DQGTVNAYL-----EKNLAVD-I
A0A2Z3GKA1      RY-----------FGPATLTAK-----Y--HFTVQ--DEGTVNAYL-----EKNLAVD-I
A0A502GZP7      SY-----------FGPATLGEK-----Y--HFTIQ--DEGTVNGYL-----EKNLAVD-I
A0A519SBU8      DQ-----------TIPTSESSP-----Y--FFVIL--DDGALNAYL-----DRNLDVA-V
A0A4Q3JNZ3      GR-----------ALPVGDDPQ-----Y--HFVVL--SDGDISGYL-----NRNLDVT-V
A0A519Q9V3      GR-----------TLPVGNDPQ-----Y--HFVIL--DDGAVSDYL-----DTNLDVA-V
A0A0M3RW20      PQ-----------FSSDVIGKD-----Y--HFVVK--DNGAINQYI-----DQNLTVE-I
A0A495VFX4      PY-----------FSDEAIGRD-----Y--HFVVN--DKSSINQYI-----DQNLIVE-I
A0A1S9B3W0      KH-----------FNPQDTEGA-----Y--YFIIK--DPGSINGYL-----GSNLGVS-V
A0A1W1VRL3      TY-----------FDANALDAQ-----F--YFVIL--DEGTLNTYL-----NTNLSVQ-I
A0A1M6R305      AY-----------MGATTLDNN-----Y--HFTIN--DEGTINSYL-----DRNLLVE-I
A0A4Z0PHK3      PL-----------LTDESREKN-----Y--HFVIN--DEGAVNNYL-----NTNLSVD-I
A0A2M9B9H9      PL-----------LDEEALEKN-----Y--HFVIN--DDGAVNNYL-----NTNLSVD-I
A0A4Z0QCY9      AL-----------LDADAREKN-----Y--HFVIN--DDGAVNAYL-----NTNLSVD-I
A0A418R9X5      AQ-----------YEGANRDAN-----Y--SFIIN--DQNAINGYL-----NQNLSVD-I
A0A428JSJ3      AQ-----------YTSADRDAT-----Y--SFVIQ--DGGTVNAYL-----TQNLAVD-I
A0A428KI59      PQ-----------HASADPDAN-----Y--SFVIN--DDGTVNGYL-----NQNLAVE-I
W8F1I6          PQ-----------HANADPEAN-----Y--SFVIN--DDGTVNGYL-----NQNLAVE-I
A0A246FQC0      AN-----------YNESVLEEQ-----Y--SFRIN--SNSALNEYF-----DTNLLVD-I
A0A372E5P8      KD-----------YNLAALDGQ-----Y--SFVIN--SAGALGNYF-----NTNLLVD-I
A0A1H3EMW1      RE-----------YSPEALDGE-----Y--SFMIN--SPGALSNYF-----NTNLLVD-I
A0A1H9ZSN3      AD-----------SGAAAPEGQ-----Y--SFMVN--SPGALSNYF-----NSNLLVD-I
A0A5N1J2M4      NT-----------FSNQVINQH-----Y--YFTIN--SPAAVLNYI-----GSNLSAQ-V
A0A519S476      GR-----------PLPTAEAAQ-----Y--HFVIL--NDGAINAYL-----DKNLDVK-V
A0A4Q3JRW8      GR-----------ALPVGDDPQ-----Y--HFVIL--NDGAVSGYL-----DRNLDVA-V
A0A519M923      GR-----------ALPTGDASP-----Y--YFTIL--NDGAVNAYL-----DKNLDVA-V
A0A4Z0ENW1      EI-----------LVPTQLDAT-----Y--YFIIL--DDNTINSYL-----DRNLKAE-V
A0A519UDB4      EG-----------LNENFSENP-----Y--HFVLL--EDNAITAYL-----DRNLTAE-V
A0A3S0QKV1      KY-----------FSGQLADAT-----Y--YFTIN--DAAAINGYL-----SANLTVS-V
A0A328BL48      RF-----------FNEQTPETK-----F--FFVIN--TPEAINGYL-----AQNLTVS-V
A0A5R8WLY4      RF-----------FNEQTPETK-----Y--FFVVN--TPEAINSYL-----AQNLAVS-I
A0A1I5WSL8      AL------------KGDVQDEN-----Y--HFTIL--SDGAVNQYL-----DKNLAVE-I
A0A0U3JVM7      EL------------TNAAQDAS-----Y--HFTIL--DDRTVNEYL-----DKNLTVE-I
A0A1G1SSV2      SF-----------AANNTADAS-----Y--HFTIQ--DDRSVNAYL-----DKNLTVE-I
A0A1G1SXV7      NL-----------VTDTPDDAS-----Y--HFTIQ--DDYTVNAYL-----DKNLTVE-I
A0A6G8CBJ6      SF-----------FDASALEAQ-----F--YFIIL--DDGSVNGYL-----NKNISVE-I
A0A0W8EDI5      EQ-----------AIQPNI--P-----Y--YFIIH--DNSSVWSYI-----DQGLTVE-I
A0A3B7RBP8      NK-----------SPQAGV--N-----Y--YFVIH--DDATVWGYI-----GENLTVE-I
A0A3R9P8H7      PQ-----------FNDKAFEGE-----Y--FFTIN--SNGALNAYF-----NKNLLVD-I
A0A238WIA7      AF-----------YQPSDLERN-----L--FFIIH--DEGTINGYL-----SQNLQVQ-V
A0A212UCJ7      SL-----------FRPSDTERN-----F--YFVIR--DEGFINQYL-----SSNLQVQ-I
A0A4Z0MQE1      PL-----------FRPVDTDRS-----F--YFIIR--DEGFINGYL-----SSNLQAQ-I
A0A4Z0PCF4      SR-----------FRPTDVERS-----F--YFIIR--DDAFINGYL-----SSNLQVQ-V
A0A5D6VDG1      KN-----------FTEDALNRS-----F--QFVIR--DDASINRYF-----DENLTVE-I
A0A6H1CVS0      KN-----------FTEDALNRS-----F--QFVIH--DDASINRYF-----DENLTVE-I
A0A243WHR7      PW-----------MNESVVGKK-----Y--FFVIN--DDGTISNYL-----NKGLNVQ-V
A0A5B8A0P6      PA-----------FNDQAINKK-----Y--YFIIN--DEGTLNSYF-----EKNISVD-I
A0A076HRT9      GK-----------IDASVIERN-----Y--FFTIN--DEAAINAYL-----DRNLLVE-I
A0A4Z0PVM7      DL-----------MNQEARDKN-----Y--HFVIN--DDGAVNAYL-----NTNLSVD-I
A0A1M6DHW8      SF-----------LNAEALDKK-----Y--HFVIN--DEGTLNAYL-----SSNLSVD-I
A0A4Q5LC61      PL-----------LNAEAQDKK-----Y--HFVIN--DDGGLNAYL-----SNNLSVE-I
A0A2U1FKU2      FV-----------AAWKGQ-----------VVYVVKEDMRKVVERY-----NQELQVA-L
A0A0A2F954      FA-----------DSWKGE-----------VLYVKKENTRKVAERY-----NQDLQVS-L
A0A0A2FW91      FA-----------DSWKGE-----------VLYVTKENTRKVVERY-----NQDLQVS-L
A0A2D2N2N1      FA-----------DSWKGE-----------VLYVTKENTRKVVERY-----NQDLQVS-L
Q7MWZ2          FA-----------DSWKGE-----------VLYVTKENTRKVVERY-----NQDLQVS-L
T2NDT6          FA-----------DSWKGE-----------VLYVTKENTRKVVERY-----NQDLQVS-L
W1R7P9          FA-----------DLWKGE-----------VLYVTKENTRKVVERY-----NQDLQVS-L
A0A1R4AFZ0      FA-----------DSWKGE-----------VLYVTKENTRKVVERY-----NQDLQVS-L
A0A1R4DVZ7      FA-----------DSWKGE-----------VLYVTKENTRKVVERY-----NQDLQVS-L
A0A2A8CVM9      -------------------------------------STNEVMSHM-----MQRVSFV-P
A0A5M4B212      TQ-------------------------LEGSYRIAFHSLDQLTNEY-----MEKLTVA-P
A0A3D1KEX9      DP-----------EFVGK------------IIHVTRIKKEDAITKF-----NKAVTAS-E
A0A358Y7S2      ID-----------ELKEHCAENE----V--YFEFI--QREKLIEEI-----KEKLTVI-A
A0A1X7J248      FF-----------NTES----------L--TFTIS--TPESLMSYV-----ESNLSVA-P
E4TQD2          FF-----------NTER----------L--FFTIS--TPESLINYV-----ESNLSVA-P
A0A2J6HHN3      VN-----------FMQKFKNRE-----F--IVVFN--NIDNLVYKY-----SRKINIS-V
A0A1Y3WMT8      EG-----------IVIDTTRYYNPDKKL--RFVAHINGYDTQTELL-----EKRLEID-L
A0A1Y4GQU1      EG-----------IVIDKTSYYKPGEKL--RFVAHINGYDVQTELL-----SKRLEID-L
A0A6A0R272      EP-----------LKSIETDG---------SYVIKVVDKVKLAQEF-----AKQLTVT-Q
A0A1V5W8T5      VE-----------QILENKGNK-----F--YFRIL--DDKGAFAEH-----ITGLDVS-I
A0A2T8HKA9      IG-----------KLTISSNKLYKPSIFGEEITVTKIPRETMVSYF-----LSRMKIV-Q
A0A2I0QZ80      FQ-----------ELKTDAETNQ----L--YFVFN--DLNTVSSRF-----HDDLSIR-P
A0A3E1F1A3      WN-----------QFKTNSSNNK----Y--YIVLN--EDKVLANNL-----HSGLSVS-L
A0A2U2XBJ3      WS-----------QFVLNSTSNK----L--YFELN--DKSTMSRRL-----RPGLTVT-P
A0A4Q4KU94      WD-----------QYLANTTSNK----L--YFVLN--EKKSIARQL-----RSGLTVT-P
A0A3B8INU3      ----------------SHLNSSYLGEPM--YFVIN--SNGALLNYI-----GAHLAVT-P
A0A2W1NDY9      EK-----------VFKADLEKDD----L--FFKIN--NYKTLTNVL-----IHSLIVN-I
A0A5C8AQR5      IG-----------AFKFASEANQ----L--YFVFN--ERKALIDRL-----LPGLIIV-P
A0A1G0CI31      IE-----------NLRSDDEQNE----L--YFTFN--NKKTLVTRL-----LPNLEIT-P
A0A556N0M0      WN-----------ILKQDDEANR----L--YFTFN--NQKTLASRL-----ITNLEVN-P
F2IKD6          WQ-----------SLKQEDVSND----L--YFTFN--NQKNLAARL-----ISNLEVN-P
A0A1I7BM74      EE-----------VLKRDINDNE----L--YFVFN--NTQSLMARL-----HGDLTIA-P
A0A2G2FJ17      WE-----------SFVTDAETNV----L--YFHFN--SEDNLASKY-----LSGLAVS-P
A0A2E3R1D0      TP--------------------------------L--TVQEVAFRL----QRGSIKST-M
A0A2T2USC0      RR-----------------------------------TVSEIAGDLVSQGGKATMSAS-A
A0A2T2V0F3      RR-----------------------------------TVGEIAGDLVAQGGKATMSAA-A
A0A2T2S682      GR-----------------------------------SRAVLAGLL-----RRRVRAQ-S
D5H561          GT-----------GGAEGGASGDDPSPV--DTTQL--SPASVAPAL-----AGRVRFS-R
A0A2H3NWA9      RL-----------------------------------SAQQLAGRL-----MGRVQAS-P
A0A2A8CVB6      RL-----------------------------------SQNQIAHRV-----RGSIRAG-T
A0A2P6C1S6      QR-----------------------------------SISAVAGQV-----QNMISAQ-P
A0A2T2UTM4      RR-----------------------------------STAEVANQV-----KGMISAQ-P
A0A414ZBF2      ----------------LFMNEEYMGKPV--YVKKG--NRKNVSDNY-----NANLQVE-V
A0A1Q3Q573      ---------------PDKLSDGSFNSLY--FVKFN--DKQTIINDI-----NSKITIE-P
A0A662BAY3      RN-----------KIETAT--------Y--KFRFN--IRSDLLKQY-----KNDLSVN-M
A0A4U3L369      YI-----------KIDKDNEDK-----F--FFQIT--SYDNATAAY-----QKNLVIT-V
A0A357YNR3      FG-----------EIEVATTPIIHSRNM--MVEIDIYRPADVANMY-----LGNLTVE-L
A0A5E8AX52      FA-----------EDNGIGK-------Y--YFTIN--SESALISFF-----QSNVTVQ-P
F4KK08          YS-----------NFPNY---------E--VLKVQKDNFNAVVRNY-----MKALQVS-L
A0A6B5PK86      IS-----------AFLEETESNE----I--YFTFN--STQSLSERF-----IRNLYVL-P
A0A2G2F510      DD-----------ALRDASTINE----L--YFTFN--SIESVTERL-----RKGLKVV-P
A0A316JZ08      PK-----------VFRKMASENE----L--YFTFN--SRQGLVERL-----HGGLDVI-P
A0A496LCF9      FM-----------DLKT----------V--NFQFR--TRQSLISEF-----FAKLQIR-L
A0A5P2G2A9      FD-----------KKKAN---------Y--TFVIN--PIKSEVQGI-----LQNLSAE-I
A0A3C0ZQC7      -------------------------------------TASEIAKRL-----MTAVEFE-P
A0A419VXB7      --------------------VLPTEGDY--YFEFN--DLEKLTLSY-----LRQLQVS-T
A0A0B0BTJ4      TA-----------GYNPKAANS-----L--RIYVR--PVRNAAEAY-----AKALHVA-Q
A0A3B9CNN6      TA-----------GYNPKAANS-----L--RIYVR--PVRNAAEAY-----AKALHVA-Q
R5X290          TA-----------GYNPKAANS-----L--RIYVR--PVRNAAEAY-----AKALHVA-Q
A0A1Q6E6I7      TA-----------GYNPKAANS-----L--RIYVR--PVRNAAEAY-----AKALHVA-Q
C3J7R8          FP-----------SSEAS---------F--SLEVEKNTRERSIRSF-----SHIFNVS-S
A0A1G8BVM8      KI-----------KIKPTIFMHSGYIGQ--NIIISKINKMNLAKSL-----VAKFNIE-S
A0A1I1FXP9      YK-----------PDVINYE-------Y--FFTIN--SRNKLLMQM-----FFNTSAY-I
A0A3N4H5N3      EG-----------ERLESVSS------F--VLNFV--NPVLITEQF-----SKSLTLE-Q
A0A2P8EAX2      ED-----------AISFPFST------F--VVRLE--NPIVKTERY-----AKALNFE-Q
A0A4V2F6N9      ES-----------AVSFPFST------F--VVILE--NPIVKTERY-----AKALKFE-Q
A0A3B9FXJ0      GK-----------VLAES---------Y--ELIIR--NKLTVAKAM-----EKRIRID-A
R5GSU5          LE-----------GLEPTTVTVSRLPVF------------TATEMY-----RSKLSCG-E
A0A2A3UE91      NI-----------QASVINEIVKDNKGF--YFIVH--DVDAVTAQL-----QAKVELK-L
A0A0A2G557      IA-----------TSKKEP--------I--EIIVN--SKEKTVADL-----SKKLTIS-Q
A0A2N2WFW8      VA-----------GDAKSFFAANNGKQF--LIVFN--SVKDLANSY-----SQKINIA-V
A0A1F3IU95      IN-----------NDAHAFFKSNRNKQF--IVQFN--NLTDIAAQY-----SQQVNIA-V
A0A3D0VUF6      IN-----------NDAHAFFKSNRNKQF--IVQFN--NLTDIAAQY-----SQQVNIA-V
A0A1T4PT95      FV-----------LTGNPSTEVEDKE-I--KITIS--SREEIISDL-----AKRLTIA-Q
A0A6I6JYY3      FD-----------PQAPNE--------F--KFVFN--KKSALVKKY-----TKALTVN-L
A0A2A4PYG9      FS-----------LISTQQNQFAQNP-Y--FFIVN--NTAAEIDKY-----YHLIDVR-I
A0A1F3K695      TS-----------QIQAQLSDLKQNS-F--YFIIK--NPNNVYLDH-----FSRLEVA-V
A0A353KZR1      TS-----------QIQAQLSDLKQNS-F--YFIIK--NPNNVYLDH-----FSRLEVA-V
A0A2N2WYB5      ID-----------DIESQQEYYKSNR-Y--YFIIN--NPQTLVDLH-----LQTLQVA-L
A0A1F3K4G0      YL-----------TIESQKENYKGNR-F--YFVIS--NPKNIVENH-----LQNLDIF-L
A0A356H8Y3      YL-----------TIESQKENYKGNR-F--YFVIS--NPKNIVENH-----LQNLDIF-L
A0A351HSA6      YL-----------TIESQKENYKGNR-F--YFVIS--NPKNIVENH-----LQNLDIF-L
A0A1F3Q014      FT-----------EIANEQNVVKKNA-Y--YFTLN--DLDAIVNES-----YPKVEVK-L
A0A2A4YXP3      KE---------------NYEILKEGN-L--YFRIN--SYEEMTNAW-----DYKLSVF-P
A0A2D5KD44      YS-----------RIKKEVEAVKGIE-Y--HFVLN--NPQSLVKGI-----LSRLEIV-I
A0A1F3R158      YE-----------EAKNAQSDIKNTL-L--FFTIN--DIESLTNSY-----ISSLNVF-P
A0A2M8ADX2      YE-----------ELKKSQSDIKGTS-I--FFTIN--DIENLTNNY-----ISKLNVF-P
A0A1J5B2H0      PE-----------VVFNKSGILNSDN-Y--YFIIN--NPSTNLSNY-----VRPLNIS-I
A0A1V5N756      PG------------YFKNISFIDKDD-Y--FFVLK--KPSDILSSY-----IPNLSVF-V
A0A651GU15      LE-----------ENSDKGSYNE----L--YFVIN--NPNSLVSRF-----RSNMEVR-V
A0A3Q9FR88      -------------------SPNVDNNKY--SFQFN--SKSSITNFI-----RKNISVL-I
A0A553GEX3      -------------------SPNVDNNRY--SFQFN--SKSSITKFI-----KKNISVL-I
A0A150ADJ9      -------------------SKSTINNTF--SFVVN--SRPSLVKFL-----KKNISVQ-V
A0A1B1FWQ4      -------------------NKILETNKY--SFTFN--SKASIIGFL-----KRNLSVM-I
A0A1S1Z228      -------------------NKILETNKY--SFTFN--SKSRIIGFL-----KANLSVM-I
A1ZKR2          TS-----------FYKPAFRQIP----F--YFKIN--SRQALISYL-----NNNLQVG-I
A0A1Q3GX01      TP-----------FYKKRFHNIP----F--YFKLN--SRQTLIDYL-----NKNLQVG-I
A0A349DQI4      TP-----------FYKKRFHNIP----F--YFKLN--SRESLIRYL-----NTNLQVG-I
A0A4P5TMD1      AH-----------DFKNNPNVYLSSN-Y--YFVIN--SRDNLSKDI-----RTKIRIE-L
A0A2N3IIZ0      LS-----------TYSEN---------I--YFVLN--SKGKSMNYL-----ANNLEAF-I
A0A1F3SJM1      KQ-----------LFISTSQNDD----L--YFIFN--SVQSVAERM-----RNGVTIT-P
A0A2G2EB96      PH-----------SFYQVSKENE----L--FFIFN--GREQLSNRL-----IQDLSVS-S
A0A2G6PRA9      PD-----------NFHKVSKEND----L--FFIFN--GREQLSNRL-----IKDLSVA-A
A0A497D5Z2      AN-----------YDLNNYDE------Y--FFRFR--TNESLADQY-----KKNLTIE-N
A0A662B170      AN-----------YDLNNYDE------Y--FFRFR--TNESLADQY-----KKNLTIE-N
A0A2A5FYT6      FI-----------QITTSKKQLKQND-Y--FFIIN--DVNQITEQY-----HHRLRVE-L
A0A2E6SYP1      IN-----------QNKLSDQNLK----F--LFMIN--NEKQIVNHF-----SKGLDVS-I
A0A2E5RLE8      RK-----------LNELNNSGKK----F--LVKIV--DKNQLISKY-----SKGLQVN-I
A0A2E7TQF6      RK-----------LNELNNSGKK----F--LVKIV--DKNQLISKY-----SKGLQVN-I
A0A2E6GVY9      RN-----------LNDLNDSGKR----F--LVKIV--DKSQLINNY-----SKGLSVN-I
A0A350JJ90      LD-----------EAQAQSSGLTEDR-K--YFILN--SAPTLVQKL-----SKNYSVR-I
A0A3M1CDV2      KR-----------DTTSIRKDLYNNQRT--FIIIQ--SKDAVASYL-----QKKLEVK-P
A0A6C1QGZ7      FN-----------MIREEQSLFSRNH-F--FFVLN--NPETLASVY-----SRDIKIN-V
A0A4P5U6G4      QE-----------VLKSNIESLKTGQ-F--YFVIN--NRQTVAKRI-----RDVIRI---
A0A2E2TFD1      FD-----------IIKNDQETGTRND-V--FFTLN--NNASIVNRY-----SKSLDLK-V
A0A2E4ELE6      FD-----------IIKSEQTDLSNND-F--YFRLN--SDAEIISKY-----SKSLKVK-L
A0A522EYA6      FP-----------EIQSQQNAVKGNS-Q--YFVVN--NIDALANEY-----FSRLSVK-L
A0A2E3XZI5      LE-----------EFKKNLEKSN----F--YFIIP--TIKQIKKEL-----LGGLEVN-I
A0A6I7QXV0      SA-----------AEQIHSHVGEP---Y--FFILE--NREQLISRV-----SRNIQVS-A
A0A2M7NLQ9      TF-----------DKLKSTSDS-----Y--FFTLN--SPEYQIAYI-----ASSLRAN-V
I4AFR0          TF-----------DKLQSPSSN-----Y--FFTLN--SHEYQINYI-----ASSIKAN-V
A0A2N2Y3E5      TA-----------ALLEYENMLKKDG-L--FFIVN--NPETQLNKI-----IQNLVVG-V
A0A2D9D7T6      KF-----------GITEINKNNR----L--YFVFN--KKYDVMRSL-----KKNLTVS-A
A0A1F3PPL5      YK-----------GIEELHKSLNHES-F--FFILK--NPTTLLNEH-----ISKLEIK-L
A0A357QK06      YK-----------GIEELHKSLNHES-F--FFILK--NPTTLLNEH-----ISKLEIK-L
A0A662AEA4      YK-----------RIELQQSNLKKTA-Y--SFIIN--NPDNIYLKH-----IDEIEIR-L
A0A0S2HYK8      YN-----------VIKSMYESAKQNS-Y--YFVIY--NDEQIFTEH-----SKKLNIK-L
A0A2N5ZWN6      FA-----------AIQSMYEKESQNS-Y--YFIIS--NMDQIYSEH-----SAKLTIR-L
A0A2E0FJ09      LN-----------RFYAQQNDGE----F--YFLYS--DLEKLASEF-----SAMLEVS-I
A0A1F3FZ62      KS-----------SIKTDLNADE----Y--YFIIN--NPDLIVNEH-----INQIDVS-I
A0A1F3K211      KS-----------SIKTDLNADE----Y--YFIIN--NPDLIVNEH-----INQIDVS-I
A0A1V6I2U9      KK-----------DLEQELDPQNKSQ-Y--FFTIN--NPNTTLKNL-----SKRLNVQ-I
A0A2H0B957      LA-----------AIREQSNKIKTDS-Y--YFTLN--DSETVYQKY-----SSRLEVS-L
A0A1F3CFW6      ID-----------AIRTQINKIKNDS-Y--YFIIN--DTESVYKKY-----SSQLEVS-L
A0A2M7E2T8      ID-----------AIRTQINKIKNDS-Y--YFIIN--DTESVYKKY-----SSQLEVS-L
A0A2M7NC69      ID-----------AIRTQINKIKNDS-Y--YFIIN--DTESVYKKY-----SSQLEVS-L
A0A1F3KLL5      ID-----------DLLADKQNLKQNS-F--YFIIN--NPTYLLQAY-----KANLLVE-V
A0A359D1M1      ID-----------DLLADKQNLKQNS-F--YFIIN--NPTYLLQAY-----KANLLVE-V
A0A0F2NS19      YN-----------EFGADKNNS-----M--FFAIN--DLEALTNKY-----IQQLGVF-P
A0A2A5H8X6      YN-----------EFGADKNNS-----M--FFAIN--DLEALTNKY-----IQQLGVF-P
A0A2H0GAU8      YE-----------SLKDVKNNK-----M--LFVIN--NIDDLTSRY-----ISQLNIF-P
A0A2M8FTK1      YE-----------SLKDVKNNK-----M--LFVIN--NIDDLTSRY-----ISQLNIF-P
A0A2A5B3B0      KD-----------LYVTPQGGD-----L--FFKIN--DYDKLTFAY-----IGKLAVF-P
A0A5C6RXM7      EK-----------V-TDFIGAV-----I--YFKLN--DNASLANNY-----ISKLSVF-P
A0A1F3C1M2      YN-----------AILEEHDELTKNN-Y--FFIIN--NPINIIKDN-----LLKLKVN-I
A0A1F3DS87      YT-----------AILEEHDELKKNN-Y--FFIIK--NPANIIKEN-----LDKLKIS-I
A0A6A0R6K9      IK-----------NETTAVKPIS----Y--FFIIN--DLQTLVKDV-----LSRLKIF-V
A0A2E7CT70      IP-----------TFSESLDKFN----Y--FFKIP--FFQEKRNEI-----INDLEIS-I
A0A2D5V560      -N-----------NWKDNLNSMSTNERL--FFRIP--SXNELKNSI-----LNGLTIN-I
A0A2D7K5A8      -G-----------NWKDLLSSLSSNERL--FFKIP--TKKEVINIL-----KNSLTIT-I
A0A2E1XQ82      -E-----------DWKDFLSSLSSNERL--LFKIP--NKKEVINII-----KNSLTIT-I
A0A5C8A5B4      FR---------------IKFPEDRMYDKNTKYHFEIYSLKDLVRVY-----RAMTMAVPL
A0A4Y9ITE2      FY----------------------EEGKPLNITIVVNNYNQATENL-----QDDIKCS-I
A0A5M8NYX7      SP------------WGTLTFEKNPFGTGEYPIVVVVRHPK-----Y-----IPYIQVN-P
A0A3D5KRY6      FF------------QFTISAKTGVAPQEDEEYVLIFNDLSRMALAY-----KEKLVVK-A
A0A1V5IPN7      ------------------------------------------------------------
A0A0E3V905      TF------------------------DSENPYSIQVTKRATSVKNY-----LTNLHAI-P
A0A553ETH6      FT---------------LELTEHYDENGESDYFFTINSRAQLISYF-----ERNLVVE-P
A0A640Q161      PK-------------------------ELTEEQLLAAKKRKATSLL-----MNALTVE-M
A0A640QU49      VK-------------------------TLTPEEILAAKKRKATSLL-----MKALNIE-M
A0A1Q3PII2      HG-------------LSIIDTTRFKPASHYLYSFKISTEESVLDLY-----TRVLNIY-A
A0A351BXT2      EN-----------------------------EDVTALISVSSLADI-----LSQIVKI-D
A0A2K8Z965      TA-------------------------RIKKMIVQVSKQTSAAKSY-----LSNLHVI-P
A0A418M8U8      VG------------------------DTTNQVLVQAMKRPAAVNGY-----LRTLQAE-P
I2GTA4          VG------------------------DTTNQVLVQAMKRPAAVNGY-----LKTLQAE-P
A0A2K8ZAJ2      LS------------------------SKLKPIFATVSLHNDAVEGY-----LGNLKIG-S
A0A368JPA3      VV------------------------YTNEPLVVQVMSPAQTIRYY-----QSKLTVA-P
A0A5N1JI29      VV------------------------YTNEPLVVQVMPQAQTIRYY-----QSKLTVA-P
A0A3P1BT12      VV------------------------YSNEPLIVQVMEHPQAIRYY-----LSKLNVE-P
A0A3P1CI15      VV------------------------YSNEPILVQVMTDPQAIRYY-----LSKLTVE-P
A0A4R8CUK1      VD------------------------YANEPVSVQVMPDLEAIEYY-----LGKLQVE-P
A0A3D0MYJ7      AP----------------------------------------------------------
A0A662AH13      PA------------IAKMLEDTKIEQK---------------------------------
A0A5C7QA01      NR------------MGLWTVEINSKDIQSGLYNIRKQSLPNAIKSL-----SANYAVA-E
A0A3D3LS70      QK----------------------------------------------------------
A0A1G1TM36      LG------------TWQLNATASLRGFEGGEVRIRTSSPEAVVQAY-----QKLLDIE-L
A0A1G7ZF38      HG-------------AAIMDTTRFKPSSHYQYSFKISATETILDHY-----DRVLRIQ-A
C6VS52          QG------------VAVIVDTTRFKPSALYQYSFRTLAKETVVDHY-----ARTLSIQ-A
A0A2A4G4B1      INALK-----------------------GQSYQIYCTPISKTVNQI-----INNLQIN-P
A0A0P7X1V8      FA------------------------------------------RL-----YGNLTFT-R
A0A5C8KAD6      ML-----------------------FAATNPLYFTLQDPRKVTDQL-----VAKLTIV-P
A0A5N1J695      QS-----------------------AAPIGPLYFSLIPTRQVTDGL-----LANLKIE-P
A0A1H4ADG3      TN----------------------DWDGSQNIKMDVSSINAVADGF-----KENINAE-I
A0A5B8VUR8      MS----------------------SWDPARSIKMAVASINAVADSY-----KENINAD-I
A0A3N2M1H3      Y---DGLPITE-----------------SIELKVVKKPMQTTVENY-----GEKLNGD-L
A0A4S2G8T2      Y---DGLPITE-----------------SIELKVVKKPMQTTVENY-----GEKLNGD-L
A0A1T5K9D4      LG--K-HWFGE-------------------AIYIQKIPVSQAAAAY-----SSALSIS-Q
A0A077ENE7      YK--K-DYYGV-------------------EIQVAKSPREAVMSNF-----VGNLSIK-Q
A0A6I5UW06      YK--K-DYYGV-------------------EIQVAKSPREAVMSNF-----VGNLSIK-Q
T0NN57          YG--T-DFYGK-------------------DIQVTKYPREAMMENF-----KGKMKIA-Q
X5K347          YG--T-DFYGK-------------------DIQVTKYPREAMMENF-----KGKMKIA-Q
A0A212K7W5      YS--KVYYNQQ--------------------ILFVKSNLRSIVNHY-----TNALNVG-L
F5IU11          YS--KGYYDQK--------------------ILFTKFNLRGIVNNY-----TNALNVG-L
A0A6I1IYY4      NL-----STYI-----------------GKPVLVKRMSPEAATAIY-----KGGISTS-L
K0XJ09          KI-----SAYY-----------------NVPVEVSRIDLNTAANIY-----HSFISTS-L
R5EUZ0          KI-----SAYY-----------------NVPVEVSRIDLNTAANIY-----HSFISTS-L
W0EQS0          YL-----PAYY-----------------NIPVEVSRISLDAASGMY-----HA--SAS-L
A0A1Y3WE15      FL-----PNYY-----------------TLLIEVSRMDLNTAANIY-----HSLISAA-L
A0A1Y4GUK3      FL-----PAYY-----------------NVPVEVSRMDLNTAADIY-----HSLISAA-L
A0A352Z1R7      EK-------GD-------------------NFRLKLLPLQNIAVSL-----KGGFKAT-E
A0A3N2N6F7      FS--P----DF-----------------DHDIRFSYWPMPTAISKY-----QAKLTET-L
A0A4P7VVU7      YA--K----RF-----------------GNTIKIFRYSISDAIEAY-----KARLSEN-L
A0A2V1ILM4      YA--K----RF-----------------GNTIKIFRYSISDAIEAY-----KARLSEN-L
A0A3N2L0E8      YA--K----RF-----------------GNTIKIFRYSISDAIEAY-----KARLSEN-L
A0A3N2LFC5      YA--K----RF-----------------GNTIKIFRYSISDAIEAY-----KARLSEN-L
A0A0A2F501      YL--ADKSKTR-----------------PSQIYVSYQNLYNVQELY-----SSGLKAS-I
R5B7P0          YS--G-EAMKK-------------------PVNVRKSGQRGVTQSY-----LNRLQVN-L
R5B0L5          GN--P---SGM-------------------TIYVTKMPLQTAASIF-----SGRLTVA-L
A0A6I1TEC0      YA--AFIKGSD-----------------APALYVSHTDLYSMTNRI-----LGSLTVG-L
A0A3R5XWG1      YA--AFIKGGD-----------------APALYVSHTDLYSMTNRI-----LGSLTVG-L
A0A646GTR1      YA--AFIKGGD-----------------APALYVSHTDLYSMTNRI-----LGSLTVG-L
A0A5P0Y910      YA--AFIKGGD-----------------APALYVSHTDLYSMTNRI-----LGSLTVG-L
A0A414YFM3      YA--AFIKGGD-----------------APALYVSHTDLYSMTNRI-----LGSLTVG-L
A0A6A7UIA7      YA--AFIKGGD-----------------APALYVSHTDLYSMTNRI-----LGSLTVG-L
A0A6A7VPS3      YA--AFIKGSD-----------------APALYVSHTDLYSMTNRI-----LGSLTVG-L
A0A374THP7      YS--QFVKNGD-----------------APVLYVSRSNIYAMTDRI-----KGSLAAS-L
A0A6G1VND1      YT--QFVKNGD-----------------APVLYVSRSNIYAMTDRI-----KGSLAAS-L
A0A0A2EVS5      YS--DEKSIQT-----------------PMTIHVSRSNLSTTMAEC-----QKRLQVG-L
A0A1T4NAJ7      YS--DEMSIQT-----------------PMTIHVSRSNLSTTMAEC-----QKRLQVG-L
A0A255T941      AR--E-DFIGE-------------------KITYSKQNIDDLADAL-----STKLVAE-L
A0A3N2KCL3      YK--P--GEAV-------------------ELEVVKAPVSATAGGY-----GSRMVIA-M
A0A4P7VSV0      YK--P--GEAV-------------------ELEVVKAPVSATAGGY-----GSRMVIA-M
A0A2V1IJY1      YK--P--GEAV-------------------ELNVVKAPVSATAGGY-----ESRMVIA-M
A0A4P7VXK7      YK--P--GEAV-------------------ELNVVKAPVSATAGGY-----ESRMVIA-M
A0A1Y4CHN5      YS--G--TFDS-------------------DVYVSRSTIYGAVQSY-----SQRLSVG-L
A0A1M6I2S6      WN--D-SFVGT-------------------SIRYNKGSVRAVTDYY-----ATALRAD-L
A0A1Y3V692      WN--D-SFVGT-------------------SIRYNKGSVRAVTDYY-----ATALRAD-L
F3PXM2          AT--D-DFMGT-------------------SIHYGKQSVQAVTDYY-----TGALRAE-L
A0A3E4ZNL4      YN--D-SFIGS-------------------TIHYSKNSADKVADNY-----AQALRAE-L
A0A174AHH7      YE--N-SFTGS-------------------TIQYSKEPADAVADSY-----TQKLRAD-L
A0A174JCE8      YE--N-SFTGS-------------------TIQYSKEPADAVADSY-----TQKLRAD-L
A0A3E4JMC4      YE--N-SFTGS-------------------TIQYSKEPADAVADSY-----TQKLRAD-L
A0A412SND6      YE--N-SFTGS-------------------TIQYSKEPADAVADSY-----TQKLRAD-L
A0A414IEQ9      YE--N-SFTGS-------------------TIQYSKEPADAVADSY-----TQKLRAD-L
A0A415UKN5      YE--N-SFTGS-------------------TIQYSKEPADAVADSY-----TQKLRAD-L
A0A6I0U0V8      YE--N-SFTGS-------------------TIQYSKEPADAVADSY-----TQKLRAD-L
A0A6I2PDH7      YE--N-SFTGS-------------------TIQYSKEPADAVADSY-----TQKLRAD-L
A0A0M1W8D8      YE--N-SFTGS-------------------TIQYSKEPADAVADSY-----TQKLRAD-L
A0A3R6GKX5      YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A7V4S1          YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
B0NU19          YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
D4V601          YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A0A4Q0U3M9      YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A0A4R4H1Q2      YE--I-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A0A6I0GII7      YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A0A6I0KYU7      YE--I-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A0A397WLT5      YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A6KY94          YE--N-SFTGS-------------------TIRYSKESADMMADSY-----TQKLRAE-L
A0A173UQR8      YE--N-SFTGS-------------------TIRYSKESADMMADSY-----TQKLRAE-L
A0A3R6HK75      YE--N-SFTGS-------------------TIRYSKESADMMADSY-----TQKLRAE-L
A0A412B7D1      YE--N-SFTGS-------------------TIRYSKESADMMADSY-----TQKLRAE-L
A0A412VNY9      YE--N-SFTGS-------------------TIRYSKESADMMADSY-----TQKLRAE-L
A0A414LTU9      YE--N-SFTGS-------------------TIRYSKESADMMADSY-----TQKLRAE-L
I9Q4U4          YE--N-SFTGS-------------------TIRYSKESADMMADSY-----TQKLRAE-L
A0A6A2J529      YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A0A3R6GM96      YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A0A015XH67      YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A0A078RZN2      YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A0A4R4I3T9      YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A6L0K5          YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A7ACT5          YE--N-FFTGS-------------------TIQYSKEPADMVADSY-----TQKLWAE-L
A0A373ISF0      YS--D-ACIGT-------------------SIRYAIGKADGAADRY-----LNALRVE-L
U6RF62          YS--D-ACIGT-------------------SIRYAIGKADGAADRY-----LNALRVE-L
A0A662ZZD5      WN--D-SFVGT-------------------SIRYRKGNVCAVTDYY-----TAALHAE-L
A0A3A5TI83      WN--D-SFVGT-------------------SIRYRKGNVCAVTDYY-----TAALHAE-L
A0A415NEB6      WN--D-SFVGT-------------------SIRYRKGNVCAVTDYY-----TAALHAE-L
A0A6I0I238      WN--D-SFVGT-------------------SIRYRKGNVCAVTDYY-----TAALHAE-L
A7AJ60          WN--D-SFVGT-------------------SIRYRKGNVCAVTDYY-----TAALHAE-L
A0A6A2JF01      WN--D-SFVGT-------------------SIRYRKGNVCAVTDYY-----TAALHAE-L
A0A6I0Y2Y2      WN--D-SFVGT-------------------SIRYRKGNVCAVTDYY-----TAALHAE-L
A0A6I2Q447      WN--D-SFVGT-------------------SIRYRKGNVCAVTDYY-----TAALHAE-L
A0A395YYT3      WN--D-SFVGT-------------------SIRYRKGNVCAVTDYY-----TAALHAE-L
A0A015UXN7      WN--D-SFVGT-------------------SIRYRKGNVCAVTDYY-----TAALHAE-L
A0A5M5W148      WN--D-SFVGT-------------------SIRYRKGNVCAVTDYY-----TAALHAE-L
A0A6I2NTL0      WN--D-SFVGT-------------------SIRYRKGNVCAVTDYY-----TAALHAE-L
A0A016E4F9      WN--D-SFVGT-------------------SIHYNKGSVNAVTDYY-----TQNLRAE-L
A0A4Q5CFJ7      WN--D-SFVGT-------------------SIRYNKGSVRAVTDYY-----ATGLRAD-L
A0A6H9P0U9      FT--D-AFIGT-------------------SIRYVRGSVRAAVDTY-----SNALVAE-L
A0A108TH71      FT--D-VFIGT-------------------SIRYVRGSVRAAVDTY-----SNALVAE-L
I8VXH0          FT--D-VFIGT-------------------SIRYVRGSVRAAVDTY-----SNALVAE-L
A0A412S0N6      FT--D-VFIGT-------------------SIRYVRGSVRAAVDTY-----SNALVAE-L
A0A412IIJ0      FT--D-AFIGT-------------------SIRYVRGSMRAAVDTY-----SNALVAE-L
A0A0P0FM97      FT--D-AFIGT-------------------SIRYVRGSVRAAVDTY-----SNALVAE-L
R6KTP3          FT--D-AFIGT-------------------SIRYVRGSVRAAVDTY-----SNALVAE-L
A0A139LU87      FT--D-AFIGT-------------------SIRYVRGSVRAAVDTY-----SNALVAE-L
A0A1C6B3Y5      FT--D-AFIGT-------------------SIRYVRGSVRAAVDTY-----SNALVAE-L
E2NMQ4          FT--D-AFIGT-------------------SIRYVRGSVRAAVDTY-----SNALVAE-L
A0A412YDB9      NA--N-AFIDT-------------------PIQYVRGSVSAAADTY-----ANTLVAE-L
R7DY01          NA--N-AFIDT-------------------PIQYVRGSVSAAADTY-----ANTLVAE-L
A0A414LGK8      NA--D-AFINT-------------------PIQYVRGSVSATADTY-----ANALVAE-L
A0A415IPQ4      FT--D-AFTGT-------------------SILYSRGSVRAAADTY-----ANALVAE-L
A0A3E5BRW7      FT--D-ALTDT-------------------PVRYARRSVRDVADAY-----TRELVAE-L
K9DXS6          FT--D-ALTDT-------------------PVRYARRSVRDVADAY-----TRELVAE-L
A0A1M6KFV3      PS--D-AFMGV-------------------PIRYVRRNVRSVSDAY-----AKELVAE-L
A0A1Q6G7L3      SS--D-AFMGV-------------------PIRYVRRSVRSVSDAY-----AKELVAE-L
A0A413H235      SS--D-AFMGV-------------------PIRYVRRSVRSVSDAY-----AKELVAE-L
A0A1M5B2J8      YR--K--GQET-------------------EIEVIRSTIKGAVGDA-----SSRLSVV-Q
A0A255RCT5      YR--K--GQEA-------------------DVEVLRSTLKEAVAGA-----SSRLTVS-Q
A0A1Y4GLF5      YV--D--A-PC-------------------TLYVDRSTLYSAVNAY-----SANLSVS-L
A0A1H3XSC0      YK--S--KEPY-------------------TLYVFRSSLHGTVGQY-----SSNLSVA-L
A6LE40          YV--K--GEAY-------------------ILYISKSSLYNAVNSY-----SSNLSIS-L
A0A4Y1VPX5      YV--K--GEAY-------------------TLYVGKSSLYNAVNSC-----SSNLSVS-L
B3JI46          YV--K--GEAY-------------------TLYVGKSSLYNAVNSC-----SSNLSVS-L
R6NN15          FV--DWQKSSE-------------------PLTVSRSGLNSAVSRY-----SAGLSVA-L
A0A358R8U0      YD--I--DRGC-------------------QLKVSRTGLYGAVGSY-----SGNLTVT-L
R6WSB6          YD--I--DRGC-------------------QLKVSRTGLYGAVGSY-----SGNLTVT-L
A0A401LPX7      YS--G--KTES-------------------TIYVTRQSLSAASAGC-----SANLTIS-Q
A0A6I0J0P8      YS--D--KTEE-------------------VIYVSRQSLAATSANC-----SARLNIS-Q
A0A6I1BFM0      YS--D--KTEE-------------------VIYVSRQSLAATSANC-----SARLNIS-Q
A0A6G0GNY9      YS--D--KTEE-------------------VIYVSRQSLAATSANC-----SARLNIS-Q
A0A3A5Z900      YS--G--KIES-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
A0A285TGL6      YS--D--KTVS-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
A0A3A5RFX4      YS--D--KTVS-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
A0A1Q6IUW9      YS--D--KTVS-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
A0A3R6NPG7      YS--D--KTVS-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
A0A413XDP6      YS--D--KTVS-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
K6AP24          YS--D--KTVS-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
A0A6I2NHV3      YS--D--KTVS-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
A0A662ZYI7      YS--D--KTVS-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
A0A078RYI7      YS--D--KTVS-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
C7XEQ8          YS--D--KTVS-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
D7INX6          YS--D--KTVS-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
K5ZG55          YS--D--KTVS-------------------TIYVTRQSLSAASAGC-----SARLNIS-Q
A0A3N2N9B8      YL--P----KQ-----------------PIALKVNRLPLDAARASY-----SSRLSVT-Q
A0A3N2NMI0      YT--P----GT-----------------AIELEVNKIPVKTAQAIY-----SSHLGVS-Q
A0A359I8H7      YTAPKGKKNKP-----------------VTKIIVERDGMQSTVETY-----GGLVKAD-L
A0A3N2KA63      YTAPKGKKNKP-----------------VTEIIVERDGMQSTVETY-----SGLVKAD-L
A0A4Q0IMT7      YTAPKGKKNKP-----------------VTEIIVERDGMQSTVETY-----SGLVKAD-L
A0A3B9FAU3      YG--SFVT-HT-----------------KDPILVTRTDLYTKTEGV-----QRNLSVE-L
A0A3C1E5L7      YG--SFVT-HT-----------------KDPILVTRTDLYTKTEGV-----QRNLSME-L
A0A4Q0UAV1      FT--KEYINEP-----------------VTFIHNTPEAL---AASF-----SGNITFE-L
A0A354SN68      FD--K---AFI-----------------TSTICVRKCNITSATERV-----QRMYLAT-G
A0A3N2N595      YK--P----GD-----------------LIDLEIDKKPLGWAVATY-----LGNLMVS-L
A0A0A2DUD9      DD--L----DL-----------------VNGLIIKRSSLYDAVENL-----GKNLTVN-L
A0A3P1ZBJ5      FE--L-----L-----------------KKSIQVVKYPLSDVVD-Y-----FGRINVE-L
R5FHS9          YN--S-WPGGL-----------------YANLYVTHVPMMSAMSSY-----QKGLSVS-L
A0A413TW79      YS--AFVNGYE-----------------SRKLHVTRTNLYAMTDHI-----KASLSAS-I
A0A3E5E9M7      YS--AFVNGHE-----------------SRKLHVTRTNLYAMTDHI-----KASLSAS-I
A0A3E4SK73      YS--AFVNGHE-----------------SRKLHVTRTNLYAMTDHI-----KASLSAS-I
A0A415GGC6      YS--AFVNGYE-----------------SRKLHVTRTNLYAMTDHI-----KASLSAS-I
A0A413DBH9      YS--AFINGHE-----------------SRKLHVTRTNLYAMTNHI-----KASLSAS-I
A0A1Y4PQK7      YV--R----GT-----------------EYKVRVVRSGLYGAVRTC-----SSRLSVA-L
A0A1Y4IH41      YV--R----GT-----------------EYKVHVVRSGLYGAVGTC-----SSRLSVA-L
A0A3A6AAP4      YV--R----GT-----------------EYKVHVVRSGLYGAVGTC-----SSRLSVA-L
A0A6I0ZRD2      YV--R----GT-----------------EYKVHVVRSGLYGAVGTC-----SSRLSVA-L
A0A1Y4DYA7      IK--D----FK-----------------ET-VYISHSGLQATTSVY-----SGKLTVA-L
A0A1Y3X4I9      AE--T----WK-----------------EA-VYVSRSGLQSTAAAY-----SDKLNVA-L
A0A1Y4FNK8      TV--T----YQ-----------------EP-VYVTRISYQAATSAY-----ASNLSVA-L
A0A355FD59      YT--N----ET-----------------SPLIYVSRTNLYSATNAC-----KEALTIS-L
A0A359CEZ9      YT--N----ET-----------------SPLIYVSRTNLYSATNAC-----KEALTIS-L
A0A353Q7B4      YT--N----ET-----------------SPLIYVSRTNLYSATNAC-----KEALTIS-L
F8X3A5          YT--K----TE-----------------MPLIYISRTNLYSATDLF-----KQNLTAS-L
A0A1M3KVR9      YT--K----NE-----------------MPLIYISRTNLYSATDLF-----KQNLTAS-L
A0A4Y9IJS3      YT--K----NE-----------------MPLIYISRTNLYSATDLF-----KQNLTAS-L
A0A495WI87      YT--S----QF-----------------SQPIYVSCSSLYSAVRRY-----APNLSVV-L
A0A354M4S6      YT--S----QF-----------------SQPIYVSRSGLYSAVRRY-----APNLSVV-L
R7DH52          YT--S----QF-----------------SQPIYVSRSGLYSAVRRY-----APNLSVV-L
A0A4Q5E7L5      YV--K----GE-----------------AYTLYVGKSSLYSAVNNC-----SSNLSVS-L
A0A4P8LP09      YV--E----GE-----------------AYTLYVDKSGLYNAVNSC-----SSNLSVS-L
A0A4R4GZU7      YV--E----GE-----------------AYTLYVDKSGLYNAVNSC-----SSNLSVS-L
A0A016CWA4      YV--E----GE-----------------AYTLYVDKSGLYNAVNSC-----SSNLSVS-L
A0A1C6H117      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A0M1W0V2      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A139KA16      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A174VQ92      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A1Q6HCG0      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A1Y4JYM9      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A3A5QW67      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A3A5RQE6      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A3A6BP07      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A3E5E153      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A3Q9IP20      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A412WV15      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A413ICP6      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A414KYB9      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A5B3FWR2      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A6I0WNS4      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
E5WX00          YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
K0X3P3          YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A415TAH7      YV--K----GE-----------------TYTLYVGKSSLYDAVNSC-----SSNLSVS-L
A0A078T2W6      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A6I1AQV4      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A5C6L2P1      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A412MJT7      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A3E4WKT5      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A3A5YY33      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A078TAH2      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A1E9CFZ7      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A373FYU5      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A3A5TZ72      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A3A5XBP2      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A3A6MEG9      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A3E4JP35      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A3E4KP40      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A3E4NX82      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A3E4XFU8      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A412RG70      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A412TD37      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A413GAA4      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A414M7I4      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A496BTA0      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A496D2V6      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A4Q5G1P5      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A5C6KCA6      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A5M5AHM5      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A6I0KZV6      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A6I0Y5K7      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A6I1BFB8      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A6I2P5W5      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
E5UZA2          YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A069SMG6      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
C3RFN5          YV--K----GK-----------------AYTLYVGKSNLYNAVNSC-----SSNLSVS-L
A0A3A5Z014      YV--K----GE-----------------SYILYIDKSSLYNAVNSC-----SSNLSVS-L
A0A6I0ING7      YV--K----GK-----------------AYTLYVGKSNLYNAVNSC-----SSNLSVS-L
A0A6I2P894      YV--K----GK-----------------AYTLYVGKSNLYNAVNSC-----SSNLSVS-L
A0A078S3Q8      YV--K----GK-----------------AYTLYVGKSNLYNAVNSC-----SSNLSVS-L
A0A069SJV7      YV--K----GK-----------------AYTLYVGKSNLYNAVNSC-----SSNLSVS-L
A0A3E5DXI5      YV--K----GK-----------------AYTLYVGKSNLYNAVNSC-----SSNLSVS-L
A0A3E5EM98      YV--K----GK-----------------AYTLYVGKSNLYNAVNSC-----SSNLSVS-L
A0A3E5F453      YV--K----GK-----------------AYTLYVGKSNLYNAVNSC-----SSNLSVS-L
I9T3G6          YV--K----GK-----------------AYTLYVGKSNLYNAVNSC-----SSNLSVS-L
A0A3E4SYU0      YV--K----GE-----------------SYTLYVGKSNLYNAVNSC-----SSNLSVS-L
A6LGY1          YV--K----GK-----------------AYTLYVGKSNLYNAVNSC-----SSNLSVS-L
K5ZSH4          YV--K----GK-----------------AYTLYVGKSNLYNAVNSC-----SSNLSVS-L
A0A6A2RTB3      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A6I0VY00      YV--K----GE-----------------AYTLYVGKSSLYNAVNSC-----SSNLSVS-L
A0A1M4YZ07      YV--K----GK-----------------AYTLYVGKSNLYNAVNSC-----SSNLSVS-L
A0A4Q5E5M7      YV--K----GE-----------------AYTLYIGKSSLYNAVNSY-----SSNLSVS-L
A0A0P0FQW1      YV--K----GE-----------------AYTLYIGKSSLYNAVNSY-----SSNLSVS-L
A0A5M5C0W6      YV--K----GE-----------------AYTLYIGKSSLYNAVNSY-----SSNLSVS-L
A0A6I0H151      YV--K----GE-----------------AYTLYIGKSSLYNAVNSY-----SSNLSVS-L
A0A6I0HI59      YV--K----GE-----------------AYTLYIGKSSLYNAVNSY-----SSNLSVS-L
A0A642LZ22      YV--K----GE-----------------AYTLYIGKSSLYNAVNSY-----SSNLSVS-L
A0A6I0IP89      YV--K----GE-----------------AYTLYIGKSSLYNAVNSY-----SSNLSVS-L
A0A642NJ89      YV--K----GE-----------------AYTLYIGKSSLYNAVNSY-----SSNLSVS-L
A0A6I0HI52      YV--K----GE-----------------AYTLYIGKSSLYNAVNSY-----SSNLSVS-L
A0A6I0YVB5      YV--K----GE-----------------AYTLYIGKSSLYNAVNSY-----SSNLSVS-L
A0A6G0G4T5      YV--K----GE-----------------AYTLYIGKSSLYNAVNSY-----SSNLSVS-L
A0A6I0HFG9      YV--K----GE-----------------AYTLYIGKSSLYNAVNSY-----SSNLSVS-L
A0A416GA42      YQ--KFDREL--------------------EIEVLKSTVRNTGNAL-----VARLGVA-K
A0A1T3IYP5      YK--D-YYGT--------------------DVFVAKYPREVIMSQF-----VANLKIK-Q
A0A3P1Z8V4      FR--RFPKGT--------------------PIVVHHYSNEIAARIY-----KKALTAA-E
A0A060RD97      SA--EKFVGK--------------------EVNVAVTSVAKAQLDF-----SSRLTVA-R
A0A3C1ITV0      YG--KNFEQ---------------------AVIVGYERPELTAKSC-----QARLTAE-L
R7HN19          YG--KNFEQ---------------------AVIVGYERPELTAKSC-----QARLTAE-L
A0A350IHV0      ID--KWHD----------------------PIVVSWVNAKRLAKAY-----CKKLNVS-L
R5RVP0          ID--K--WKK--------------------PMRVSWVNSAKLAKAY-----CKGVTVA-L
R6A0L2          F---GRWTDE--------------------TIEVDRLSKEKAAARF-----LKMLSAS-E
R7LG80          F---NKWEDE--------------------EITVNRNSVSATADAL-----RKRMDVA-Q
A0A2L2WX98      ID--KMPTGE--------------------TVTVTRLPKKMAAASY-----CKQFSAGEY
A0A285T4L1      WG--QAWTER--------------------DIRVSKNPLNAVAGRF-----QGSMGIR-Q
G5GD56          FS--RFPVGK--------------------TIQIHHLPIEMAAKIY-----QEKIKAS-A
R5KD55          YP--SAVADND-------------------EIDVRKSDNASATGRF-----LGGLSVE-I
A0A174QNT3      YV--RLYIGK--------------------DVLVTRSDLETVTNSM-----MERIQTS-A
A0A4S2FGS1      SI--PHYQGK--------------------EIRVTRSDLESATNAV-----MGRIQTS-A
R9I0H0          SI--PHYQGK--------------------EIRVTRSDLESATNAV-----MARIQTS-A
K5BUT9          NL--SAYLSQ--------------------PISVSRISPEIATNIY-----QSKIATS-L
A0A174FPA3      NL--SAYLSQ--------------------PISVSRISPEIATNIY-----QSKIATS-L
R6S9Y6          NL--SAYLSQ--------------------PISVSRISPEIATNIY-----QSKIATS-L
A0A642LIH6      NL--SAYLSQ--------------------PISVSRISPEIATNIY-----QSKIATS-L
C9KX15          NL--SAYLSQ--------------------PISVSRISPEIATNIY-----QSKIATS-L
A0A6H0KRK1      NL--SAYIGK--------------------PVSVTRISPETAAAIY-----KGGISTS-L
R6DAG6          NL--SVYIGK--------------------PVSVTRISPETAAAIY-----KGGISTS-L
A0A3L8AAP1      NL--SAYIGK--------------------PVSVTRISPETAAAIY-----KGGISTS-L
A0A4S2AYX2      NL--SAYIGK--------------------PVSVTRISPETAAAIY-----KGGISTS-L
A0A4Y9H477      NL--SAYIGK--------------------PVSVTRISPETAAAIY-----KGGISTS-L
A0A0E2M2Y7      FA--DSWKGG--------------------ILYVTKENIRKVIQRY-----NKDLQIS-L
A0A0K2J6Z0      FA--DSWKGG--------------------ILYVTKENIRKVIQRY-----NKDLQIS-L
B2RKZ8          FA--DSWKGG--------------------ILYVTKENIRKVIQRY-----NKDLQIS-L
A0A212GC82      FA--DSWKGG--------------------ILYVTKENIRKVIQRY-----NKDLQIS-L
A0A254MU12      FA--DSWKGG--------------------ILYVTKENIRKVIQRY-----NKDLQIS-L
R6CQ93          WS--KSWVGR--------------------DIHVSKIPLNAAAGRF-----LGSMGIR-Q
A0A3D1NQW3      MS--PDYYEKA-------------------PIRVTKGNLGVVTQFY-----QHEVKSF-V
B0MT10          MS--PDYYEKA-------------------PIRVTKGNLGVVTQFY-----QHEVKSF-V
R7JGW9          MS--PDYYEKA-------------------PIRVTKGNLGVVTQFY-----QHEVKSF-V
A0A3D2BF46      MS--DDYFGD--------------------PISVSKQIVSSVASGY-----NKRIAIE-L
A0A358R538      LT--PAYEGV--------------------PVRVRKRSLGSATSAY-----RNAVKCD-V
A0A1Y4AAB8      LS--PADEGT--------------------AIQVAKSSLEAATSAY-----RAAVKCA-V
A0A1Y3WWY9      MN--PKFNGV--------------------PIRVGKSSLKALTDTY-----RGAIKCD-V
A0A1Y4U5L4      MN--PEFNGV--------------------PIRVGKSSLKALTDAY-----RGAIKCD-V
A0A1Y3VCJ1      ME--PSYRET--------------------PIRVSKGDLKTIANMY-----RGAVKCE-V
A0A1Y3QTW7      MD--STYVDR--------------------PITVTKSSPMVTTNAY-----RATVKSD-V
R6XWY7          MD--STYVDR--------------------PITVTKSSPMVTTNAY-----RATVKSD-V
A0A4Y1X9Y9      MD--STYVDR--------------------PITVTKSSPMVTTNAY-----RATVKSD-V
A0A4Y1WM66      MD--STYVDR--------------------PITVTKSSPMVTTNAY-----RATVKSD-V
A0A174AVF1      MD--STYVDR--------------------PITVTKSSPMVTTNAY-----RATVKSD-V
A0A656Q4F4      MD--STYVDR--------------------PITVTKSSPMVTTNAY-----RATVKSD-V
A0A1Q6EIY0      MD--STYLKK--------------------PITVIKNSLAATTNAY-----RAAVKSD-V
A0A5B5VN71      MD--STYLKK--------------------PITVIKNSLAATTNAY-----RAAVKSD-V
E4M8L3          MD--STYLKK--------------------PITVIKNSLAATTNAY-----RAAVKSD-V
I3YQ50          MD--STYLKK--------------------PITVIKNSLAATTNAY-----RAAVKSD-V
R5UEY8          MD--STYLKK--------------------PITVIKNSLAATTNAY-----RAAVKSD-V
A0A1H4D866      MK--PEYTGV--------------------PIRVVKNSLSRTTNAY-----RNAVKSD-V
A0A5B3G4Y7      MA--PDYIGV--------------------PIRVTKSSLGRTTNAY-----RAAVKSD-V
A0A374A9J5      MA--PDYIGV--------------------PIRVTKSSLGRTTNAY-----RAAVKSD-V
A0A5B3GQN5      MA--PDYIGV--------------------PIRVTKSSLGRTTNAY-----RAAVKSD-V
A0A1Q6E9S3      MA--PDYIGV--------------------PIRVTKSSLGRTTNAY-----RAAVKSD-V
D4IJ36          MA--PDYIGV--------------------PIRVTKSSLGRTTNAY-----RAAVKSD-V
A0A414Q925      TD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
A0A415PUS9      TD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
A0A108TCU0      TD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
A0A413BA42      TD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
S3Y344          TD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
A0A4Q5G8Y8      TD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
A0A412TGL3      TD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
A0A413VJ33      MD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
A0A414L0W6      TD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
A0A412DP39      TD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
A0A413ZSE8      TD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
B0NP84          TD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
R6AK43          TD--ENSIGK--------------------TVYVTKGNMKEVAESY-----NKALNVG-V
A0A412N2D9      TN--ESYIGK--------------------SVYVAKGNLKEVAEEY-----NKALNAG-V
A0A1Y4JYS9      TN--ESYIGK--------------------SVYVAKGNLKEVAEEY-----NKALNAG-V
R6LHA4          TN--ESYIGK--------------------SVYVAKGNLKEVAEEY-----NKALNAG-V
A0A3E5HPT8      YS--ESYFDR--------------------PIKVTSKSREGMVAFW-----LSNLTIR-Q
C6IJ48          YS--ESYFDR--------------------PIKVTSKSREGMVAFW-----LSNLTIR-Q
Q8A3U2          YS--ESYFDR--------------------PIKVTSKSREGMVAFW-----LSNLTIR-Q
A0A3R6S1H6      YS--KMYYSV--------------------PVTVTKYNLLQVAKAC-----NAGLRAY-L
A0A3R6SD81      YS--KMYYSV--------------------PVTVTKYNLLQVAKAC-----NAGLRAY-L
A0A354WXN6      YS--ERYWNK--------------------DISINKRAASAVTNAY-----QAALNAS-L
R5IP14          PL--TKFKKK--------------------VITVNKRRLKDATTRY-----RRAVSVS-L
A0A316SZX7      FD--S--WKN--------------------EIKISKNPVKAVAASY-----KGRMNVS-L
A0A1Y4AIY1      YT--DTYYNK--------------------EVHVRKSNLKGIATGY-----QNALVSE-L
A0A0J6CIR2      YA--DKYFGK--------------------AVTISKRNREEIALTY-----SNSLQVA-L
A0A3D8HG59      YT--TAYFGT--------------------PVRVTKSDLDETVLHF-----NRILQVA-L
A0A3R6S408      YT--TAYFGT--------------------PVRVTKSDLDETVLHF-----NRILQVA-L
F3ZRU7          LG--KAYEGE--------------------TIQIHHRGLKNVTLGY-----GNAIQIA-L
A0A1C5Q1F3      YT--QDYYQV--------------------PVTVNKMNLEKVGMAY-----NAALQSM-V
R7A239          YT--QDYYQV--------------------PVTVNKMNLEKVGMAY-----NAALQSM-V
A0A3R6HIK7      YA--DNYYNI--------------------PIQVTKSRLKSVAKRY-----QSALQST-L
K5ZVW7          YA--DNYYNV--------------------PIQVTKSRLKSVAKRY-----QSALQST-L
A0A1Y4D5Z0      YT--DLCYGK--------------------SITVRKSNLSNVARAY-----LNKLQST-V
A0A413VXJ7      YS--DNFYEK--------------------PISVTKSNMERVVDAY-----QSSMEVS-L
I9RSN9          YS--DNFYEK--------------------PISVTKSNMERVVDAY-----QSSMEVS-L
U6RJK5          YS--DNFYEK--------------------PISVTKSNMERVVDAY-----QSSMEVS-L
A0A1Q6GA32      YS--DNFYEK--------------------PISVTKSNMERVVDAY-----QSSMEVS-L
I9RPU6          YT--DAFYGK--------------------PVNVVKSNLESVIEGY-----RGRLKVS-L
I8YFS5          YT--DTYYGN--------------------PVFVTKANMEKVVEGY-----QSKMKIS-L
A0A6H9LTF8      YT--DTYYGK--------------------PVYITKSNMEKVVEGY-----LRRINIS-L
I8Y597          YT--DTYYGK--------------------PVYITKSNMEKVVEGY-----LRRINIS-L
A0A1Q6GBF5      YT--DVFYDK--------------------PVHVTKSNMESVVENY-----RNRLKVS-L
I8YFZ3          YT--DVFYGR--------------------SVNVVKFNMESVVESY-----RNKLKVS-L
A0A6H9M1J1      YT--DVFYGK--------------------PVSVVKSNLESVIEGY-----RTRLKVS-L
A0A1Q6GDH2      YT--DAFYGK--------------------PVNVVKSNLESVIEGY-----RGRLKVS-L
U6RSB0          YT--DVFYGK--------------------PVNVIKSNLESVIEGY-----RARLKVS-L
I9GXM2          YT--DVFYGK--------------------PVNVVKSNLESVIEGY-----RGRLKVS-L
I9SIK1          YT--DVFYGK--------------------PVNVVKSNLEGVIEGY-----RGRLKVS-L
A0A6H9LZ74      YT--DVFYGK--------------------PVNVVKSNLEGVIEGY-----RGRLKVS-L
I9TP59          YT--DVFYGK--------------------PVNVVKSNLEGVIEGY-----RGKLKVS-L
R5S343          YN--KNDLNR--------------------TVMIEKNIVSDVVDAY-----RERMRIE-L
A0A1M6K7I9      YT--NEYYGD--------------------KILVQKFVTERVVDDC-----MATLSVS-L
A0A5M6A8C8      YT--NEYYGD--------------------KIQVQKSVTERVVDDC-----MTTLSVS-L
A0A6H9LT84      YT--DAFYAK--------------------PIYVVKSNMEKVVEGY-----QNRIKIS-L
A0A6H9LUV5      YT--DTFYDN--------------------PIYVTKSNMEKVVEKY-----LNEINIS-L
A0A3R5ZMK1      YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
A0A3E4ZTK7      YG--DKYFNT--------------------TVQVTKSPLQNVAIGF-----QANLQAT-L
A0A1Y3ZIA4      YG--DKYFNT--------------------TVQVTKSPLQNVALRF-----QSGLQAT-L
K5Y1A4          YG--DKYFNT--------------------TVQVTKSPLQNVALRF-----QSGLQAT-L
A0A4Q5CIT0      YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
A0A3R6K8X4      YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
A0A414GI87      YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
A0A415BDM7      YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
A0A412DM15      YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
A7AEU7          YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
A0A1Q6I3T6      YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
A0A414XX40      YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
A0A3R6BKI7      YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
A0A414LPI6      YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
A0A412M2W1      YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
K5ZX55          YG--DKYFNT--------------------VVQVTKSPLQDVALRF-----QGGLQAT-L
A0A5F0U645      YT--DLYYGS--------------------EITVSKSNQDRVALDY-----NESLQVV-L
K5ZBN2          YT--DLYYGS--------------------EITVSKSNQDRVALDY-----NESLQVV-L
A0A0J6CKW3      YT--DLYYGS--------------------EITVSKSNQDRVALDY-----NESLQVV-L
A0A0F5IQM7      YT--DLYYGS--------------------EITVSKSNQDRVALDY-----NESLQVV-L
A0A496CDT3      YT--DLYYGS--------------------EITVSKSNQDRVALDY-----NESLQVV-L
A0A6G1ZKM3      YT--DLYYGS--------------------EITVSKSNQDRVALDY-----NESLQVV-L
S0GLB0          YT--DLYYGS--------------------EITVSKSNQDRVALDY-----NESLQVV-L
A0A3R6NLC1      YT--DLYYGS--------------------EITVTKSSRDWVALNY-----NEALQVA-L
A0A416WYC9      YT--DLYYGS--------------------EITVTKSSRDRVALNY-----NEALQVA-L
A0A0F5IT40      YA--DKYFGK--------------------AVTISKRNREEIALTY-----SNSLQVA-L
A0A496CX20      YA--DKYFGK--------------------AVTISKRNREEIALTY-----SNSLQVA-L
A0A5F0UBI0      YA--DKYFGK--------------------AVTISKRNREEIALTY-----SNSLQVA-L
A0A6G1ZHG0      YA--DKYFGK--------------------AVTISKRNREEIALTY-----SNSLQVA-L
S0GSI7          YA--DKYFGK--------------------AVTISKRNREEIALTY-----SNSLQVA-L
K5YB65          YA--DKYFGK--------------------AVTISKRNREEIALTY-----SNSLQVA-L
A0A0F5IWP9      YS--DKYFGK--------------------PVAVVKKNRVDVALGY-----SNTLQVA-L
A0A0F5IZT8      YS--DKYFGK--------------------PVAVVKKNRVDVALGY-----SNTLQVA-L
A0A417LKQ2      YS--DKYFGK--------------------PVAVGKKNREDVTLSY-----SNALQVA-L
A0A416TME1      YS--DKYFGK--------------------SVVVGKKNREDVALNY-----SNALQVV-L
A0A416XPE8      YS--DKYFGK--------------------SVVVGKKNREDVALNY-----SNALQVV-L
A0A3B0C2S4      PIAYE-----------------------GIQFRVVLKSVKDAVFAL-----SEKLQVQ-P
L8JI02          YAPKE-----------------------NTRYYFVIHDLSEVIETY-----QTELEVY-P
A0A4Q5WS95      YKAGS-----------------------QGPFYFRLIDPKSVAAGL-----QKKLDVA-P
A0A501VZX6      KEGIA-----------------------KHPLYFSLIRPKKIVESL-----EKNIKIE-A
A0A399SH26      QSSQA-----------------------KEQLYFQLLPLKAVTASL-----LNNLQVN-A
A0A501W1A9      FSWAA-----------------------TGRLFFSIKDPRKAARQL-----ASSIQIE-T
A0A0E3ZGV6      QTSTT-----------------------TNPLYFSIISPTRAANQL-----SGSIFIE-S
A0A1I2N4S1      QNGSA-----------------------QHPLFFSINNPKAVAKQL-----ISRIYVE-S
A0A2T5YE44      QNGSA-----------------------QNPLFFSINNPKAVAKQL-----ISRIYVE-S
A0A1V9FHD0      QTTDS-----------------------TGQLYFDLYKTKNLAPTI-----SLNLVVT-S
A0A4V4H170      QLSMA-----------------------EGPLFFRLYKPKNIAPGF-----ISNLGVK-S
A0A1V9F098      QTEAP-----------------------GGPLFFRLSKPKNVAPGY-----IASLEVK-S
A0A4R2VU64      QADTP-----------------------GGQLYFQLIKPKNVAPGI-----IASLDAK-P
A0A4S8HY23      QSDTV-----------------------VAPLFFRLYKPKNRAPAI-----ISNLQVK-S
A0A1V9F383      QTTAP-----------------------VGPLFFELNKPKDVAPGI-----LLNLQVN-S
G8TRZ6          QTSKP-----------------------VGPLFFNLNKTKDVVPGL-----LLNLLVV-S
A0A543WA52      QKGNP-----------------------QDSLYFILVNPKKITDGI-----LSDLEVS-S
A0A1M5BA90      LKTAS-----------------------TNPLYFSLNNPKMVLNSL-----VTNLRVI-A
A0A512B879      FKTAT-----------------------TNNLYFSLVPPKQALNSL-----ILNLNVS-P
A0A559PPI3      KVQQA-----------------------KKPLYFILINPRSVTQSL-----LKSLEVA-P
A0A1T5CS78      VNKKA-----------------------SNPLFFYLLNPKIISTSL-----LDELDIS-T
A0A0Q9Z8F1      VNKKA-----------------------SNPLFFYLLNPKMISSEL-----IDELDIS-T
A0A2N0U0M7      VNKNA-----------------------SDPLFFYLLNPKMISSEL-----IDELDIS-T
A0A2N3U785      -PGFSTTN--------------------YSEVLVEFKDYRRVANYY-----RNALSIY-P
A0A0D3L8Q3      --SRLIRN--------------------GMTVRVHFNNIQRLASNY-----SDRLVVE-K
A0A0E3ZG78      LTASSKSI--------------------GSKLTVKFKNVQQLAEHY-----SQAIQIG-P
A0A1I6BRK6      ----QYNV--------------------GTKIIVYFQDIYQVANHY-----SQAINIK-P
A0A243WAB1      ----GNTA--------------------DRKVIVSFQDIHQVADHY-----NKAIAVQ-P
A0A6G8C8X6      ----KDLG--------------------ENKIIVHFQDIKQVAAHY-----NKAIVVQ-P
A0A5B6TJH8      LNSTPTSN--------------------LNQVKVQFQNIQEVASRY-----HNAIEVM-Q
A0A519U664      --SIKNAV--------------------SDKIIVRFNDIHQVAAHY-----SQAIGIQ-P
A0A519UDD1      --GLQNMP--------------------ATKIIVRFQDILKVADYY-----NKAIGVQ-P
A0A519MA34      --STKNAV--------------------SDKIIVRFNDIHQIAAHY-----SQAIGIQ-P
A0A519UCX0      --ATKSAV--------------------SDKIIVQFNDIHQVAVHY-----SQAISVQ-S
A0A4R5DL69      TWNQSFGDTFLLPTGEATLRKTIYKPDPENTYSIKISGFESTVSEY-----SRRLSIS-A
A0A1M4YED3      LKFTKNDKANA-AP--------------QGALKLFLYNPESLASSY-----ANRVSIP-P
A0A2H3NSN0      ------------AV--------------DD-EQPTDSE---AMIRL-----FDMVDF--A
A0A2P6C324      ------------PV--------------SEEEPYTQYA---AILRL-----QEMVSF--V
A0A1M6XHU0      ------------PT--------------EDGREPSIRE---IAFRL-----RERVRF--R
A0A5S9C8G0      ------------PT--------------EDGREPSIRE---IAFRL-----RERVRF--S
G2SF81          ------------PT--------------EDGREPSIRE---IAFRL-----RERVRF--S
A0A5S9EYW1      ------------PT--------------EDGREPTIRE---IALRL-----RERVHF--Q
D0MHQ9          ------------PA--------------EDGREPSIRE---IAFRL-----RERVRF--S
A0A126PFG0      FAL---------PA--------------GSRLRIVARDPDLVVTAY-----QKALEVD-L
A0A3M1N7Z3      SAQLRIDCDPNCPS--------------EGQYEVVVFAPQATTFAW-----QRRVSV--I
                                                                            

A0A1T5MMH4      LN-------Y-----A-AQTIRIAFQDNNPLKAHAIVDAINKTYLHYSYEQKKLTTKQKI
A0A2W4R1L8      IN-------F-----N-ANTIRISFKDHNPLKAQTVVNKIDSLYLIFSNEQKTLANRQKI
A0A2E5CV79      MNGISIKRRN-----A-TGVLEITFQSVFADEARRISDGIAQVYKNLEKTIGNEDATLRV
A0A2D4ZVH1      PD-------P-----E-ADIVSISFESPLPTEASSIINMTMDTYSALSTEQNRTMAVSAL
A0A0K8QSK7      SN-------R-----Q-TSILTLTVQDHNSAKGNDFLNKLVEVYQRDNLNQKNEVANRTI
A0A1V6CN82      RD-------W-----E-TSIVDIDLKDYHPQKAVDFLNKLVEVYRIDNVEKKNQYADQTI
A0A1M4XZ45      SG-------K-----E-TSILNLTLRDYNVSKGVAFLNKLTEVYQLDNLEKKNENANRTI
A0A399D319      ND-------K-----E-TSILNLTLRDFNVKKGVDFLNKLTEVYQLDNLEKKNENANRTI
A0A1M6GR99      PD-------R-----L-GTFIEISMKTNSVQLGEDIINELIQVYSESNLEKKNHLANMTL
A6EBM4          AG-------K-----N-SNILSLQQTDVNPRFAADILNAILQEYLDYDKLQKTQSATQMI
A0A1M6TTV4      IN-------F-----N-ANTIKIALSDPNKYKAKSLLQAIDTIYLNFTKAAKNLAVEQKI
A0A4Q8RX32      AN-------V-----D-GTVVNVLLKSNNARMGIDFLEQYVVTIIEDNLDRKNYIAHTTI
K0X1U5          SD-------K-----K-ANGISLKIRESNKQRGKDILNTLIECYNEDAVLNKNLKAQNML
R5EXK3          SD-------K-----K-ANCISLKIRESNKQRGKDILNTLIECYNEDAVLNKNLKAQNML
A0A401UAP7      KN-------Y-----N-ANTIRISFKEFSAEKAMDIVNKIVNIYLGFSNEQKNFANKHKI
A0A1W2GF52      IN-------F-----N-ANTIKISLSDFNQTKARNLLQAIDTIYLAFTKNAKNQAVEQKI
A0A2G5L7B8      IN-------F-----N-ANTIKIALADPNKYKARSLVQAIDTIYLNYTKAAKNQAVEQKI
A0A523GAC0      LN-------L-----T-ANTIRISFRDHNRYKARDLVSAIDTIYLTYTKEEKNKANQQKI
L8JW09          LN-------L-----N-ANTIRIAFKDYNPLKARDLVNAIDTLYLKYSEEEKNLENKQKI
A0A364XUP5      LN-------F-----Y-AKTIRVAFKDNNPSKARAILQVIDDVYLKYSHEQKNLANKQKI
A0A1M5RLA9      LN-------Y-----N-AHTLRISFKDNNPTKATAILNKIDSIYLHYSYEQKNLANKQKI
A0A385SFR9      LN-------F-----N-ANTLRISFKDNNPSKATAILNKIDSIYLHYSYEQKNLANKQKI
A0A5M4A9J4      VN-------K-----D-ATLLNLKMESATPSKSISFLNKLMEVYQQQNLDKKNEMATRTI
A0A5M4B1C7      VN-------K-----D-ATLLKLSMLSPTPQKDIDFINQLMEVYQDQNLEKKNAMATRTI
A0A0D3LFR6      LN-------P-----N-AKTIKISLTDYNPYKARVVVDAVSNMYLTYKEEEQIKANNQKI
M7N6D4          LN-------P-----S-AKTIKISLSDHNPFKAKVLVDVLSNMYLGYTEEEKIKSNSKRI
A0A4D7K1D4      QS-------L-----A-ANTIKITFTDNDKYKAYDVVNTIDSLYLEYSREQKMQANKQKI
A0A5C7MX19      LD-------F-----K-TKSFKISYKDKSAVKTRDITNMMVRVFVEYDMEKKREGFENVI
A0A1Q3ZMZ7      LN-------P-----E-AQTIEIKFESHNANLSRDVVNVIIDEFFAFDEMLKKQSSENVL
A0A2D8JJW3      QESLNINHVK-----E-TSHLVITVESLDSKEAANIVSCLIDSYVEEEKKHANQKTSDQI
A0A2W2AFF7      VN-------K-----Q-VTLINLSLQSNIPHQGEDALNKLINVYLQANVDDKNKIADSTM
R7PCR1          VD-------K-----Q-SSLIQLVCQDVNKKRAEVLLSTLLDVYREDIIESKNRVAENTS
A0A2N5YXE2      LN-------E-----N-AGTILITYNDYNARKSAEITNTIAEKFIEFDENKKKESANNII
A0A1G9E2A9      VN-------A-----N-ASTIRIAFKDYTPEKARDIVNKIDSIYLVQTIENKNLATEQTL
A0A098LL25      LN-------L-----D-ANTILLSYKNHNYSKATDIVNTIDSVYLEQTLENKSKSHEQTI
A0A6C0GJI1      LN-------Q-----M-ANSLGISFKDHSIAKARDIVNTIDSVYLTKTLEIKNTSNKKKI
A0A2T2YJE8      VN-------L-----D-ASTVEISFTDHNPFKAHEIVNSIDSVYLEQKIALKDLATRQTL
A0A127B287      LN-------P-----E-AKTISISFKEFNREKARDVVNKIDTVYLQQKLARSNQASQQTI
A0A3M9N829      LN-------P-----E-SKTIQISFKDFNRYKARDIVNNIDTVYLQHKLERSNQASRQTL
A0A0P0CSF9      LN-------P-----E-SKTIQIAFKDFNRFKARDIVNNIDTVYLQYKLERSNQASKQTL
A0A5M8QQB8      LN-------P-----E-SKTIQISFKDFNRFKARDIVNNIDAVYLQHKLERSNQASKQTL
A0A3M9MNC3      LN-------P-----E-SKTIQISFKDFNRYKAHDIVTNIDAVYLQHKIERSNQASRQTL
A0A5B6TAX2      LN-------P-----E-SKTIQISFKDFNRYKAHDIVNNIDAVYLQHKIERSNQASRQTL
A0A5N1IQ33      VN-------P-----E-ANTIGISFKDNNALKAHDIVDKIDTLYLQEKLAKNSLASQQTL
A0A512AYT3      VN-------P-----D-AHTIGIFFTDFNPAKARDIVTEIDTAYLEQKIHQKNLASSQRQ
A0A5M6CYN7      VN-------P-----D-AHTVGIFFTDFNPAKARDIVNKIDSAYLEQKIRQKNLATSQIE
A0A369QP10      VN-------L-----D-ASTVDISFTDHNPFKAHEIVNSIDSVYLEQKIALKDMATRQTL
A0A126PDF2      SS-------A-----D-ANTIQISFTDFNPKKAQRIVNKVDTVYQRAKVLREQENTARTL
A0A2Z3GKA1      SS-------A-----D-ANTIQISFTDFNPKKAQRIVNKVDTVYQRAKVLREQENTARTL
A0A502GZP7      SS-------A-----D-ANTIQISFTDFNAKKAQRIVNKVDTVYQRAKVLREQENTARTL
A0A519SBU8      VN-------P-----S-ANTIQISFTDNNPSKAAHIINNIDTVYLKEKLDRKRQSSALTL
A0A4Q3JNZ3      VN-------P-----S-ANTIQISFTDNNPEKAAHIINNIDTVYLQEKLERKTKNSELSL
A0A519Q9V3      VN-------P-----S-ANTIQISFTDNNPEKAAHIINNIDTVYLQEKLDRKKQSSALSL
A0A0M3RW20      IN-------P-----E-ANTIGISFADHNPLKAKDIVNRIDTVYLVEKLAKNSQGQQQTL
A0A495VFX4      IN-------P-----E-ANTIGISFSDHNPLKAQDIVNRIDTVYLVEKLAKNSQGQQQTL
A0A1S9B3W0      IN-------P-----D-ASTIGISFTDNNPAKARDIVNKIDSVYLQVKLARTNQATQQTL
A0A1W1VRL3      VN-------P-----D-ANTVQISFKDFNPAKAQDIVNKIDTVYLQEKLAQKKKASDQSL
A0A1M6R305      VN-------P-----D-ANTIQISFQDFTPAKARAIVNKIDTVYLQEKIAQKQAATAQTL
A0A4Z0PHK3      VN-------P-----D-ANTIQIGFTDFNPAKARAIVNKIDTVYLQEKLAKKQEATAQTL
A0A2M9B9H9      VN-------P-----D-ANTIQIAFTDFNPAKARDIVNKIDTVYLQEKLAKKQEATAQTL
A0A4Z0QCY9      VN-------P-----D-ANTIQISFTDFNPAKAREIVNKIDTVYLQEKLAKKQEATAQTL
A0A418R9X5      IN-------P-----D-ASTISISFTDYNPSKASDIVNYVDSVYLVEKILRKQETMARAT
A0A428JSJ3      VN-------P-----D-ASTISISFADHNPVKASDIVNKIDTVYLVEKLLRKQETMARAT
A0A428KI59      VN-------P-----D-ASTISIAFTDHNSVKARDIVNKIDSVYLVEKLLRKQETMARAT
W8F1I6          VN-------P-----D-ASTISIAFTDHNPVKARDIVNKIDSVYLVEKLLRKQETMARAT
A0A246FQC0      VN-------L-----D-ANTISISFTDHNPAKAQAIVNGIDSVYLVEKLVRKQEQATRAM
A0A372E5P8      VN-------L-----D-ANTISISFTDHNPAKARDIVNAVDAVYLEEKLTRKREQAARAL
A0A1H3EMW1      VN-------V-----D-ANTISISFTDHNPAKARDIVDAVDAVYLEEKLVRKREQSARAL
A0A1H9ZSN3      VN-------V-----D-ANTISISFTDHNPAKARDIVNAVDAVYLEEKLARKREQSARAL
A0A5N1J2M4      VN-------F-----D-AQTIKISFTDHNPKKAQDIVNRVDSVYLEHKRETKNQSNEQTI
A0A519S476      IN-------P-----N-ANTIQISFTDNNPVKAAHIVNNIDTVYLQEKMARKKQGNDSTL
A0A4Q3JRW8      VN-------P-----N-ANTIQISFTDNNPEKAAHIINNIDTVYLQEKLDRKKQSSALSL
A0A519M923      VN-------P-----S-ANTIQISFTDNNPEKAAHIINNIDTVYLQEKLARKKQQSELSL
A0A4Z0ENW1      LN-------P-----S-ASTLQISFLDNNRVKAQRIVNALDTVYRDVKLAHKQETTEKSL
A0A519UDB4      LN-------P-----S-ANTIQISFQDNNRLKAQRIVNALDSVYREAKVARKQEATEKTL
A0A3S0QKV1      IN-------P-----E-ASTIGISFSDNTPQKAQAIVNKIDSVYLNVKLDRSSQATQQTL
A0A328BL48      IN-------P-----D-ANTIGISFTDYNPAKARDIVNKIDSVYQQVKLARNYQSTQQSM
A0A5R8WLY4      IN-------P-----D-ANTIGISFTDYTPTKARDIVNKIDSVYQQVKLARNSQSTQQSM
A0A1I5WSL8      VN-------P-----E-ANTIQISFNDFNPTKAQDIVNKIDSLYLVEKVTRKNEATRNQL
A0A0U3JVM7      VN-------P-----E-ASTIQISFNDFNPSKAQDIVNKIDSVYLAEKLAQKSETTTRKL
A0A1G1SSV2      VN-------P-----E-ANTIQIAFNDFNASKAQDIVNKIDSVYLEEKLAQKSESTISKL
A0A1G1SXV7      IN-------P-----E-ASTIQIAFNDFNPSKAQDIVNNIDAVYLEERLAQKQESTISKL
A0A6G8CBJ6      VN-------P-----E-AHTVEISFADFNPLKAQDIVNKIDTVYLQEKLAQKKEASEKSL
A0A0W8EDI5      IN-------P-----E-ANTIAISFKDHNPKKARDIVNKIDTLYLQEKLAKNTQATQQAL
A0A3B7RBP8      IN-------P-----E-ANTIGISFKDHNPGKARDIVNKIDTLYLQEKLAKNSLATQQTL
A0A3R9P8H7      VN-------V-----D-ANTISISFTDHNPTKARAIVNKIDSVYLVEKLLRKQEQAARAM
A0A238WIA7      VN-------P-----D-ANTISIGFTDYNPLKAHDIVNKVDTAYLVEKIQRKQEQSAKTL
A0A212UCJ7      IN-------P-----D-ANTISISFTDNNSLKAHDIVNKVDTAYLVEKIQRKQEQSAKTL
A0A4Z0MQE1      VN-------P-----D-ANTISIAFTDHNPLKAHDIVNKVDTAYLVEKIQRKQEQSAKTL
A0A4Z0PCF4      VN-------P-----D-ANTISISFTDHNPLKAHDIVNKVDTAYLVEKIQRKQEQSAKTL
A0A5D6VDG1      VN-------P-----E-ASTISISFKDHNPRKARDIVNRIDTVYLVAKLTKNTQSQQQIM
A0A6H1CVS0      VN-------P-----E-ANTIGISFTDHNPRKARDIVNRIDTVYLVAKLTKNTQSQQQIM
A0A243WHR7      VN-------P-----D-ANTIQISFTDFNPSKAQAIVNKIDTVYLQEKLAQKQEVTQRQL
A0A5B8A0P6      IN-------P-----N-ANTIQISFQDFNPLKARDVVNKIDSVYLEEKLAQKQQATAQTL
A0A076HRT9      VN-------P-----D-ANTIQISFQDFSPSKARAIVNKIDTVYLQEKIAQKQTATAQTL
A0A4Z0PVM7      VN-------P-----D-ANTIQISFTDFNPAKARDIVNKIDTVYLQEKLAKKQEATAQTL
A0A1M6DHW8      IN-------A-----D-ANTIQIAFTDFNPAKAQDIVNKIDTVYLQEKLTQKQQATAQTL
A0A4Q5LC61      VN-------A-----D-ANTIQIAFTDFNPAKAQDIVNKIDTVYLQEKLAKKQQATAQTL
A0A2U1FKU2      AD-------K-----K-STIVRLSLNNTDLDRAKDFINTLISSYNDDVMNDKKSVAVSTA
A0A0A2F954      AD-------K-----K-ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAISTA
A0A0A2FW91      AD-------K-----K-ATIVNLSLKNEDLDRAKNFVNTLISSYNDDVMNDKKSVAVSTA
A0A2D2N2N1      AD-------K-----K-ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTA
Q7MWZ2          AD-------K-----K-ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTA
T2NDT6          AD-------K-----K-ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTA
W1R7P9          AD-------K-----K-ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTA
A0A1R4AFZ0      AD-------K-----K-ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTA
A0A1R4DVZ7      AD-------K-----K-ATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTA
A0A2A8CVM9      M--------Q-----S-QSMIQFTVESGVPEEASTVANLYSSQYEIFSREKARASVTAAR
A0A5M4B212      VS-------K-----E-GTMIKLSTTCENPEKGIDFLNKMMQVYQTRNLDKKNVIATKTI
A0A3D1KEX9      VN-------K-----E-ASLISLTCKDNNKDRAEAILTVLMDLYKRDIVESKNSVAANTA
A0A358Y7S2      VN-------P-----E-AKTIEITYENSNAKLSYDITKTLIEQYLFFQEEMNIKNAKKTI
A0A1X7J248      EN-------L-----N-ANTIKITFEDYNPYKVQEIVETVSELYTEYSKEQKNKANQLKI
E4TQD2          EN-------L-----N-ANTIKITFEDYNPYKVQAIVEQVSELYTKYSKEQKNKANQLKI
A0A2J6HHN3      VS-------D-----A-AKTIRISLRDINASKATDIVNAITTEFELFEIEEQKQSSESIL
A0A1Y3WMT8      SD-------K-----K-ANGISLKIKDSNRKRGQDILDTLIECYNEDAVLNKNLKAQNML
A0A1Y4GQU1      SD-------K-----K-ANGISLKIEDSNRRRGQDILDTLIECYNEDAVLNKNLKAENML
A0A6A0R272      VE-------E-----K-VALLSIVYQSSNPLLCKDFVDALVSSYSNVEFELKALAASNTI
A0A1V5W8T5      LN-------F-----D-AKTIRIYYTSNNAQKTSDLVNTISEDFLTYNIEKKQERAEKVL
A0A2T8HKA9      IE-------D-----D-AGLLQLTLEDHSPKRATDLIKTLIEVYNEQTVEEKNRVAVSTA
A0A2I0QZ80      ID-------Q-----K-AKTVEISYRSHSPTFAKDIITALTKSFFKYDEGLKKESAENVL
A0A3E1F1A3      VD-------N-----N-AKTVEVAYRSSSPQLATDMVKSLVSNFFNYDEDLNKESADNIL
A0A2U2XBJ3      VD-------A-----N-ARTVQISFRSHSPLLAKEMIQSLTANFFKYDENIKKESADNVL
A0A4Q4KU94      VD-------P-----N-ARTVELSFRSHSPTLAMEIVQSLTANFFKYDENIKKESADNIL
A0A3B8INU3      LN-------L-----N-ANTIRVSFQEYNRQKAQDMVGAITSIYQTYTKDQKKQANQQKI
A0A2W1NDY9      EN-------A-----D-ANTIKVSFRSNNNVLAQDMVREVVETFFTYDLEKKSKSSESIL
A0A5C8AQR5      IN-------L-----E-AKTIEISYQAYNPVLCNDIVSAITSAFFEYDESLKKQSSDNIL
A0A1G0CI31      AD-------I-----E-AKTILIRYQGYNAELCHDITNAVAEAFFTYDEEVKRKSAENIL
A0A556N0M0      ID-------I-----N-AKTIELRYSGNNPDLCKDIIQSVATTFFNYDEEMKRKSADNIL
F2IKD6          VD-------A-----N-AKTIELRYTGNNPELCRDIIKSVSLTFFNYDEEMKRKGADNIL
A0A1I7BM74      LD-------V-----K-AKSILISYRSNNAHLSQDICNAVGESFFDYDDHLQQESSEKIL
A0A2G2FJ17      VD-------I-----Q-AKTIEISYRNTNANLAQDITKAIGDAFFEYDERYTKESAENIL
A0A2E3R1D0      ET-------G-----G-ADAIRVNAVSTDPQEAALISNTYAEAFAQLTQDQSRSGASASR
A0A2T2USC0      AGGNLAGQYE-----S-ADAINISVKGVSASEAALIANLYAQEYINYNERKSKESARSTR
A0A2T2V0F3      AGENLGNQYE-----S-ADAIRISVRGVSASEAALIANLYSQAYIDYNQRKSQESARSTR
A0A2T2S682      AG-------R-----E-VDAIRITAQGPVPAEAALIADQYAAAYLQRTREKSRESLRAKR
D5H561          AG-------A-----E-TNVIQIVAQDETPAVARRLANLFTEAYIELTQKSSRERVKASR
A0A2H3NWA9      GG-------E-----E-IDAIRLSATSTDPQEAALLVNLFSEEYVEFSRDRSRQSVQATY
A0A2A8CVB6      YG-------E-----Q-FDAIRIVATGRDAADVALVANIYADEYIRRTKEKARESLQASR
A0A2P6C1S6      SG-------E-----E-TDALYISASSHHPNEASLVANLYAEEYIQRTQERSREDLRASR
A0A2T2UTM4      SG-------E-----K-TDALYISAKSHHPYEVSLIVNLYAEEYIQRTKEKSREDLKASR
A0A414ZBF2      VD-------K-------SSLINLTIEDENIGRAEDVLNTLIEAYKNDAIEDKNKVVINTA
A0A1Q3Q573      IE-------A-----G-NNTLAITYADQNPEKAKDIANALATEFIDYDLNKKREGMGNIL
A0A662BAY3      LS-------Q-----E-TSIIELSLKTLNVAKGIDFLNTLVAVYQAYTLERKNENASRTI
A0A4U3L369      PD-------D-----K-ANVIDLSMTSKVPSKGEFILNYFIQRYLRSSLEQRNQIADSTL
A0A357YNR3      TS-------K-----T-SSVADVSLICSNVALGRDFLVKYIQTYNEKGIADQIELADKTS
A0A5E8AX52      LN-------F-----S-AKTIKISLRDFNKYKARDFVTAIDTLYLKYTTEEKNQAIEQKL
F4KK08          QQ-------K-----D-ASVIKLTIQAGNPLLAEDFLSTLILVYTELERSDKVKIAESTQ
A0A6B5PK86      ID-------E-----R-ARTVSIAFKGDNSKLCHDVTLAVANTFIDYSVKLKKKSSESIL
A0A2G2F510      VE-------V-----G-AKTISISYRGYTPQLCKDITLAISNSYISFDEDMQRKGSENIL
A0A316JZ08      MD-------P-----N-ARTIQVSFKGHNARMCRDLSLAIAEAYQEYDEEINRKSSENVL
A0A496LCF9      IE-------------N-TSVLDVSVNSDNPARDVDFLTQHAKSFLGDNLDKKNYEADKTI
A0A5P2G2A9      PN-------K-----Q-VSAINLTLPVEIPSKGEDVLDTLIKEYIKSNKDQKNAYADSTI
A0A3C0ZQC7      I--------R-----D-SDVIKVTARSVQPKEAALIANTFAEAYYDRNLFSSRSRSRAAR
A0A419VXB7      VN-------K-----D-ADVISLQLTGQNPDQKISYLNELSRVYIQYGLQQKNQISDNTI
A0A0B0BTJ4      AQ-------K-----F-SNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATM
A0A3B9CNN6      AQ-------K-----F-SNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATM
R5X290          AQ-------K-----F-SNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATM
A0A1Q6E6I7      AQ-------K-----F-SNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATM
C3J7R8          AS-------K-----Q-GSIITLTMQHQNPEVAEDFLNTLVQIYNENSRMEKVRVAQKTE
A0A1G8BVM8      VD-------K-----Q-SSLVQLSIIDTHPQRAEDIINTLVTVYEKNAIDNKNQVLSKTV
A0A1I1FXP9      LN-------Q-----S-ANTIRIIIKDHHPQKAHDIMVTIDSVYLEQTLEQKNKVNEQTL
A0A3N4H5N3      PS-------I-----K-SSTIYLTMLNTSPARGKDIMSSVINGYNFLNLNQKNEVALKTI
A0A2P8EAX2      SS-------V-----K-SSTLFIRLLDSSPTRGKQILNSLIEGYNTSNQNQKNEVALKTI
A0A4V2F6N9      SS-------V-----K-SSTLFIRLLDSSPTRGKQILNALIDGYNSSNQNQKNEVALKTI
A0A3B9FXJ0      EN-------T-----Y-GGKIVIEYTDVNDQRAKDVVNTIADAIVTNGLERKSVSANSII
R5GSU5          ID-------K-----E-SSLIVLTFQDTNKKRAEDFLNVLLDVYKEDIIDGKNRIAESTA
A0A2A3UE91      LN-------E-----L-AKTILIRVKDVNAAKSSDIVNAITEEYLAFDVERKSESSRNII
A0A0A2G557      SG-------K-----Q-SSVIDLRFKDENTDFAEDFLNTLISQHDATSRSEKLKIAHNTE
A0A2N2WFW8      LN-------D-----V-AKTIRISIRDMNPRKAADLVNKVAEEFAAFEVEYQKESSNSIL
A0A1F3IU95      IN-------D-----V-AKTIRISLKDYNPRKAADVVNSVAKEFATFEVEYQKNSSNSIL
A0A3D0VUF6      IN-------D-----V-AKTIRISLKDYNPRKAADVVNSVAKEFATFEVEYQKNSSNSIL
A0A1T4PT95      SS-------K-----G-SSIIDLRFRDENPHLAEDFLNTLINEHDTTSRLEKLKIARSTE
A0A6I6JYY3      AD-------K-----E-TSIVGLTLRDLNQEKGIHFLNKLTEIYQLDNLGKKNDNANRTI
A0A2A4PYG9      LN-------Q-----A-AKTIQVTVRENNPQKAADIVNSMASEFVEYDVEKKAQSATKIL
A0A1F3K695      QN-------Q-----L-AQTIEIAFSDNNPLKTAEIANVIAEEFLTYDVEKKKESANQIL
A0A353KZR1      QN-------Q-----L-AQTIEIAFSDNNPLKTAEIANVIAEEFLTYDVEKKKESANQIL
A0A2N2WYB5      QN-------R-----S-AQTIQITYSGYNPEKAADIVNTIAEEYLKYDVESKKESAESIL
A0A1F3K4G0      LN-------R-----S-AQTIQISYSGYNAEKASDIVNTIAEEYLKYDVEIKKESAANIL
A0A356H8Y3      LN-------R-----S-AQTIQISYSGYNAEKASDIVNTIAEEYLKYDVEIKKESAANIL
A0A351HSA6      LN-------R-----S-AQTIQISYSGYNAEKASDIVNTIAEEYLKYDVEIKKESAANIL
A0A1F3Q014      LN-------D-----Q-AKTILVSYKGFNPQKAADIVSKMTEEYSNFDIERKGESSLKVI
A0A2A4YXP3      LN-------N-----A-AKTINISFEDHNPKKAVDIVTAVANEYIIYDIEERSRSSKNAL
A0A2D5KD44      LN-------P-----N-AKTLQVGISDNNRLKAFDIVNGLIDEFKLYNVEKKKQSSKQIL
A0A1F3R158      LN-------P-----L-AKTISLSFQDNNAVKTADILTSLANEYIIYDIEERSKSSKNVI
A0A2M8ADX2      LN-------P-----M-AKTISISFQDNNATKTADIITALANEYIVYDIEERSKSSKKVI
A0A1J5B2H0      IN-------E-----A-AKTVSITFRDENAQKTSDIVNTIAEEFVIYDIEKKAESTNKII
A0A1V5N756      VN-------E-----N-SQSIMVMYSDRNPVKAADIVDTIISEFNLYDVEKQAMSTDKIL
A0A651GU15      MN-------N-----I-AQTIQISCKNHNATLARDFVMAHAHQYLQYDQESRELSASNII
A0A3Q9FR88      FD-------P-----K-ANTIQISFKAANREKAVAVLKAINTAYSQLSRESKALVYERAL
A0A553GEX3      FD-------P-----K-ANTIQISFKAANREKAVAVLKAINTAYSQLSRESKALVYERAL
A0A150ADJ9      FN-------P-----K-ANTIQISFTAGNREKAIAILQSINLAYSQLSREGKALVYERAL
A0A1B1FWQ4      YD-------P-----K-AKTIQISFTARNRKKAERVLEAINKAYSQLSREGKALVYERAL
A0A1S1Z228      YD-------P-----R-AKTIQISFTARNRKKAEAVLEAINKSYGQLSREGKALVYERAL
A1ZKR2          LN-------K-----S-ARIIGINFRDHHPQKARDIVHVIDTIYLHKTLENKKRANTQQK
A0A1Q3GX01      LN-------R-----S-ARIIGVNFRDYNPLKASNIVHVIDTIYLQKTLENKKRANIQQK
A0A349DQI4      LN-------R-----S-ARIIGVNFRDFNPLKAKHIVHVIDTTYLQKTLENKKRANIQQK
A0A4P5TMD1      YP-------P---------TIQFSLQDPVPLKAVDIINTLQEEFIKYNKERKTESSSLII
A0A2N3IIZ0      LN-------P-----Q-AKIIAISFKDHNATKARDVLKSISEVYRVKSVEIKNRANRQKK
A0A1F3SJM1      ID-------V-----A-AKTISISFRGHNAQLCHDVTLAISKAFQEFDEESKRQGADNII
A0A2G2EB96      ID-------P-----Y-AKTISISFRGYNAVLCRDVVNAVSKSFIEYDEEQKRKSSDNII
A0A2G6PRA9      ID-------P-----N-AKTISISFRGHNATLCRDVVQAVSESFIEYDEEQKRQSSENII
A0A497D5Z2      VP-------K-----E-SSILEISLLEENEQKGVAFLNKLAEVYEQYNLGKKNENASRTI
A0A662B170      VP-------K-----E-SSILEISLLEENEQKGVAFLNKLAEVYEQYNLGKKNENASRTI
A0A2A5FYT6      LN-------A-----A-AKTIKISFTDHSGKKAKDISEAIAEGFINIDVERKSQSAEKVL
A0A2E6SYP1      FN-------V-----R-AKTIKIGYSGDHPEKCADIVNSLASAFLISNISKKKESANQMI
A0A2E5RLE8      EN-------T-----R-ANTIKISYTGNHPKKCADIVNSLSSLFLISNISKKKESANQMI
A0A2E7TQF6      EN-------T-----R-ANTIKISYTGNHPKKCADIVNSLSSLFLISNISKKKESANQMI
A0A2E6GVY9      EN-------S-----R-ANTIKISYTGNHPKKCADIVNSLSSLFLISNISKKKESANQMI
A0A350JJ90      QS-------A-----A-AKTVQIVVTDNNPAKASAICEQIAQTYLVFDHERKSESANQVL
A0A3M1CDV2      LN-------D-----L-AQTISISIKDVNPQKTTDIVNTIAEEYLIYDVERKSESSKNIL
A0A6C1QGZ7      LN-------P-----A-AKTIQINYQGTNAAKASDIVNIIAEEFGMYDLEKKTESANNIL
A0A4P5U6G4      -N-------P-----Y-TPSILISFQDKNPYRAADIVNAMNDEFISYDKEKKTESATLIL
A0A2E2TFD1      LS-------Q-----S-AKSISISFTDPNPRKAADLANAISTGFIDYDLTRKIYSSTQVI
A0A2E4ELE6      LN-------Q-----A-ANSVEISFSDYNPRKAADLSNAISGGFIDYDLQRQITSSNQIL
A0A522EYA6      LS-------D-----A-AKTIQISFQDNNAAKTTDIVNSMAEQFKEYDREKKGESEQKIL
A0A2E3XZI5      ID-------R-----S-AHTINIIHKHSNTFFSKDICNSLAEIYIDYDLERKQLSSEKIV
A0A6I7QXV0      IN-------P-----R-TKTLQIKYSDNHPQKAKEIVETLTKEYINYDLERKQESASQIL
A0A2M7NLQ9      LN-------P-----K-AYTIQVSFTDNNPYKAAIVTNTVVDIYFEKTLENKNKVYRQTI
I4AFR0          VN-------P-----K-AYTIQISFTDNNPYKAAIITNTIVDIYFEKTLENKNKVYKQTI
A0A2N2Y3E5      LN-------F-----E-AQTIQITYTDFNPQKTSEIVNTISEQFLKYDVEKKKESADKIL
A0A2D9D7T6      ID-------P-----S-AKTIQITFDHYNPELTRDMTQAIMDVFFLYEEEISKKNTDKIL
A0A1F3PPL5      QN-------P-----E-ANTIEISYVDNNALKTSEVVNTIAEEFRKYDVERMKESAESIL
A0A357QK06      QN-------P-----E-ANTIEISYVDNNALKTSEVVNTIAEEFRKYDVERMKESAESIL
A0A662AEA4      LN-------K-----Y-ANTIEISCTSNNANKTSEMVNTIAEEYMKYDIEKKKESAQNIL
A0A0S2HYK8      LS-------S-----S-SNSIEISYQSHNSQQAADLVNAVAREFQRFEVEKKKESIQNIL
A0A2N5ZWN6      LN-------S-----S-SNSIEITYESNNSQQAADVVNKIAQEFQLFDVEKKKESVKNIL
A0A2E0FJ09      AN-------S-----N-ANTIGLSFTHPNQVLTKDVLGALIENFDQFDSIKRSESSNRIV
A0A1F3FZ62      LN-------V-----L-AQTVLINVTNQNATKSADIANAIADEFILYDIERKAESANNIL
A0A1F3K211      LN-------V-----L-AQTVLINVTNQNATKSADIANAIADEFILYDIERKAESANNIL
A0A1V6I2U9      LN-------E-----T-AGTIKITYQDFNARKSTEITNTIAEKFIEFDEAKKKESATNII
A0A2H0B957      LN-------Q-----E-ANTISISITDNNARKTSEIVNAIAEQFIKYDVEKKKESSQKIL
A0A1F3CFW6      LN-------Q-----E-ANTIQISFKDNNAQKTSEIVNTIAEEFIKYDLEKKKESSQQIL
A0A2M7E2T8      LN-------Q-----E-ANTIQISFKDNNAQKTSEIVNTIAEEFIKYDLEKKKESSQQIL
A0A2M7NC69      LN-------Q-----E-ANTIQISFKDNNAQKTSEIVNTIAEEFIKYDLEKKKESSQQIL
A0A1F3KLL5      LS-------D-----E-AKTISIKYSDYNAQKTTDIVNVIAEELLKYDVEKKKESAMKIL
A0A359D1M1      LS-------D-----E-AKTISIKYSDYNAQKTTDIVNVIAEELLKYDVEKKKESAMKIL
A0A0F2NS19      LN-------P-----S-AKTISISFNDNNALKTSDVITSLANEYILYDIEERSKSSKKII
A0A2A5H8X6      LN-------P-----S-AKTISISFNDNNALKTSDIITSLANEYILYDIEERSKSSKKII
A0A2H0GAU8      LN-------P-----S-AKTINISFQDNNSTKAKDIVTSLANEYILYDLEERSKSSKKVI
A0A2M8FTK1      LN-------P-----S-AKTINISFQDNNSTKAKDIVTSLANEYILYDLEERSKSSKKVI
A0A2A5B3B0      LN-------N-----A-AKTINISFQDNNGEKAKEIITAVANEYIDYDIEERSKSSKKAL
A0A5C6RXM7      IN-------I-----S-AKTINISFKDYNAAKARDMVTAIAEEYIDFDIEERSKSSKKIL
A0A1F3C1M2      LN-------P-----S-AQTVDISFTDNNATKTSDVVNTISEEFLKYDVEKKKESDQQIL
A0A1F3DS87      LN-------P-----S-AQTVDISFIDNNATKTSDVVNTIAEEFLKYDVEKKKESDQQIL
A0A6A0R6K9      VN-------I-----N-AKTVSIAYDDINRIKTKDIVSSVIREFKVYNVEKKKQSSKQIL
A0A2E7CT70      ID-------P-----A-ANTIGITYSHTNPKFAQDVCNTISKVYIDYDLKKKALSSINIV
A0A2D5V560      KN-------Q-----S-AHSXQISHQHTNPHFSKDICNSIVKNYMDYEIDKKQKSTDNIV
A0A2D7K5A8      QD-------Q-----S-AHSIKISHLHTNPHFSKDVCNSFVKIYMNYEINKKQKSTDKIV
A0A2E1XQ82      QD-------Q-----S-AHSIKISHQHTNPHFSKDICNSIVEIYMNYEINKKQKSTDKIV
A0A5C8A5B4      SD-------E-------SNVVNLSIQVEVVEKGQAFLNKLMETYIDYELDKQQQKGRKTI
A0A4Y9ITE2      PN-------K-----K-ARVITISLNSTNVPFAEKVVNALVEGYNERGIEENRVKNQITA
A0A5M8NYX7      LN-------K-----M-TTVVDVTTKTEVPQKGIDVINTLIGIYNQRSIAEKNYVANHTI
A0A3D5KRY6      LS-------AIDPTIN-SNMITLELKTNQLERDVDFLDQLSKMYIQYGLEKKNRKASNTI
A0A1V5IPN7      SK-------R-----D-TDILNLSFESTNRGEAMAAVNAIADAVQQQNTQMARLEFTTIR
A0A0E3V905      TG-------K-----G-STVILLSLEDAVPAKGEAILNQLIREYNEAAIMDKNKVAASTL
A0A553ETH6      LN-------L-----N-ANTIKIALQDFNRYKARDLVNAIDSLYLNYSKQEKTKENKQKI
A0A640Q161      V--------D-----N-TQLMRITVTTESPSLSAELANAVADVYIENYLQAKLDMTAKAT
A0A640QU49      V--------D-----N-TQVMRITVTTESPNLSAELANAVADVYIENYLQAKLDMTAKAT
A0A1Q3PII2      PN-------K-----T-ASLVNLSWQDVLPRKGEAILSQLIARYMKASIAEKNKVADNTI
A0A351BXT2      QK-------R-----G-LDVVDIIVESPAKYEAMLIANLYSKVYQSFSLDLSREELTSLT
A0A2K8Z965      TG-------K-----G-STVILISLEDGVPSKGEAVINQLITEYDQAAIMDKNKVAANTL
A0A418M8U8      TS-------K-----A-STVVVLTLEDAVPEKGEAVLNQLIDEYNQAAIIDKNKVAANTL
I2GTA4          TS-------K-----A-STVVVLTLEDAVPEKGEAVLNQLIEEYNQAAIIDKNKVAANTL
A0A2K8ZAJ2      TT-------M-----L-STVLVMNLQEAVPSRGEAILNQLISEYNKEAVVDKNNQASSTL
A0A368JPA3      SG-------K-----E-STVLVLTIEDAVATKGEAILNQMIANYSSASTTEKNRAVANTL
A0A5N1JI29      SG-------K-----E-STVLVLTIEDAVPTKGEAILNQMIANYSSASTNEKNRAVANAL
A0A3P1BT12      SS-------K-----T-STVLVLTIEDAVPAKGEAILNQMIANYSSAATDDKNRVVASTL
A0A3P1CI15      SS-------S-----T-SSVLVLTIEDAVPAKGEAILNQMIVNYNSAATVDKNRVVASTL
A0A4R8CUK1      SS-------D-----A-STVLLLTFEDAVPAKGEAILNQIIANYHSAAIGDKSRMIANSL
A0A3D0MYJ7      ---------K-----N-LNIIDISVKSTSFPEASLISIIYANSYLSYSLELSKSELTLKR
A0A662AH13      ---------R-----G-LDIVTISYESHSPFEARLIANTYADAYEGLSLRYTRQQLTTVV
A0A5C7QA01      RG-------K-----L-TGVLGLNYQGADKIHITQVLNAILKAYSVQNIERRTAESAQTL
A0A3D3LS70      ---------R-----G-LDIISIDVDSPSRTEARLIANVYAAAYLNYNLEFSRKGVKNVG
A0A1G1TM36      IN-------K-----V-APAIRLQIKDQVPQRGIDVLNQLIAAYNNASATEKNKLTANAL
A0A1G7ZF38      PN-------K-----A-ASLVNLSIQDVLPRKGEAILNQLIERYQKASIQEKNKVADNTI
C6VS52          PN-------K-----I-ASMVNLSIQDVLARKGEAILKQLIVRYQKASIDEKNKVADNTI
A0A2A4G4B1      LS-------D-----K-THGLTLTMEVEQAERGQLILEELVATYNKLEQDDKNLISENTA
A0A0P7X1V8      AD-------R-----N-SNLLRVSYRSPSPYEASRVVDLAIETYTDVSTRINRSQARNAI
A0A5C8KAD6      SG-------K-----L-STVVDIRLRDEVPERSEDILNYLINSYNDMAVLDRNELAANTL
A0A5N1J695      AN-------K-----L-STVINITLEDPVPQRGEAILNNLIYAYDQAALNERNTLAANTM
A0A1H4ADG3      SD-------K-----Q-TSIINLSLNTTIPEQGIDIMNGLIHVYQLSNIEDNNRITDSTI
A0A5B8VUR8      SD-------K-----Q-TGIINLSLNTTIPQQGIDIINGLIHRYQLSNIVDNNRIADSSI
A0A3N2M1H3      VN-------Q-----D-AEIIGLTIRDVSVQRAEDILNTVLLVYNENWIEDKNKMAVATS
A0A4S2G8T2      VN-------Q-----D-AEIIGLTIRDVSVQRAEDILNTVLLVYNENWIEDKNKMAVATS
A0A1T5K9D4      NN-------S-----A-ETVLNLSIQDFSLQRANDILTAIVYRYNEEAVKEKNKVAVNTA
A0A077ENE7      ME-------E-----E-ASLMQVTMTDDSSERAADILTSLITVYNDVYLQDKSKIAENTA
A0A6I5UW06      ME-------E-----E-ASLMQVTMTDDSSERAADILTSLITVYNDVYLQDKSKIAENTA
T0NN57          MD-------E-----D-ASLLQITMEDQSPERAADIITMLITVYNEVSLEDKNKIAVNTA
X5K347          MD-------E-----D-ASLLQITMEDQSPERAADIITMLITVYNEVSLEDKNKIAVNTA
A0A212K7W5      SN-------E-----D-ATIIDISLNDVSAQRAEDILDTLITVYNKNWIQERTQIAVNTS
F5IU11          SN-------E-----N-ATIINISLNDVSAQRAEDVLDTLITVYNKNWIQDRTQIAVNTS
A0A6I1IYY4      AG-------K-----G-TTMVQITCVGNNVSRADAILSALINVYNETIIEDKNRIAVNTA
K0XJ09          AG-------E-----R-TTLVQINCVDSNISRAEAILNALIDVYRETIIEDKNRIATSTA
R5EUZ0          AG-------E-----R-TTLVQINCVDSNISRAEAILNALIDVYRETIIEDKNRIATSTA
W0EQS0          AG-------E-----R-TTLVQINCVDSNISRADAILSTLIDVYRETIIEDKNRIATSTA
A0A1Y3WE15      AG-------E-----R-TTLVQINCIDSNTSRAEAILNTLIDVYRETIIEDKNRIATSTA
A0A1Y4GUK3      AG-------E-----R-TTLVQINCVDSNISRAEAILMALIDVYRETIIEDKNRIATSTA
A0A352Z1R7      VG-------N-----R-TNIVRISYSSTDPVQARDLVNTLVQVYLGQNIELKTEEASRTV
A0A3N2N6F7      SN-------E-----D-ASVIDFAIKDDNVQRGDDFLSALIDIYNEKWVEQKAQMAVATS
A0A4P7VVU7      AD-------D-----N-STVIDFTIKDVSIQRADDFLNTLIDIYNEKWVDDKAK-AKSTS
A0A2V1ILM4      AD-------D-----N-STVIDFTFKDVSIQRADDFLNTLIDIYNEKWVDDKAKMAKSTS
A0A3N2L0E8      AD-------D-----N-STVIDFTIKDVSIQRADDFLNTLIDIYNEKWVDDKAKMAKSTS
A0A3N2LFC5      AD-------D-----N-STVIDFTIKDVSIQRADDFLNTLIDIYNEKWVDDKAKMAKSTS
A0A0A2F501      NN-------D-----K-ASIIDIAYQDRSIQRAEDFLNMLINVYNESWVKDKNQVAISTS
R5B7P0          AD-------K-----N-ADVISLSIKDVSTQRAQDILNTLIAVYNENWVRDKNQIANSTS
R5B0L5          KE-------K-----L-GNTINLSVMDYSPERAVDLLNGVIAVYNEKWLADKNQVSVSTA
A0A6I1TEC0      NE-------E-----K-TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTS
A0A3R5XWG1      NE-------E-----K-TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTS
A0A646GTR1      NE-------E-----K-TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTS
A0A5P0Y910      NE-------E-----K-TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTS
A0A414YFM3      NE-------E-----K-TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTS
A0A6A7UIA7      NE-------E-----K-TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTS
A0A6A7VPS3      NE-------E-----K-TTIVNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTS
A0A374THP7      SE-------E-----K-STVIDLTYKDVLPKRAEDVISTIISVYRKNWLEDKNQMTISTS
A0A6G1VND1      SE-------E-----K-STVIDLTYKDVLPKRAEDVISTIISVYRKNWLEDKNQMTISTS
A0A0A2EVS5      IN-------D-----K-TSILELSYTDVSIERAEDFLDTLISVYNENWVKDKNKIAVSTS
A0A1T4NAJ7      IN-------D-----K-TSILELSYTDVSIERAEDFLDTLISVYNENWVKDKNKIAVSTS
A0A255T941      DN-------K-----E-GTVITLTTEATSPKKAEDILNTLIEVYNENWILDKNQIAISTS
A0A3N2KCL3      SG-------D-----K-SSVINLTVTDQSTQRSQALLNTLIGVYNEYWVRDKNQIAVSTS
A0A4P7VSV0      SG-------D-----K-SSVINLTVTDQSTQRSQALLNTLIGVYNEYWVRDKNQIAVSTS
A0A2V1IJY1      SG-------D-----K-SSVINLTVTDQSTQRAQALLSTLIGVYNEYWIRDKNQIAVSTS
A0A4P7VXK7      SG-------D-----K-SSVINLTVTDQSTQRAQALLSTLIGVYNEYWIRDKNQIAVSTS
A0A1Y4CHN5      AN-------E-----D-ATIINLSITDVCIQRAEDVLNTLIAVYNENWLKDKNQIAVSTS
A0A1M6I2S6      GN-------E-----D-ATIINLSIDDVSIPKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A1Y3V692      GN-------E-----D-ATIINLSIDDVSIPKAEDILNTLIEVYNEKWIQDKNQIAVSTS
F3PXM2          GN-------E-----D-ATIINLSIDDSSVWKAEDILNTLIEVYNEYWIRDKNQIAVSTS
A0A3E4ZNL4      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A174AHH7      GN-------E-----N-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A174JCE8      GN-------E-----N-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A3E4JMC4      GN-------E-----N-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A412SND6      GN-------E-----N-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A414IEQ9      GN-------E-----N-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A415UKN5      GN-------E-----N-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A6I0U0V8      GN-------E-----N-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A6I2PDH7      GN-------E-----N-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A0M1W8D8      GN-------E-----N-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A3R6GKX5      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A7V4S1          GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
B0NU19          GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
D4V601          GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A4Q0U3M9      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A4R4H1Q2      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A6I0GII7      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A6I0KYU7      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A397WLT5      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A6KY94          GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A173UQR8      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A3R6HK75      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A412B7D1      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A412VNY9      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A414LTU9      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
I9Q4U4          GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A6A2J529      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A3R6GM96      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A015XH67      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A078RZN2      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A4R4I3T9      GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A6L0K5          GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A7ACT5          GN-------E-----D-ATIINLSIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A373ISF0      GS-------K-----E-ATIINLSINDTSIARAEDILNTLIEVYNEKWIQDKNQIAVSTS
U6RF62          GS-------K-----E-ATIINLSINDTSIARAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A662ZZD5      GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTS
A0A3A5TI83      GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTS
A0A415NEB6      GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTS
A0A6I0I238      GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTS
A7AJ60          GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTS
A0A6A2JF01      GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTS
A0A6I0Y2Y2      GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTS
A0A6I2Q447      GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTS
A0A395YYT3      GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTS
A0A015UXN7      GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTS
A0A5M5W148      GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTS
A0A6I2NTL0      GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTS
A0A016E4F9      GN-------E-----D-ATIINLSIDDASIPKAEDILNTLIEVYNEKWIQDKNQIAVSTS
A0A4Q5CFJ7      GN-------E-----D-ATIINLSIDDASIQKAEDILNTLIEIYNEKWIQDKNQIAVSTS
A0A6H9P0U9      GN-------E-----D-ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTS
A0A108TH71      GN-------E-----D-ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTS
I8VXH0          GN-------E-----D-ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTS
A0A412S0N6      GN-------E-----D-ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTS
A0A412IIJ0      GN-------E-----D-ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTS
A0A0P0FM97      GN-------E-----D-ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTS
R6KTP3          GN-------E-----D-ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTS
A0A139LU87      GN-------E-----D-ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTS
A0A1C6B3Y5      GN-------E-----D-ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTS
E2NMQ4          GN-------E-----D-ATIINLSINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTS
A0A412YDB9      GS-------D-----D-ATIINLSISDASIRKAEDLLNTLIEVYNENWIQDKNQIAVSTS
R7DY01          GS-------D-----D-ATIINLSISDASIRKAEDLLNTLIEVYNENWIQDKNQIAVSTS
A0A414LGK8      GS-------D-----D-ATIINLSISDASIRKAEDLLNTLIEVYNENWIQDKNQIAVSTS
A0A415IPQ4      GN-------E-----D-ATIINLSINDASIQKAEDILNTLIEVYNENWIQDKNQIAVSTS
A0A3E5BRW7      GN-------E-----D-ATIINLSISDASIRKAEDLLNTLIEVYNENWIRDKNQIAVSTS
K9DXS6          GN-------E-----D-ATIINLSISDASIRKAEDLLNTLIEVYNENWIRDKNQIAVSTS
A0A1M6KFV3      GN-------E-----D-ATIINLSINDASTRKAEDILNTLIEVYNENWIQDKNQIAISTS
A0A1Q6G7L3      GN-------E-----D-ATIINLSINDASTRKAEDILNTLIEVYNENWIQDKNQIAISTS
A0A413H235      GN-------E-----D-ATIINLSINDASTRKAEDILNTLIEVYNENWIQDKNQIAISTS
A0A1M5B2J8      ND-------E-----K-SNIISLSFQDVSIQRAEEVLNTLISVYNENWVKDKNQIAVSTS
A0A255RCT5      DD-------E-----K-SNIISLSFQDVSIQRAEEVLNTLISVYNENWVKDKNQIAVSTS
A0A1Y4GLF5      NN-------E-----K-ASVIDLSFKDLSTQRAEDVLNTLISVYNENWVKDKNQVAVSTS
A0A1H3XSC0      SS-------E-----K-TSIVNLTFRDHSIQRAEDILNTLISVYNENWVKDKNQIAVSTS
A6LE40          NN-------E-----K-ASVIDLSLKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A4Y1VPX5      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
B3JI46          NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
R6NN15          QS-------E-----K-TTIVDLTFKDVCIQRAEDILNTVIAVYNENWIKDKNQIAVSTS
A0A358R8U0      SD-------K-----K-ASAIDLTFRDVSTQRAEDVLNTMISVYNENWVRDKNQIAVSTS
R6WSB6          SD-------K-----K-ASAIDLTFRDVSTQRAEDVLNTMISVYNENWVRDKNQIAVSTS
A0A401LPX7      ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
A0A6I0J0P8      ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLIAVYNENWVRDKNQIAVSTS
A0A6I1BFM0      ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLIAVYNENWVRDKNQIAVSTS
A0A6G0GNY9      ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLIAVYNENWVRDKNQIAVSTS
A0A3A5Z900      ND-------E-----K-SNIITLSFQDVCTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
A0A285TGL6      ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
A0A3A5RFX4      ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
A0A1Q6IUW9      ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
A0A3R6NPG7      ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
A0A413XDP6      ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
K6AP24          ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
A0A6I2NHV3      ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
A0A662ZYI7      ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
A0A078RYI7      ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
C7XEQ8          ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
D7INX6          ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
K5ZG55          ND-------E-----K-SNIITLSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTS
A0A3N2N9B8      GS-------D-----N-SSLIRLTLSDRSIERADDVLSTLIDVYKDAWIRDKNEIAVSTS
A0A3N2NMI0      SG-------E-----N-SSVIRLTLSDRSIQRADDVLATLIDVYKDSWIRDRNEIAVSTS
A0A359I8H7      AD-------K-----D-ADVIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATS
A0A3N2KA63      AD-------K-----D-ADVIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATS
A0A4Q0IMT7      AD-------K-----D-ADVIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATS
A0A3B9FAU3      TD-------K-----M-STLVRISYKDKEPYRADDIINTLITVYKESWVREKNMLTIATT
A0A3C1E5L7      AD-------K-----M-STLVRISYKDKEPYRADDIINTLITVYKESWVRDKNMLTIATT
A0A4Q0UAV1      KE-------F-----S-TSIINLIMTDESPQRAEDVLNTLLDVYNQRYVIERNQAAQAAS
A0A354SN68      RE-------D-----G-SSVVNITCNGEHIGMLNDILNAVIKAYNKKWVEDRNQVALNTS
A0A3N2N595      NN-------K-----E-GTVIDLTLNDRSTQRAQDLLNTLIGVYNEYWISDKNQVAVSTS
A0A0A2DUD9      AD-------E-----K-STILSLSLLDRSQERADAILNTLVATYNESWLADRNLSAVSAS
A0A3P1ZBJ5      KE-------K-----E-STMVDISINDVSVERAEDVLKTLIDVYNQNWVEDKNQVAVNTS
R5FHS9          AD-------N-----K-AAVINLEMQDVNIQRAEDILNTIIAVYKDRWVRDKNQVAVATS
A0A413TW79      SE-------E-----K-ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTS
A0A3E5E9M7      SE-------E-----K-ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTS
A0A3E4SK73      SE-------E-----K-ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTS
A0A415GGC6      SE-------E-----K-ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTS
A0A413DBH9      SE-------E-----K-ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTS
A0A1Y4PQK7      ND-------E-----E-STVLSLSYRDVSPARAEDILNTVISVYNENWVKDKNQVAVSTS
A0A1Y4IH41      ND-------E-----E-STVLSLSYRDVSPARAEDILNTVIAVYNENWVKDKNQVAVSTS
A0A3A6AAP4      ND-------E-----E-STVLSLSYRDVSPARAEDILNTVIAVYNENWVKDKNQVAVSTS
A0A6I0ZRD2      ND-------E-----E-STVLSLSYRDVSPARAEDILNTVIAVYNENWVKDKNQVAVSTS
A0A1Y4DYA7      KD-------E-----K-STVINLSIEDVCIQRAEDVLNTLIAVYNENWVKDKNQIAVSTS
A0A1Y3X4I9      ND-------E-----K-STVINLSLEDVCIQRAEDVLNTLIAVYNENWVKDKNQIAVSTS
A0A1Y4FNK8      ND-------E-----K-STVVNLTFTDVCTQRAEDVLNTVIAVYNENWIKDKNQIAVSTS
A0A355FD59      SD-------E-----K-VTVIDLSYNDVSTQRAEDVINTLIAVYKENWIKDKNQITVSTS
A0A359CEZ9      SD-------E-----K-VTVIDLSYNDVSTQRAEDVINTLIAVYKENWIKDKNQITVSTS
A0A353Q7B4      SD-------E-----K-VTVIDLSYNDVSTQRAEDVINTLIAVYKENWIKDKNQITVSTS
F8X3A5          SE-------E-----K-ATVIDLSYKDVSTQRAEDVLNTLISVYKENWVKDRNLITVSTS
A0A1M3KVR9      SE-------E-----K-ATVIDLSYKDVSTQRAEDVLNTLISVYKENWVKDRNLITVSTS
A0A4Y9IJS3      SE-------E-----K-ATVIDLSYKDVSTQRAEDVLNTLISVYKENWVKDRNLITVSTS
A0A495WI87      ND-------E-----K-STVVDLSFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTS
A0A354M4S6      ND-------E-----K-STVVDLSFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTS
R7DH52          ND-------E-----K-STVVDLSFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTS
A0A4Q5E7L5      NN-------E-----K-ASVIDLSYKDNSIQRAEDMLNMLISVYNENWVKDKNQVAVSTS
A0A4P8LP09      NN-------E-----K-ASVVDLSFRDNSIQRAEDVLDMLISVYNENWVKDKNQIAVSTS
A0A4R4GZU7      NN-------E-----K-ASVVDLSFRDNSIQRAEDVLDMLISVYNENWVKDKNQIAVSTS
A0A016CWA4      NN-------E-----K-ASVVDLSFRDNSIQRAEDVLDMLISVYNENWVKDKNQIAVSTS
A0A1C6H117      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A0M1W0V2      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A139KA16      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A174VQ92      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A1Q6HCG0      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A1Y4JYM9      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A3A5QW67      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A3A5RQE6      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A3A6BP07      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A3E5E153      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A3Q9IP20      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A412WV15      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A413ICP6      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A414KYB9      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A5B3FWR2      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A6I0WNS4      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
E5WX00          NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
K0X3P3          NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A415TAH7      NN-------E-----K-ASVIDLSFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTS
A0A078T2W6      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I1AQV4      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A5C6L2P1      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSSS
A0A412MJT7      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A3E4WKT5      NS-------E-----K-ASVINLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A3A5YY33      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A078TAH2      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A1E9CFZ7      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A373FYU5      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A3A5TZ72      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A3A5XBP2      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A3A6MEG9      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A3E4JP35      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A3E4KP40      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A3E4NX82      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A3E4XFU8      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A412RG70      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A412TD37      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A413GAA4      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A414M7I4      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A496BTA0      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A496D2V6      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A4Q5G1P5      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A5C6KCA6      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A5M5AHM5      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I0KZV6      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I0Y5K7      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I1BFB8      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I2P5W5      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
E5UZA2          NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A069SMG6      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
C3RFN5          NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A3A5Z014      NN-------E-----K-SSVIDLAFKDNSIQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I0ING7      NN-------E-----K-ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTS
A0A6I2P894      NN-------E-----K-ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTS
A0A078S3Q8      NN-------E-----K-ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTS
A0A069SJV7      NN-------E-----K-ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTS
A0A3E5DXI5      NN-------E-----K-ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTS
A0A3E5EM98      NN-------E-----K-ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTS
A0A3E5F453      NN-------E-----K-ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTS
I9T3G6          NN-------E-----K-ASVIDLAFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTS
A0A3E4SYU0      NN-------E-----K-ASVIDLAFKDNSTQRAEDVLSMLISLYNENWVKDKNQIAVSTS
A6LGY1          NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
K5ZSH4          NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6A2RTB3      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I0VY00      NS-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A1M4YZ07      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A4Q5E5M7      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A0P0FQW1      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A5M5C0W6      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I0H151      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I0HI59      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A642LZ22      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I0IP89      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A642NJ89      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I0HI52      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I0YVB5      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6G0G4T5      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A6I0HFG9      NN-------E-----K-ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTS
A0A416GA42      AS-------K-----E-SSMIQLNITDPVPQRAEDILNTLVDAYKEDIVNDKNTVARNTE
A0A1T3IYP5      ME-------E-----D-ASLLQVSMEDQSPERAADVLTALINVYNEVYLQDKNKIAENTA
A0A3P1Z8V4      YS-------K-----E-SSLLLLTCTDINKHRAEDVLNEVCNIYKKDIVDNKNRVAQRTA
A0A060RD97      AD-------K-----V-SSVVNLSFIDQSPQRATAVLNTLIAEYNTESIMDKNRIARNTD
A0A3C1ITV0      AD-------K-----L-ATVINFSYTDASEKRAEDVLNTLLDAYNEEWIRYTNKSTDNTA
R7HN19          AD-------K-----L-ATVINFSYTDASEKRAEDVLNTLLDAYNEEWIRYTNKSTDNTA
A0A350IHV0      SG-------K-----E-STVLVLSLEDTFPRRAEDILNTLIDVYNEQWVANKNRSARNTT
R5RVP0          SG-------K-----E-STVIVLTMKDRFPSRADAVLRTLIDVYNEHWVENKNRSARNTT
R6A0L2          YD-------K-----E-TSLIVLNCNDTNIERADQVLATLYDTYKEDVVENKNRVALNTA
R7LG80          IE-------K-----E-ASLIGLTFQDINPKRAVDVLNTLYNTYKEDVVENKNRVALNTA
A0A2L2WX98      DK-------K-----E-SSLIILGCEDINETRAEDIINVVFDAYKRDIVANKNRVANNTA
A0A285T4L1      EE-------D-----E-SSILVLSLKDDSPLRAEDVLNTLVNVYNEEALNDKNQVAVNTS
G5GD56          YD-------K-----E-TSLVVLSAQDINTARAEDLLNTVYEAYKHDVVDNKNRVASSTA
R5KD55          GD-------K-----K-STILDLSYNDVSGKRAEDILSAVIDIYNKVWMKNRNEVSAGAT
A0A174QNT3      MD-------Q-----K-STLVNIVYQDVNIARADAILATILQVYNETIVEDKNRIASNTA
A0A4S2FGS1      MD-------T-----K-STLVNIVCQDVNIARADAILTSILQVYNETIVEDKNRIASNTA
R9I0H0          LA-------S-----Q-STLVNIICQDVNIARADAILTSILQVYNETIVEDKNRIASNTA
K5BUT9          AG-------E-----R-TTLVQITCSDTNISRADAILAALVKVYSETIIEDKNRIAANTA
A0A174FPA3      AG-------E-----R-TTLVQITCSDTNISRADAILAALVKVYSETIIEDKNRIAANTA
R6S9Y6          AG-------E-----R-TTLVQITCSDTNISRADAILAALVKVYSETIIEDKNRIAANTA
A0A642LIH6      AG-------E-----R-TTLVQITCSDTNISRADAILAALVKVYSETIIEDKNRIAANTA
C9KX15          AG-------E-----R-TTLVQITCSDTNISRADAILAALVKVYSETIIEDKNRIAANTA
A0A6H0KRK1      AG-------K-----G-TTMVQITCTGDNISRADAILNALINVYNETIIEDKNRIAVNTA
R6DAG6          AG-------K-----G-TTMVQITCTGDNVSRADAILNALINVYNETIIEDKNRIAVNTA
A0A3L8AAP1      AG-------K-----G-TTMVQITCTGDNVSRADAILNALINVYNETIIEDKNRIAVNTA
A0A4S2AYX2      AG-------K-----G-TTMVQITCTGDNVSRADAILNALINVYNETIIEDKNRIAVNTA
A0A4Y9H477      AG-------K-----G-TTMVQITCTGDNVSRADAILNALINVYNETIIEDKNRIAVNTA
A0A0E2M2Y7      AD-------K-----N-ATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTA
A0A0K2J6Z0      AD-------K-----N-ATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTA
B2RKZ8          AD-------K-----N-ATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTA
A0A212GC82      AD-------K-----N-ATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTA
A0A254MU12      AD-------K-----N-ATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTA
R6CQ93          EE-------D-----E-SSILVLSLKDDSPLRAEDVLNTLVNVYNEEAVNDKNLVAVNTS
A0A3D1NQW3      AN-------K-----Q-ASIITISMKSSVPKKAEDVINTLIAVYEKDAIDDKRGIAESTG
B0MT10          AN-------K-----Q-ASIITISMKSSVPKKAEDVINTLIAVYEKDAIDDKRGIAESTG
R7JGW9          AN-------K-----Q-ASIITISMKSSVPKKAEDVINTLIAVYEKDAIDDKRGIAESTG
A0A3D2BF46      VE-------K-----Q-ANAISISLDDNIPRRAEDVINTLIARYNDESINDKNRIADYTA
A0A358R538      AN-------K-----Q-ASVVTVTMSNTVPRRAEEVIDALVAVYNEDAVEDKRRISVVTS
A0A1Y4AAB8      ED-------K-----Q-TSVVGIAMNDAVPKRAEDVINTLITVYNNDAIADKRRISEETA
A0A1Y3WWY9      A--------K-----Q-GSVVTISMSNSVAKRAEDVINTLIDVYEKDAIDDKRRVSVTTA
A0A1Y4U5L4      A--------K-----Q-GSVVTISMSNSVAKRAEDVINTLIDVYEKDAIDDKRRVSVTTA
A0A1Y3VCJ1      TN-------Q-----Q-ASVVTLSMNNAIPKRAEDVLNTLIEVYEQDAINDKRRVSVSTA
A0A1Y3QTW7      AN-------K-----Q-ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTN
R6XWY7          AN-------K-----Q-ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTN
A0A4Y1X9Y9      AN-------K-----Q-ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTN
A0A4Y1WM66      AN-------K-----Q-ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTN
A0A174AVF1      AN-------K-----Q-ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTN
A0A656Q4F4      AN-------K-----Q-ASIVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTN
A0A1Q6EIY0      AN-------K-----Q-ASIVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTA
A0A5B5VN71      AN-------K-----Q-ASIVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTA
E4M8L3          AN-------K-----Q-ASIVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTA
I3YQ50          AN-------K-----Q-ASIVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTA
R5UEY8          AN-------K-----Q-ASIVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTA
A0A1H4D866      AN-------K-----Q-ASVVTISMNNSVPRRAEDILNTLISVYNEDAIDDKRRVSVTTA
A0A5B3G4Y7      AN-------K-----Q-ASVVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATG
A0A374A9J5      AN-------K-----Q-ASVVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATG
A0A5B3GQN5      AN-------K-----Q-ASVVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATG
A0A1Q6E9S3      AN-------K-----Q-ASVVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATG
D4IJ36          AN-------K-----Q-ASVVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATG
A0A414Q925      AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
A0A415PUS9      AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
A0A108TCU0      AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
A0A413BA42      AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
S3Y344          AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
A0A4Q5G8Y8      AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
A0A412TGL3      AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
A0A413VJ33      AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
A0A414L0W6      AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
A0A412DP39      AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
A0A413ZSE8      AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
B0NP84          AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
R6AK43          AN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
A0A412N2D9      TN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
A0A1Y4JYS9      TN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
R6LHA4          TN-------K-----Q-SSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTA
A0A3E5HPT8      MS-------G-----D-AALLSMTMNDLSPTRAADILDMLITVYNEEAIKDKNRISVNTA
C6IJ48          MS-------G-----D-AALLSMTMNDLSPTRAADILDMLITVYNEEAIKDKNRISVNTA
Q8A3U2          MS-------G-----D-AALLSMTMNDLSPTRAADILDMLITVYNEEAIKDKNRISVNTA
A0A3R6S1H6      AD-------K-----K-ASIINLAIEDVSKARAEDIINTLIVVYNEDAINDKNQVAINTS
A0A3R6SD81      AD-------K-----K-ASIINLAIEDVSKARAEDIINTLIVVYNEDAINDKNQVAINTS
A0A354WXN6      AS-------K-----T-STIINLTLQDRSIPRADDVLNTLIAVYKEDVINDKNQVAVNTS
R5IP14          ES-------K-----N-GGALNITMNDTDIKRAEDVINTLIAKYNEDAIADKNRLAVNTA
A0A316SZX7      IG-------K-----T-TSSVSITLQDPNPKRAEDVINTLIDVYNLDGTNDKKKVAESTA
A0A1Y4AIY1      VA-------E-----Y-ATIIKLSLSDVSASRAEDVLNTLIAVYNEDAIEDKNRITVSTS
A0A0J6CIR2      AS-------K-----T-ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTS
A0A3D8HG59      AS-------K-----T-ATIINLTLQDESIQRAEDIVNTLIAIYNEDVINDKNQITVNTS
A0A3R6S408      AS-------K-----T-ATIINLTLQDESIQRAEDIVNTLIAIYNEDVINDKNQITVNTS
F3ZRU7          AD-------K-----K-ATIINLSLRDEVPQRAEDILNTLIDVYNEEAINDKNQMAMNTS
A0A1C5Q1F3      AS-------K-----T-SSIIHLSISDVSPRRAEDILNTLIDVYNQDAIDDKNRIAVNTA
R7A239          AS-------K-----T-SSIIHLSISDVSPRRAEDILNTLIDVYNQDAIDDKNRIAVNTA
A0A3R6HIK7      AD-------K-----M-STIINLSLSDVSIARAEDVLNTLIAVYNEDAIEDKNRVTVSTS
K5ZVW7          AD-------K-----M-STIINLSLSDVSIARAEDVLNTLIAVYNEDAIEDKNRVTVSTS
A0A1Y4D5Z0      AS-------K-----T-ATIINLSLSDVSISRAEDVLNTLIAVYNEAAIDDKNKVTISTS
A0A413VXJ7      AS-------K-----T-ATIINLTLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTS
I9RSN9          AS-------K-----T-ATIINLTLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTS
U6RJK5          AS-------K-----T-ATIINLTLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTS
A0A1Q6GA32      AS-------K-----T-ATIINLTLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTS
I9RPU6          AS-------K-----T-ATIINLVLDDVSTARAEDVLNMLIAVYNEDVINDKNQIAVNTS
I8YFS5          AS-------K-----T-ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTS
A0A6H9LTF8      AS-------K-----T-ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTS
I8Y597          AS-------K-----T-ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTS
A0A1Q6GBF5      AS-------K-----T-ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTS
I8YFZ3          AS-------K-----T-ATIINLVLDDVSIARAEDILNMLIAVYNEDVINDKNQIAVNTS
A0A6H9M1J1      AS-------K-----T-ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTS
A0A1Q6GDH2      AS-------K-----T-ATIINLVLDDVSTARAEDILNMLISVYNEDVINDKNQIAVNTS
U6RSB0          AS-------K-----T-ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTS
I9GXM2          AG-------K-----T-TTIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTS
I9SIK1          AG-------K-----T-TTIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTS
A0A6H9LZ74      AG-------K-----T-TTIINLVLEDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTS
I9TP59          AG-------K-----T-TTIINLVLEDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTS
R5S343          AD-------K-----S-TTIIYLTLQDVSVARAEDVINTLIEAYNEDAVNDKNQIAINTA
A0A1M6K7I9      AS-------K-----M-ATIIDLEYKDESIARAEDILNTLISVYNEDAINDKNQIAVNTS
A0A5M6A8C8      AS-------K-----M-ATIIDLEYKDESIARAEDILNTLISVYNEDAINDKNQIAVNTS
A0A6H9LT84      AS-------K-----T-ATIINLVLDDVSTARSEDILNMLIAVYNEDVINDKNQIAVNTS
A0A6H9LUV5      AS-------K-----T-ATIINLVLKDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTS
A0A3R5ZMK1      AS-------K-----T-ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A3E4ZTK7      AS-------K-----T-ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A1Y3ZIA4      AS-------K-----T-ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
K5Y1A4          AS-------K-----T-ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A4Q5CIT0      AS-------K-----T-ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A3R6K8X4      AN-------K-----A-STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A414GI87      AN-------K-----A-STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A415BDM7      AN-------K-----A-STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A412DM15      AN-------K-----A-STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A7AEU7          AN-------K-----A-STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A1Q6I3T6      AN-------K-----A-STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A414XX40      AN-------K-----A-STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A3R6BKI7      AN-------K-----A-STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A414LPI6      AN-------K-----A-STIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A412M2W1      AS-------K-----T-ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
K5ZX55          AS-------K-----T-ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTS
A0A5F0U645      AS-------K-----T-ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTS
K5ZBN2          AS-------K-----T-ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTS
A0A0J6CKW3      AS-------K-----T-ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTS
A0A0F5IQM7      AS-------K-----T-ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTS
A0A496CDT3      AS-------K-----T-ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTS
A0A6G1ZKM3      AS-------K-----T-ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTS
S0GLB0          AS-------K-----T-ATILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTS
A0A3R6NLC1      AS-------K-----T-ATILNLSLQDASVSRAEDVLNTLIAIYNEDAISDKNQVMVNTS
A0A416WYC9      AS-------K-----T-ATILNLSLQDASVSRAEDVLNTLIAIYNEDAISDKNQVMVNTS
A0A0F5IT40      AS-------K-----T-ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTS
A0A496CX20      AS-------K-----T-ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTS
A0A5F0UBI0      AS-------K-----T-ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTS
A0A6G1ZHG0      AS-------K-----T-ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTS
S0GSI7          AS-------K-----T-ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTS
K5YB65          AS-------K-----T-ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTS
A0A0F5IWP9      AS-------K-----T-ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTS
A0A0F5IZT8      AS-------K-----T-AAIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTS
A0A417LKQ2      AS-------K-----T-ATIINLTLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTS
A0A416TME1      AS-------K-----T-ATIINLTLQDVSIPRAEDILNMLIAVYNEDAINDKNQVTVNTS
A0A416XPE8      AS-------K-----T-ATIINLTLQDVSIPRAEDILNMLIAVYNEDAINDKNQVTVNTS
A0A3B0C2S4      TD-------K-----R-SEVLSLSIKGQSPERSETVINELINKFNQDGIIDRQLISKRTL
L8JI02          IS-------R-----E-SNIVELSMRGSVPHKTARFLDQLLHIYLQNELHKKNQLGVKTI
A0A4Q5WS95      AG-------K-----L-SSIVRLKYNDEVPQRGEDILNNLIHDYNAASIDYKNSVARNTI
A0A501VZX6      EN-------K-----L-STVVNFTLYDQIPARGEDILNTLIYTYNSIAINERNKLAANTL
A0A399SH26      AN-------K-----L-STVVNLQLKDAVPERGEAILNLLVHNYNQASVVERNILAENTL
A0A501W1A9      PG-------K-----L-SSVVNLYIEDQTPERGEDILNSLIKAYQQAALNERNQAVAQTL
A0A0E3ZGV6      AG-------K-----L-SSVVNLYLEDKVPERGEDILNALIHAYQKAAVTEKNSLVSQTL
A0A1I2N4S1      PG-------K-----A-SSVVNLYIEDNVPERGEDILNALIDAYLQAAQVDRNALVSQTL
A0A2T5YE44      PG-------K-----A-SSVVNLYIEDNVPERGEDILNALIDAYLQAAQVDRNALVSQTL
A0A1V9FHD0      EN-------K-----L-SSTMDLTYSDAVPQRGEDIMNHLLLAYNQLSIDEQRGTAANTL
A0A4V4H170      AS-------K-----L-STTINLTFRDEVPERGEDILNKLLVAYNRLSIEEKKGTAANTL
A0A1V9F098      SS-------K-----L-SSTINLTFRDEVRDRGEDVVNKLLVAYNRLSIEEKKGTAANTL
A0A4R2VU64      AS-------K-----L-SSTINLTFRDEVPQRGEDILNKLLVVYNRLSIEEKKGTATNTL
A0A4S8HY23      SS-------K-----L-STTINLTLRDEVPERGEDILNKLLIAYNLLSIEEKEGAAANTL
A0A1V9F383      PN-------K-----L-STTIDLTLRDPIPRRAEDILNKLLIAYHLQSIEEKKGMAANTL
G8TRZ6          PN-------K-----L-SSTIDLTLRDEIPKRGEDILNRLLTDYTQQSIDEKQDQATNTL
A0A543WA52      TN-------K-----L-STVVSISYNDPVPKRGEDIINRLIYNYNQKAVTDRNALASSTL
A0A1M5BA90      AS-------K-----L-STVIDLAIMDEVPERGENILNTLIQAYYRSAAKEKNVLAANTL
A0A512B879      IN-------K-----L-SSVIHLTIKDEVTQRGKEILNLLISEYNQAAINDKNLLTSNTL
A0A559PPI3      PE-------K-----L-STVINLYLQDAVPNRGEDILNGIIAAYNQNGIEDKNILAANTM
A0A1T5CS78      SN-------K-----L-SSVVNLSIKDEVPERAENILNRLIYQYNQKIIKDQNELALSTM
A0A0Q9Z8F1      SN-------K-----L-SSVVNLTIRDAVPERAENILNRLILEYNRKIIKDQNELAASTM
A0A2N0U0M7      SN-------K-----L-SSVVNLTIRDAVPERAENILNRLILEYNRKIIKDQNELAASTM
A0A2N3U785      IN-------K-----E-TKVIAIELTEPVPEKGIDLVYHLISLYNKDKANDKKASAVNSL
A0A0D3L8Q3      DK-------L-----AWSSALILSLVDPVPEKGKDILNKLIEVYNKEAVEDKNVIAANTI
A0A0E3ZG78      VN-------K-----S-ASVLWVGLTDPIPEKAKDIVNKLIEVYNKEAIEDKNLIASYTI
A0A1I6BRK6      VG-------K-----T-TNVLNISLIDPMPERAKNIVDKLMQVYNDEAIDDKKQLGTSAL
A0A243WAB1      VG-------K-----S-ASVLSLSLVDPIPEKAKDILDKLMEVYNDEAVVDKNLMATSTL
A0A6G8C8X6      VS-------D-----G-ASVLSLSIVDPIPEKARNIINKLIEVYNKEAIEDKNLMATNTL
A0A5B6TJH8      AG-------K-----TWTNVIKLELTDSKPERAKDILNKLVEVYNKESIEDKNVLATNTL
A0A519U664      VG-------K-----S-SNVLTLSLVDPIPEKAKNIINKLMYVYNRESIEDKNLMAVSTL
A0A519UDD1      IN-------K-----N-ASILYLSLTDPIPAKAKDILNKLMEVYNKEAIEDKNLLATNTL
A0A519MA34      VG-------K-----S-SNVLALSLVDPIPEKAKNIINTLMHVYNSEAIEDKNLMAVGTL
A0A519UCX0      VG-------K-----S-SNVLNLTLIDPIPEKAKNIINKLMHVYNNEAIEDKNLMAVSTL
A0A4R5DL69      TN-------K-----Q-VSIISLRLTDILPRKGEALLKKLTENYLSTSITDKNRIADSTI
A0A1M4YED3      NP-------K-----S-STVLTLYFQDESAYRAKDVLNELMNVYTINGLSEKDALAANTL
A0A2H3NSN0      AE-------A-----D-QGLIRIVARSQYPEEAAAVANTYADAYRAYSRESARAGVAAAR
A0A2P6C324      PD-------Q-----Q-QGLINIRVESQDPAEAALIANSFAQQYRLFSREMARAGVVAAR
A0A1M6XHU0      PL-------S-----D-QDMIVITAESTTPEEAAVIANRYAEEYEKYSRERSRESLAAAR
A0A5S9C8G0      PL-------S-----D-QDMIVITAESTTPEEAAVIANRYAEEYERYSRERSRESLAAAR
G2SF81          PL-------S-----D-QDMIVITAESTTPEEAAVIANRYAEEYERYSRERSRESLAAAR
A0A5S9EYW1      PL-------S-----D-QDMIVITAESTTPEEAAVIANRYAEEYERFSRERSRESLAAAR
D0MHQ9          PL-------S-----D-QDMIVITAESTTPEEAAVIANRYAEEYERFSRERSRESLAAAR
A0A126PFG0      IN-------K-----I-SPAISLQIKDEVPQRGMDVLNQLMAVYNGAATAAKNKLTANTL
A0A3M1N7Z3      PK-------R-----G-TTILQVSVTDISPVRATRFLNALIEQAREHERSIRQLQYTKAL
                                      .                                     

A0A1T5MMH4      DWLNNELQQIELKMEGFEDYFERFTL-KNKTNDLQ-----EDLRKTIESINKIDS---QR
A0A2W4R1L8      TWLTNELKQIEEKMSQYENYFEDFIL-ANKTSNLD-----EELANTIRLIHEIDS---QR
A0A2E5CV79      EFMDDLVNQQEGKLLLAEDSLKQFKI-ENSFFSSD-----GEASSVARQISALEN---DI
A0A2D4ZVH1      EFLRTERTKLESELVSTEDSLQNFMN-RTLLIAVD-----PQTEEIISTIANLEV---EK
A0A0K8QSK7      NFIHSQLGEISDSLSISETEMLQFQS-DNRVIDLS-----AQSQQLLQQMSELDN---QR
A0A1V6CN82      NFIEYLLEGVSDSLAVAEGELLSFQS-RNRIFDIG-----SQSGQLLSEMSELDS---KK
A0A1M4XZ45      HFISSQLQSISDSLSVSENRMETFQS-ENQVLDIS-----MQSQQLLEQMRDLDQ---QR
A0A399D319      QFISSQLQSISDSLSISESRMETFQS-EHQVLDIS-----MQSQQLLEQMRELDE---EL
A0A1M6GR99      EYIDEQLDEVSASLNLTENNLQKFMS-QNKLMNID-----EQSTRLAQQRLDLQN---QL
A6EBM4          GFINEQLKHLSSAVSGAEKSLETYKQ-QSKVMDIS-----VTSEHTLDKVSDLES---QQ
A0A1M6TTV4      SFLDRQMKKTQVELEQYEDYFEKFTI-QNRTTDLS-----RDLNNTIQLLNQLDS---QR
A0A4Q8RX32      DFIDNQLSQVFDSLNLAEKSLQEFRT-QKQVIDVG-----MKASQIYDNLNALMA---EK
K0X1U5          SFIDERLITVEEELHEAERIVERYKR-ENDLSDID-----AEAKIILEANSQYRK---LL
R5EXK3          SFIDERLITVKEELHEAERIVERYKR-ENDLSDID-----AEAKIILEANSQYRK---LL
A0A401UAP7      DWVNNELEQIEEKMSQYEDYFKDFTL-KNKTQDLT-----ADMSRTVEQINALDT---SS
A0A1W2GF52      RFLETQMAKTSKELVEYEDYFEKFTI-KNRTTDLS-----SDLTKTIALLNELDS---QR
A0A2G5L7B8      SFLETQMYKSQIELEQFEDYFEKFTI-KNRTTDLS-----QDLNYTIRLLNQLDS---QR
A0A523GAC0      DFLDDQLLLTQSKLQDYESYFESFTI-RNKTTDIQ-----TDLSNTIKAITVLDS---QN
L8JW09          EWLNSELRQIETQLEGYEHYFENFTI-KNRTSDLN-----EDLKRTIETINALDS---QR
A0A364XUP5      DWLNNELQQIEEKMEGYENYFKHFTL-QNKTNNLD-----EDLKRTVTAISRLDS---QR
A0A1M5RLA9      DWVSNELVNIEHKMEDFENYFENFTL-QNKTNNLD-----EDLKKTVSAINRLDS---QR
A0A385SFR9      DWVSNELVNIEHKMEDFENYFENFTL-QNKTNNLD-----EDLKKTVSAINRLDS---QR
A0A5M4A9J4      QFISSQLGSVSDSLTASERHREQFQS-RNNLLDLS-----YQSQQLLDQMVSLQE---QK
A0A5M4B1C7      QFISSQLSSVSDSLVKSEQRRESFQS-KNKLLDIS-----YQSQQLLDQMVTLEE---QK
A0A0D3LFR6      AFLNTLVEDAESKLEGYETYFEDFTI-SQRTTNLN-----KDISNTILLLESVDS---QR
M7N6D4          AFLDEQVEETEAKLEDFESYFENFTI-DYKTTNLA-----GDINRTIIMMEAIDS---QR
A0A4D7K1D4      AFLEEQMGNTAQTLENYENYFESFTI-ENQTVDLQ-----KDMAETIQFLNQLDS---QK
A0A5C7MX19      SFLNVQIGQFEEGNTAFEDSISALRV-QFGYMDK------NELQTMSSEVSSTNI---II
A0A1Q3ZMZ7      NFLNNQLDSLAIELNKSRDSIVFFQQ-KNKLNNPD-----NVADQLIQKIDEANE---ES
A0A2D8JJW3      IFLKNQILSNSDSLLKMKDEIQKFQQ-AEDILSSD-----GNANEHVEQFLKLKS---ER
A0A2W2AFF7      RFIDDRVALVGEELTGIEKKIEAFKK-ENELTDIG-----EESKILLGSTSDYMK---QL
R7PCR1          KFIEERIGLIEQDLIKVEGSLARFKE-KYNIVDFQ-----KSAEAFLQQQGTARN---LA
A0A2N5YXE2      TYIDQQMENVFLQLTNTEQNLHDFKQ-QNNIRSNTETLLFNKTNLYTTKMSELES---KL
A0A1G9E2A9      KFLDDQLDSTAQKLAQQEESIEDFVR-ENRTLSIS-----STIGQTLEQIKNLRF---ER
A0A098LL25      KFLEASLLKTEENLAKAEKDLETFVR-NNRTVDVK-----QDFGKSGIKIEELEK---EK
A0A6C0GJI1      EFLEGQLLATEKNLEKYELEQEDFIV-KNRTTDVK-----SDVSKFVTNIEELNK---QR
A0A2T2YJE8      SFLDEQLKETNENLGNSEIQMENFVK-ENKTYDVR-----ADVSKSITKLEELNK---ER
A0A127B287      DFLSNQLQETQDNLQKAEIDMEYFVK-QNKSYDVK-----AGLEGAMTQIQELEK---EK
A0A3M9N829      NFLTEQLKETENSLKKVEDEIESFVR-QNKSYDIR-----SSFQEAITEYRELEQ---KK
A0A0P0CSF9      NFLNEQLKETEDSLRKAENDIERFVR-QNMSYDLK-----ANFQEALAQVQELEK---EK
A0A5M8QQB8      SFLNEQLKETEDSLRKAENDIEQFVR-QNKSYDIK-----ANLQEALSMVQELEK---EK
A0A3M9MNC3      TFLNDQLKETEDSLRKAENDIERFVR-QNKSYDIK-----SNLQEALAQVQELEK---EK
A0A5B6TAX2      SFLNDQLKETEDSLRKAENDIERFVR-QTKSYDIK-----SNLQEALGQVQELEK---EK
A0A5N1IQ33      AFLEGQLDENSRKLQQAEVALQDFVR-RNKTFDVK-----NDMGTIVEQTAEMQK---ER
A0A512AYT3      KFLDQLLKETETNLQNSEENMESFVR-QNRTYDIK-----AEVGTQLAKLETLNN---ER
A0A5M6CYN7      QFLNEQLKETQDNLANSEGKMENFVR-ENRTYDVK-----ADVSTQISKLEELGK---AR
A0A369QP10      SFLDEQLKETNENLGNSEIQMENFVK-QNKTYDVR-----ADVNKQMTKLEDLNK---QR
A0A126PDF2      RYLDQQLEVNYDNLERAENRYQGFVE-KTKTYDVK-----SEVAALASRGEDLEE---QR
A0A2Z3GKA1      RYLDQQLEVNYDNLERAENRYQGFVE-KTKTYDVR-----SEVAALAAKGESLEE---QR
A0A502GZP7      RYLDQQLDVNYDNLQRAENRYQGFVE-KTKTYDVK-----SEVADLAAKSEDLEE---QR
A0A519SBU8      SYINQVIADNDKLLRQAEDTQQEFVR-QNKTYDIK-----SEVSAIKGQMESLLK---ER
A0A4Q3JNZ3      GFIDRVIAENDKKWQAAEEAQKEFVR-RNKTYDVK-----GDMATIRGNLEKQQD---ER
A0A519Q9V3      KFIDQVIADNDKRWRAAEEAQKEFVR-RNKTYDVK-----GDMATIKGNLEKQQD---AR
A0A0M3RW20      QYLDEQLDITRDSLQRAELALQRFVK-ANKTYDVK-----ADVGTLTEKLAEQEK---ER
A0A495VFX4      EYLDEQLDVTRDSLQRAELALQRFVK-ANKTYDVK-----ADVGTLTEKLAEQEK---EK
A0A1S9B3W0      TFLDGQLVENRDKLQNAEEALQNFVK-QNKTYDAK-----SDLGAITQELSELQK---ER
A0A1W1VRL3      QFLSEQADAFNNKLQLAEDNLQSFAR-ENRTYDVR-----ADAATVNGKILAQEE---KR
A0A1M6R305      QFLQQQLAENRQNLAVAEENLQSFAR-QNKTYDVK-----ATIGDLTGRLEKQEE---ER
A0A4Z0PHK3      QFLDKTLTENQQQLQGAEENLQAFVR-ENKTYDVK-----SELALITGKLAKQEE---ER
A0A2M9B9H9      QFLDKTLTENQQKLQSAEENLQAFVR-QNKTYDVK-----TEVAGITEKLAEQEE---VR
A0A4Z0QCY9      KFLDRTLAENQDKLQDAEANLQAFVQ-QNKTYDVK-----GEVSAITEKLAKQEE---ER
A0A418R9X5      NYIDRQLGVNSDKLSQAEAKMQDFVR-KNKVFDVK-----SEAGLVTNQLNMLES---QQ
A0A428JSJ3      SYIDQQLGINDNKLGQAESNMQDFVK-RNRVFDVK-----SEASLINNQLTTQEA---EQ
A0A428KI59      NYIDKQIDINDNKLGQAESNMQDFVK-RSRVFDVK-----SEANLVTNQLTAQEL---EQ
W8F1I6          NYIDKQIDINDNKLGQAESNMQDFVR-RSRVFDVK-----SEASLVTNQLTAQEL---EQ
A0A246FQC0      GYINDQLGDNNQKLNQAEEAMQSFVK-RTGSYDVK-----GDVGQITGLLMELEE---ER
A0A372E5P8      RYINEQLGSNNQSLSQAEENMEAFVK-RTGSYDVK-----GEVSQLTGLLQTLEE---ER
A0A1H3EMW1      RYINEQLSNNNESLGQAEENMQSFVK-RTGSYDVK-----GEVGTITGLLQELEV---ER
A0A1H9ZSN3      RYINEQLGSNNQSLSQAEEAMEAFVK-RTGSYDVK-----GEVGQITGLMQELEE---ER
A0A5N1J2M4      SFLREQLDATKVSLQEAEANLEAFAK-KNKSYDIK-----SDVSASRLKIEELMK---ER
A0A519S476      SYLDKLIDETDKRFKAAQELQQQFVL-RNKTYDIT-----TEVEGLKTRLEKQQD---TR
A0A4Q3JRW8      QFIDQVIADNDKRWRAAEEAQKEFVR-RNKTYDVK-----GDMASIKGNLEKQQE---AR
A0A519M923      KFIDLVIADNDQRWRAAEEAQKEFVR-RNKTYDVK-----GDMTAIKADLEKQQE---DR
A0A4Z0ENW1      DYLDKQLQENGKNLANAEDNLKEFVQ-QNRTYDAK-----GELGIITDKLEKIEE---DR
A0A519UDB4      AYLDQQLAANGINLAKAEDNLKTFVE-QNGTYDAK-----GQLGDISEKLLEIQK---GR
A0A3S0QKV1      AFLQGQLLDNRAKLQDAEKALEEFVR-QSKTYDAK-----ADVGTLTTQLSDLRK---ER
A0A328BL48      AFLDSQLNGNRDSLQKAENALQAAVK-RNRTYDAK-----GDLATITTQMQELAK---QR
A0A5R8WLY4      AFLDSQLNGNRDSLQKAENAFQAAVK-RNRTYDAK-----GDLTAITTQLQELAK---QR
A0A1I5WSL8      KFLDQILDENGQNLERAEDRLQSFVQ-KTGTYDTR-----AELEAISGKMEKLEA---ER
A0A0U3JVM7      RFLDQILDQNGQNLERAEDRLQNFVQ-QTGTYDSK-----GEFSAITEKLEKLEA---DR
A0A1G1SSV2      RFLDQILDQNGQNLEDAEDRLQKFVQ-KTGTYDSK-----GEFEAISGKLEKFET---ER
A0A1G1SXV7      RFLDQILDQNGQNLEDAEDRLQNFVQ-KTGTYDSK-----GEFEAISAKLEKFET---ER
A0A6G8CBJ6      RFLGEQTDVTNNKLQQAEDNLQSFAR-ENKTYDVR-----RDAATVIDKIAIQEE---KR
A0A0W8EDI5      AFLEGQLDQNSQRLQGAEEALQEFVK-RNKTYDVK-----SDLATITEKMEALEE---EK
A0A3B7RBP8      AFLEGQLDENRNKLQGAEVALQEFVR-RNKTYDVK-----SDVANIAEKMAALQE---ER
A0A3R9P8H7      SYINEQLGENNQKLGQAEENMQAFVK-RNGTYDVK-----GDVGQIMTALKEQET---ER
A0A238WIA7      RYLAEQSEENRRLLRQAEEQLQDFMK-RNNLFDAE-----SELGTVTSAITTQQE---ER
A0A212UCJ7      RYLADQSNDNRQLLRQAEEQLQEFMK-QNRLFDAE-----TELGSLTTILTTQQE---ER
A0A4Z0MQE1      RYLAEQSEDNRQLLRQAEEQLQDYMK-QNKLFDAE-----SELGSLTTLLNSQEE---ER
A0A4Z0PCF4      RYLAEQSDENRQLLRQAEEQLQNYMK-QNKLFDAE-----SELGSLTGTLKEQEK---ER
A0A5D6VDG1      QYLDKQLELTRDSLQRAEIALQSFAK-RAKMYDVR-----SGVQTITDQLDEQEK---EQ
A0A6H1CVS0      QYLDKQLELTRDSLQRAEIALQSFAK-RAKMYDVR-----SGVQTITDQLDEQEK---ER
A0A243WHR7      KFLETQIVENKDSLQGAEKNLEKFTD-RTKTYDVR-----GDLASISDKLLEQEK---ER
A0A5B8A0P6      EFLDKTLTENKNKLEAAENNLQGFVR-RNKTYDVR-----SDVSTVIAKLAQLEE---DR
A0A076HRT9      QFLDQQLTENRQSLAQAEENLQDFAR-QNKTYDVR-----ASIGEITARLEKQEE---ER
A0A4Z0PVM7      QFLEKTLAENQQKLQGAEANLQAFVQ-QNKTYDVK-----GEVSVITDKLAKQEE---ER
A0A1M6DHW8      QFLEKTLSENRKQLQLAEENLQSFVR-DNKTYDVK-----ADVAAITEKLAAQAE---EQ
A0A4Q5LC61      QFLEQTLAENRTQLQNAEENLQSFVR-NNKTYDVK-----ADVAAISEKLAEQEE---ER
A0A2U1FKU2      TFIDERLAMIGGELGSVDTEIETFKK-QNNITDIT-----TDVGTYLKNSSDLQK---DQ
A0A0A2F954      SFIDERLAMIGGELGSVDTEIETFKK-RNNITDIS-----TDVGAYLKSSADLQK---DQ
A0A0A2FW91      AFIDERLAMIGGELGSVDTEIETFKK-SNNITDIS-----TDVGAFLKSNADLQK---DQ
A0A2D2N2N1      AFIDERLAMIGGELGTVDTEIETFKK-RNNITDIS-----TDVGTYLKSSADLQK---DQ
Q7MWZ2          AFIDERLAMIGGELGTVDTEIETFKK-RNNITDIS-----TDVGTYLKSSADLQK---DQ
T2NDT6          AFIDERLAMIGGELGTVDTEIETFKK-RNNITDIS-----TDVGTYLKSSADLQK---DQ
W1R7P9          AFIDERLAMIGGELGTVDTEIETFKK-RNNITDIS-----TDVGTYLKSSADLQK---DQ
A0A1R4AFZ0      AFIDERLAMIGGELGTVDTEIETFKK-RNNITDIS-----TDVGTYLKSSADLQK---DQ
A0A1R4DVZ7      AFIDERLAMIGGELGTVDTEIETFKK-RNNITDIS-----TDVGTYLKSSADLQK---DQ
A0A2A8CVM9      DFLETQAEKRREEIRELEQQWETFAQ-NNQVVTQGIGGE-RLVAEYTELTARRDA---LR
A0A5M4B212      FFITSQLASVSDSLSASQKVRERFQS-HNNLLDVS-----YQSQQLLDQLVKLED---QK
A0A3D1KEX9      KFVDQRIDLIGSELNDVENKLAKFKQ-NNKIVDFT-----ENARTYLQQSALSQQ---EL
A0A358Y7S2      DFIDYQLDSLSRVLEISKEDLANFQK-RERLPNIE-----KIGDNLSENLTNYSK---VI
A0A1X7J248      QFLNKQLKQTESELANYETYIEDFTI-ENKTINPS-----DDVSRLIAEMVKMDS---IL
E4TQD2          EFLNKQLKQTENELSNYETYIEEFTI-KNKTVNPS-----QDVSRLISEMVSMDS---IL
A0A2J6HHN3      EFIDGQLGIVEENLTESEDSLYKVSV-ASPDSL-------EDKTGLKSRMRELDR---LI
A0A1Y3WMT8      SFIDDRLATVENELHEAERVIEQYKR-ENDLSDID-----TEAKIILEANSEYRK---LL
A0A1Y4GQU1      AFIDDRLITVENELHEAERVIEQYKR-ENDLSDIN-----SEAKIILEANSQYRK---LL
A0A6A0R272      RFIDERLDQLSSTMNEVEDQITQFKQ-DKRIIDFE-----SVERIESERLIDLES---SK
A0A1V5W8T5      AFIEEQMSVVYNKLDESEKQLDQFKK-SNNITGSIF----DDKAAIQNALMDNSQ---QI
A0A2T8HKA9      DFIRERIAIIERDLGTVETDLERIKM-DNKGMDVN-----EAAGMYITESREYLN---AS
A0A2I0QZ80      GFIASQLDSLTRELSISKDSVMRFQR-NENITNPE-----HLSGSISSKIEFLRT---EE
A0A3E1F1A3      DFINQQLDSLTQELSVSKDSIMYYQR-RENITNPE-----YLTSSVASKMEKLKA---EE
A0A2U2XBJ3      EFIAVQLDSLTRELKMAKDSIMVYQR-MENITNPE-----QIAANTSQKIEKLRT---EI
A0A4Q4KU94      DFIAVQLDSLTQELKVAKDSIMAYQR-QENITNPE-----FIASTTSQKIEILKL---EE
A0A3B8INU3      EFLDDQLMQTEERLDRYDKYFENFTI-SNQTTDLS-----SDLQKTIQQIWTLDT---LL
A0A2W1NDY9      SFIDEQLDTVYNSLKFSENSIQSFTN-ISKNNNPA-----LYKENLLDQIDQLRT---EV
A0A5C8AQR5      QFIESQLDSLALELKLSKDSLTDYQR-SSNLPDPE-----GITSELNGNISKLKD---QL
A0A1G0CI31      QFINKQLDSISGELQISKDSLTLFQR-SAQLNDPE-----TDGLSLTQNMDQFQD---QL
A0A556N0M0      SFIQLQLDSISGELKDSKDSLTDFQR-KTRLTDPE-----NTNGSLTENMDKFQD---ML
F2IKD6          AFIQIQLDSISGELKDSKDSLTDFQR-KSHLTDPE-----GTGGSLSENMDKFQD---IL
A0A1I7BM74      KFINAQLDSLNKELILSRNALTEFQR-RENLSDLE-----NIESNLSAKVNTLEN---EL
A0A2G2FJ17      SFISLQLDSLRKELSASKDSIMYFQR-KENLPDPE-----NLGESIATKLEKYRF---DK
A0A2E3R1D0      EFLEDQVETQNDRLQETDAAVEQYML-REGAVALQ-----EETSRLVDQIATLDA---RR
A0A2T2USC0      KFLEQQSKKFRNRVNRAEQRLEKFMR-EENAVALD-----QETQQIVQQISEMQA---RR
A0A2T2V0F3      KFLEQQASKFKNRVDRAEQELESFMQ-EEKAVALD-----QETSRIVDQIANLQT---RQ
A0A2T2S682      DFLDQQSDKFATQVQQADRALAKYMQ-KEEAVSLD-----QEASRLVQQLSELEA---RR
D5H561          TFLEQRSQELERELETIEQRIQRFQR-SEDAVSLD-----QRQGSLTSRIAETES---SL
A0A2H3NWA9      DFLKEQSESLRVDMEEAEQNLVDFMQ-REEAVALD-----EETSSTVSRITSLES---ER
A0A2A8CVB6      DFLERQAEKLKAEVQAAEGEIENYMQ-REGAIALD-----QESGRIVSDIAQMEA---EQ
A0A2P6C1S6      QFLEEQADTLRQDVQAAEQKIEEYMQ-RENAVSLD-----QETGRVVQQISELEA---QR
A0A2T2UTM4      EFLEEQADTLRQEVQAAEQKIENYMQ-EEKAISLD-----QETGRVVQQISELES---KR
A0A414ZBF2      NFIKDRLTIIEADLGVIDTEIEDYKR-ENKLTDVT-----SESALLLQNSSRLGG---ES
A0A1Q3Q573      RFIDGQIDSFSREQQAIQDSVAQFKI-NNEIFSDD-----NSSQGILTSANALQQ---AL
A0A662BAY3      NFISTQLQTVSDSLGISENAMQAFQS-KHKLLNIS-----IQSEQLLDQVNELEK---EK
A0A4U3L369      SFINERLGIVTGELGNVEKQIALYKG-NNKIISPD-----VQAQLMASTYDENFK---LG
A0A357YNR3      RLIDDQLSKLSGELSDVENQVQIYKQ-SQGITDIA-----AQANLYNNQMANVGQ---RR
A0A5E8AX52      SFLDEQLGITERKIEEYEDYFENFTI-ENRTTNIQ-----TDLGRTIVLLQSLDS---QR
F4KK08          RFVDDRLAIISSELGQVDAEIEDFKQ-SQQIADIQ-----AEAQEYIKGSSEVKT---RL
A0A6B5PK86      QFIEVQLDSLSTELKRSKDSLMDYQR-EVNLSDPE-----KEGDLMQTDANKFQE---EL
A0A2G2F510      GFIDSQLDSLSNELKSSKDSLMIFQR-KSNLPNPE-----EAASNITDNISKLQD---QL
A0A316JZ08      SFINNQLDSLYFELQSSQDSLADFHS-KSSVVDPE-----LSGGELNEKLNDLEL---QL
A0A496LCF9      QFINSQLSIISDSLTQSESNLNSFKI-ANNMYGE------NNTTILTSKMDELQQ---VG
A0A5P2G2A9      SFINDRLGLVSGELTNAESGLADYKK-KNNIADLE-----AQAQAVISSSSEYEK---QL
A0A3C0ZQC7      EFLDTQLKVRKSSLDESEGTLQKYME-QKGIVSLD-----DEAKKVIDQLATLEA---QR
A0A419VXB7      HFINQQLKDIVDTLKSTSNEFTKYRS-SNKVFDLS-----QEATLVTGKLSNLDT---KR
A0A0B0BTJ4      RFIDERLQAVEGELSDVDTAIEKFKS-DNSAVDII-----SETKLSLETSRQYED---DL
A0A3B9CNN6      RFIDERLQAVEGELSDVDTAIEKFKS-DNSAVDII-----SETKLSLETSRQYED---DL
R5X290          RFIDERLQAVEGELSDVDTAIEKFKS-DNSAVDII-----SETKLSLETSRQYED---DL
A0A1Q6E6I7      RFIDERLQAVEGELSDVDTAIEKFKS-DNSAVDII-----SETKLSLETSRQYED---DL
C3J7R8          HFIDGRLAIIGGELGSVDTEIEQFKQ-NNRIADIQ-----QEARSYITGTAEFAR---QM
A0A1G8BVM8      DFITDKTTILENELRSIDSDIEQYKK-EKNLTDIP-----SVSSMYLDASSRINA---EA
A0A1I1FXP9      AFLNSQLDTTAQKLAMSEKEVERFIQ-VNRVIDVR-----DQVAEMITHVEKLKK---DK
A0A3N4H5N3      NFIDERLALAREELNQVERDAEQYKQ-RNRITDIG-----LDSRIFLESTQEMRK---EI
A0A2P8EAX2      KFLDEKLFLAKKELDSLEMYVERFKQ-RNRVTDIG-----LDSRIYLESTASTSK---EI
A0A4V2F6N9      KFLDEKLLVAKKELDSLEMYVERFKQ-RNRVTDIG-----LDSRIFLESTASTSK---EI
A0A3B9FXJ0      SFIQSQIDSLENELYIQENILKDFKK-DAQLINPS-----IAEQNLMTKFNELDQ---NK
R5GSU5          IFIDSRIKIIGDELNDVEGSLARFKE-RNQIVDFE-----KSAQSALEEQRTLRL---SM
A0A2A3UE91      SFIDSQLGNVYDALKDTEGDLQKFKK-DKNISEKD-----KIITTELMRYSTIED---QM
A0A0A2G557      AFINDRITIISKELGDVDQEIERFKQ-NNQIANIA-----SEAEVYIESSKEITK---QT
A0A2N2WFW8      DFIDTQLGLVEDNLDQTEDSMRQGKN-MSFDST-------LDRSSLQARLFELDN---LL
A0A1F3IU95      EFIDSQLGQVEENLDQTKDSLQQSSA-PSVDSS-------LDRTALQSRLFELDN---LI
A0A3D0VUF6      EFIDSQLGQVEENLDQTKDSLQQSSA-PSVDSS-------LDRTALQSRLFELDN---LI
A0A1T4PT95      AFINDRITIISKELGDVDHEIERFKQ-NNQIANIE-----SEAEIYIESSKEITK---QT
A0A6I6JYY3      QFINSQLQNISDSLNVSENRMASFQS-ENQVIDIS-----LQSQQLLEQMKELDN---ER
A0A2A4PYG9      EFIDSQLLQVYDKLRSSENKMQGFKR-ENKLSQQ-----GDFITVYVXKLDNIEN---EL
A0A1F3K695      SFIEEQESTFVKNIDETEKALHDFKK-ENNINISESELNTLSLNLYASKIEEIET---EI
A0A353KZR1      SFIEEQESTFVKNIDETEKALHDFKK-ENNINISESELNTLSLNLYASKIEEIET---EI
A0A2N2WYB5      AFIEERLKLVYQNLDETEKQLHEFKK-ENKLNLDKYPINGSPFPIFTAKISEFED---EL
A0A1F3K4G0      AFIEERLKQVYHSLDETEKELVAFKR-ENKINTDQFKAEGSPFPLFTTKISELED---EL
A0A356H8Y3      AFIEERLKQVYHSLDETEKELVAFKR-ENKINTDQFKAEGSPFPLFTTKISELED---EL
A0A351HSA6      AFIEERLKQVYHSLDETEKELVAFKR-ENKINTDQFKAEGSPFPLFTTKISELED---EL
A0A1F3Q014      EFIDHQIDIVYEQLKSSETSIQEFTK-NNNVTNT--DIENT---AKTTRLNALDD---QI
A0A2A4YXP3      QFIDEQLDRYYNKLRLSEDKIKDFHQ-GTNYTSM--DRSSS---YF-DRSNRLEN---EL
A0A2D5KD44      DFLNAQIESVYEKQKVYERQIQRFKR-ENGITEI--DQFSK---VYIERMNQIDQ---AQ
A0A1F3R158      EFLDDQLDKYYNKVKLSENSIEEFQK-TNKLTDI--DKFSS---LYVDRVNKLEN---QL
A0A2M8ADX2      EFLDDQLDKYYNKVKLSENSIEEFQK-TNKLSDI--DKFSS---LYIERVNKLEN---QL
A0A1J5B2H0      EFIDNQINRMYDTLAKSENQLERFKK-TNKIDTIKLDVVPT---LF-SRQNELEN---QF
A0A1V5N756      KFIDEQLEIFNQKLFETKNDIQEFKK-ENKIDLI-FQPLPE---VY-SIIKEFNS---EI
A0A651GU15      RFIDNQIEEVYNELRETEFELSMFMK-DNKISDLN-----RISEFYLSYFQQYDD---RQ
A0A3Q9FR88      TYLFKQIDTTKDSLALQEKKMRAISY-GKDLSSY------MEAGPIVGNIQELEK---SL
A0A553GEX3      TYLFKQIDTTKDSLALQEKKMRAISY-GKDLSSY------MEAGPIVGNIQELEK---SL
A0A150ADJ9      DYLYNQADLTRDSLSLQEKKLREISY-NKDLSSY------MDAGPIVNNIQELEK---SL
A0A1B1FWQ4      EFLYSQIDITKDSLNNLETKMREMSF-NKDLSSY------MEAGPIVGNIQELEK---SL
A0A1S1Z228      GFLYSQIDITKDSLNNLEKTMRELSF-NKDLSSY------MEAGPIVGNIQELEK---SL
A1ZKR2          AYLNRRLGEIEDSMRTYEAKIQSFML-KFKTNDVN-----KKLEESVKEIEKLIK---EK
A0A1Q3GX01      EYLNRRLNEIEDSMRNYEGKIQAFKL-KLKTNDVN-----EKLEKSVQEIEELLK---QK
A0A349DQI4      KYLNRRLNEIEDSMRNYEAKIQGFKL-KLKTNNIN-----EKLDKSVQEIEQLIK---KK
A0A4P5TMD1      DFIDTQIGLLNTELQAYENQLKAFKI-EHSLISTD-----SKQQEILTALKEINA---NE
A0A2N3IIZ0      EYLDAQIEKTEKELNAYEAEMERFII-QNKTNNIE-----GKISELVNKIQQLTE---ER
A0A1F3SJM1      RFIDNQLDSLRKELKSSKDSLMFFQR-SANLPDPE-----SISGTITENISKLND---EL
A0A2G2EB96      SFIDDQLDSLSSEVRIAKDSLIRYQR-KSQLSDPE-----NAGISISDNVNKMQD---QL
A0A2G6PRA9      SFIDAQLDSLSSEVRIAKDSLIEYQR-RSQLSDPE-----NVGVSINENANKLQD---QL
A0A497D5Z2      KFITSQLASISDSLSISEDLMQDFQS-KNKIINIS-----LQTEQLLDQINDLDK---HR
A0A662B170      KFITSQLASISDSLSISEDLMQDFQS-KNKIINIS-----LQTEQLLDQINDLDK---HR
A0A2A5FYT6      NFIDTQIESVYGRLRTSETSMQSFQK-DNRITGND-----GFTGIYLERLNLLEN---EV
A0A2E6SYP1      KFTDDQVVKINKRLEYYRKLLKPYKE-LGSSETKDDF---DYNQLTRDLKGKDEN---EK
A0A2E5RLE8      KFTNDQILKINQKLEYYQKLLQPYKE-IQENNSEYGT---DYGKLALDLAAKDQI---EK
A0A2E7TQF6      KFTNDQILKINQKLEYYQKLLQPYKE-IQENNSEYGT---DYGKLALDLAAKDQI---EK
A0A2E6GVY9      KFTNDQILKINQKLEYYQKLLQPYKD-LQKDNQEIKT---DYGKLALDLASKDQI---EK
A0A350JJ90      EFINQQIEEVYSKLKISEDLMSEFSQ-RTKLTKKK-----GIAATYITRVNVLEQ---KK
A0A3M1CDV2      NFINAQLSVVYEELKNSETKLNEFKK-QNNIVSTDNNS--ALSTSQSQIYSSVQE---QL
A0A6C1QGZ7      AFIDQQLSLLGSTLTTAEIELENFRK-EHGI----DDVTITPLPMLQTRIADFEN---QI
A0A4P5U6G4      NFIESQINLINAELQAYENQIKAFKI-QNGLISTE-----SKISEILTALNNIKQ---KQ
A0A2E2TFD1      EFIDSQISEVYGRLKESEVSIQEFKL-SNKVTGSS-----ELTGIYLDRLGNLEE---EL
A0A2E4ELE6      EFIDHQSSEVFTRLKSSEVSIQEFKI-DNKVSKTE-----NFTEMYIDRLALLEE---EL
A0A522EYA6      SFLEDQLAIAFERLRTAETSIYSFKK-ENKVTEVK-----NMPDAGSARLNSLED---EL
A0A2E3XZI5      KFINNRKDSVQKKLILNEKKIRDFKK-LNDFENKT-----TLIENQTKRIEEIEK---EL
A0A6I7QXV0      NFLNNQIDVFSDDLAQFQDTIKKFRI-ENRYLNPT-----DEVQMVMGRLNRVEN---MM
A0A2M7NLQ9      NYLEDQVRIVQDSLERIEKRIDNYKQ-ENGITSQKPEEYQALVQNILNDIRELQE---KR
I4AFR0          DYLDAQTTIVQDSLEQVEKRMDDYKL-ENGITSQNPQEYQSLVQNILNDIRDLQA---KR
A0A2N2Y3E5      DFIENQSDLIYDELDKIEEQLILFRK-QNNIKTDDEKDL-ATYRSVIERITRVES---DL
A0A2D9D7T6      AFVDTQLDSLSTLLQKSKDSITSFQK-KSKL----SNPD-NTTVELSSRINSFKT---RQ
A0A1F3PPL5      AFIEEQLEAVYKKLSETERQIHSFKK-ENKISPNSDLNL-SAFPIYTSKIHEFDE---EI
A0A357QK06      AFIEEQLEAVYKKLSETERQIHSFKK-ENKISPNSDLNL-SAFPIYTSKIHEFDE---EI
A0A662AEA4      SFIDLQLKSVYKNLDHTEKQLHEFKK-ENKLNYNILSNQ-NSAPIFTTKITEFQN---EI
A0A0S2HYK8      AFIERQLKNVYKTLDTTESKLQEFKK-ENNIPSEALER--TPFPIFTAKIEEFEE---QI
A0A2N5ZWN6      DFIERQLKNVYQTLDNTENKLQQFKK-DNNIPSDAFER--SPFPIFTSKIEEFSE---QI
A0A2E0FJ09      EFIAMQKDSVSKKLKESERMLKDFKD-TNKI----RQVE-GMTDSYLSRIEEMES---EL
A0A1F3FZ62      KFVDDQLGLVYDQLYKTESDLDMFKR-MNKIPDRLTDM--KSPPTYFSRVNDLQS---QL
A0A1F3K211      KFVDDQLGLVYDQLYKTESDLDMFKR-MNKIPDRLTDM--KSPPTYFSRVNDLQS---QL
A0A1V6I2U9      KYIDQQMENVFTQLNATEKDLHNFRE-QNNILNIKDEYLFNKSNIYSSQISDIES---KI
A0A2H0B957      DFIEVQNNLIYQQLDSIEQLLIKFSI-THQIQGDKESST-SNVNRYANLLTKIEE---DI
A0A1F3CFW6      NFIENQNNLIYQQLDSIEGLLMQFGI-THQIRNDNDSKE-TGTERYSILLSKIEE---EL
A0A2M7E2T8      NFIENQNNLIYQQLDSIEGLLMQFGI-THQIRNDKDSKE-TGPERYSILLSKIEE---EL
A0A2M7NC69      NFIENQNNLIYQQLDSIEGLLMQFGI-THQIRNDKDSKE-TGPERYSILLSKIEE---EL
A0A1F3KLL5      DFIDEQLQSVYLQLDENEKKIHDFKK-SN-IDSALQNKL-SPLPLFTAKINELQS---EI
A0A359D1M1      DFIDEQLQSVYLQLDENEKKIHDFKK-SN-IDSALQNKL-SPLPLFTAKINELQS---EI
A0A0F2NS19      QFLDDQLDKYYNKVKLSENRIQDFQT-SKKI----GNPN-EVSSIYLDKINRFEN---QL
A0A2A5H8X6      QFLDNQLDKYYNKVKLSENRIQDFQT-SKKI----GNPN-EVSSIYLDKINRFEN---QL
A0A2H0GAU8      EFLDDQLDKYYNRVKLSENKIQDFQS-NNKI----GNPQ-EFSSIYLDRLNRFEN---QL
A0A2M8FTK1      EFLDDQLDKYYNRVKLSENKIQDFQS-NNKI----GNPQ-EFSSIYLDRLNRFEN---QL
A0A2A5B3B0      QFIDQQLDKYYNRVKGAENRIQEFQE-GTNF----STLD-R-SSIYFDRSSKLEN---DL
A0A5C6RXM7      EFVDIQLDKYYNKLKLSENKIQKFQK-DNNF----KGAD-A-TQKYFDRSTKLED---QL
A0A1F3C1M2      AFIEDQESLLLKNIDQTEREIHDFKQ-LNNIELTNQDNV-KPISIYLTKFTEIET---EI
A0A1F3DS87      AFIEDQESLLLKNIDQTERELHDFKQ-VNKIELTNQDNV-KPISIYLTKFTEIET---EV
A0A6A0R6K9      EFLNDQIYNVYEKQRVSEKEIQDFKR-ENFL----PDVD-DYSRIMIDRISQLNE---AQ
A0A2E7CT70      QYINAQKDSVDKRLKLSEQEIQIFKK-ANNV----NSSL-MANKTQLSKISEVEN---KL
A0A2D5V560      SFITRQKDSVRKRLIRNEKDLRIFKK-NNKX----NXXL-LNISGIKENXEKIEI---EI
A0A2D7K5A8      AFIKIQKDSVKNRLIKSEKDLRIFKK-NNKF----KNEL-IGITGLKDKAEKIEK---EI
A0A2E1XQ82      AFIETQKDSVKNRLIKSEKDLRIFKK-NNKF----KNEL-ININGFQDKAEEIEK---EI
A0A5C8A5B4      DFIDKQIGTVSDSLQKVENSMEQFRGVSGGMINTA-----STQDALFQERSRLED---ER
A0A4Y9ITE2      DFIETRLGSIAEELNAAEREVEAYKV-DNNFVDLV-----ADAQYIFTKKGTIDE---AL
A0A5M8NYX7      DFINDRITTITEELSSSEQKVEEYKQ-VQGMTDLT-----AEAQLFLTSQSEYSK---KI
A0A3D5KRY6      TFIDNQIAGVNYSLQSAGNMFTNFRA-ENRTVDLG-----REASLVVENLKKVEA---DR
A0A1V5IPN7      EFLGEQLDLISRRLQISEDDLRAFKN-ENKLIEIS-----ETTRKWIEQTTQVES---QY
A0A0E3V905      KFIEDRLNIVSGELASAERNVEQYKS-HQGITDLS-----VQAQTFLQTVQQNDA---LM
A0A553ETH6      EWLDNELREIESQLEDYENYFETFTV-ENRTSDLN-----EDLKNLILIINDIDS---QR
A0A640Q161      SFLTDSLEGLKKKLDVAERNLARFYE-ENQVVNID-----GVVGLAAEELEQLSK---QL
A0A640QU49      SFLTDSIEGLKDKLDIAERNLAKFYE-QNQVVNID-----GVVGLASDELEQLNK---QL
A0A1Q3PII2      AFINQNLQRISSELAEVETSIEHFRK-HHRVIDAT-----EDGRQILERFHANAS---EE
A0A351BXT2      GYLREEKENKFKDLAVAEGELEDYQK-NGGLILLD-----AQVKNVVENISVLEA---QQ
A0A2K8Z965      KFIEDRLNIVSGELSSVEKNVQSYKS-HQGITDLS-----VQAQSFLETVQQNDA---SL
A0A418M8U8      RFIEDRLAILSGELTTVEKEVERYKA-TQGITDLS-----TQAASFLQAIQQNDG---LL
I2GTA4          RFIEDRLAILSGELTAVEKEVERYKA-TQGITDLS-----TQSASFLQAIQQNDG---LL
A0A2K8ZAJ2      NFIEDRLALISGELSNVEKEVESYKS-THGITDLS-----VQAEKFLTTVKDNDL---QL
A0A368JPA3      SFIQTRLKLVSAELATLEKSIETYKA-VNGISGIG-----SGAQSLLSSLQSNDA---QL
A0A5N1JI29      SFIQTRLKLVSAELATLEKSIETYKA-VNGISGIG-----SGPQSLLSSLQSNDA---QL
A0A3P1BT12      SFIQTRLKLVSGELAGLEKSIETYKS-ANRISGIG-----SDAQALLSTLQNNDA---QL
A0A3P1CI15      SFIQARLKLVSGELAALEKSIENYKS-VNRITGMG-----SSAQALLSNLQSNDA---QL
A0A4R8CUK1      VSIQARLKQLSGEQKALEKSIEHYKS-VYRIAGMG-----PGAQWLLDTLQKNDA---QL
A0A3D0MYJ7      KFLENEKEKKFNELSIAESNLENFQK-QNGIVDVQ-----QNVSELLGKSSEVEN---IK
A0A662AH13      EFLKNQRQVQYNALLDVEEKLKDFQV-EGGIIALD-----DQAKALIDILSTFEA---QR
A0A5C7QA01      KFLDEQLPELKKQLDNAEREFNKFRQ-QYNTVDVS-----KESELYLSQSITLET---KK
A0A3D3LS70      DYLFEIKNKKLNDLNNSEAALQDFQQ-RGGIVFLD-----DQAKSIVEQIATLEA---QK
A0A1G1TM36      QFIDSRLGSLRGELNQAESAVTGYRS-QQGLADVA-----SQSQIVLENTQANDT---RL
A0A1G7ZF38      AFINSNLTHISSELTQVETNIEQFRK-RHRVIDMA-----EDGRQALQQYHSNAS---DE
C6VS52          AFINHNLERVSAELASVETNIEGLRK-QHKLIDIA-----EDTRQALQKLAANTS---EE
A0A2A4G4B1      AFIDSRLKGITKELVMVEGHLESFKT-QRVLTDLD-----MESGLYLRDNAQSRQ---EI
A0A0P7X1V8      DFLDSELDKVSMQLNYSEEQLRDFMN-QNQLVQLD-----AQAQQLIETLSTLEA---ES
A0A5C8KAD6      DFVESRIQLVEKELKDLENEVVHYKA-TNGAVDLN-----EQGKLYLRNIGDNDR---RI
A0A5N1J695      AFIEDRIKLIEKDLENVEEKVQQYKS-SQGVVNLG-----EQSKLYLQSVGENDR---KI
A0A1H4ADG3      EFLNNRLFTVGAELDSIEGNIQHFKQ-HNELADLP-----TQSQSLIANAGENAK---EL
A0A5B8VUR8      EFINNRLVTVGAELDSIEGNIQHFKQ-SNDLADLP-----SQSQSLISNAGANAK---DL
A0A3N2M1H3      AFIDERLRLIQQELGDVDSNIAKYQT-TTGSPDLI-----ASAQASMEKESNLEQ---SI
A0A4S2G8T2      AFIDERLRLIQQELGDVDSNIAKYQT-TTGSPDLI-----ASAQASMEKESNLEQ---SI
A0A1T5K9D4      EFIDSRIKIIRKELSDVEDMMSGYRS-TKKLLDAN-----ADAAEYLSESRSYGS---DI
A0A077ENE7      DFIKDRLAIIEGELGAVESNVENLKI-ANQGIDVA-----TAGSLYLNEKNQYKS---EG
A0A6I5UW06      DFIKDRLAIIEGELGAVESNVENLKI-ANQGIDVA-----TAGSLYLNEKNQYKS---EG
T0NN57          SFIKERLAIIESELGAVESDIENLKI-ANKGVDVE-----AAGGMYLSESNQYKT---EK
X5K347          SFIKERLAIIESELGAVESDIENLKI-ANKGVDVE-----AAGGMYLSESNQYKT---EK
A0A212K7W5      SFIEERLNVIEKELGGVEDSISRFKS-QNLIPDIQ-----AASNMYMARSNENDT---KI
F5IU11          SFIEERLNVIEKELGGVEDSISRFKS-QNLIPDIQ-----AASNLYMVKSNENDT---KI
A0A6I1IYY4      KFIDERIAVIGKELGDVEEELTDFKQ-RNRIIGTE-----GNGSQYLAESSRVKG---ET
K0XJ09          KFINERVEIISKELGDVENELTDFKQ-KNRIVSID-----AAATQFMSESSKMRD---EL
R5EUZ0          KFINERVEIISKELGDVENELTDFKQ-KNRIVSID-----AAATQFMSESSKMRD---EL
W0EQS0          KFINERVEIISRELGDVENELTDFKQ-KNRIVSID-----AAASQFMSENSQMRS---EL
A0A1Y3WE15      QFINERVEIISRELGDVENELTNFKQ-QNRIVSID-----AAASQFMSENSKMRD---EL
A0A1Y4GUK3      KFINERVEIISRELGDVENELTDFKQ-KNRIVSID-----ASANQFMSENSQMRT---EL
A0A352Z1R7      SFIENQLKGLRGELEGAEQDLETYKS-SSGMFKLD-----SEAQEVVKNLSETEK---LR
A0A3N2N6F7      EFINERLNVIEKELGHVDDNIATFKG-EHLVPDVA-----AASEMYMANANENTK---QQ
A0A4P7VVU7      RFIAERLRVIEQELGNVDSDIADFKG-EHLVPDVA-----AASAMYMEDANENTK---QQ
A0A2V1ILM4      RFIADRLRVIEQELGNVDSDIADFKG-EHLVPDVA-----AASAMYMEDANENTK---QQ
A0A3N2L0E8      RFIADRLRVIEQELGNVDSDIADFKG-EHLVPDVA-----AASAMYMEDANENTK---QQ
A0A3N2LFC5      RFIADRLRVIEQELGNVDSDIADFKG-EHLVPDVA-----AASAMYMEDANENTK---QQ
A0A0A2F501      LFINERLSVIEQELGHVDKDISSFKS-ANLIPDLK-----ETTRIYLDQTSEAEA---QL
R5B7P0          VFINDRLRVIEGELAGVDSDISAYKS-ENMIPDVG-----AAATMYMQQSTVLNQ---QL
R5B0L5          SFINERLAVIENELGHVDSDIASYQS-EHLIPNVQ-----QAASMYMTESQVVST---QM
A0A6I1TEC0      RFITERLGVIEHELGDVDKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QI
A0A3R5XWG1      RFITERLGVIEHELGDVDKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QI
A0A646GTR1      RFITERLGVIEHELGDVDKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QI
A0A5P0Y910      RFITERLGVIEHELGDVDKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QI
A0A414YFM3      RFITERLGVIEHELGDVDKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QI
A0A6A7UIA7      RFITERLGVIEHELGDVDKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QI
A0A6A7VPS3      RFITERLGVIEHELGDVDKDISSFKS-ANLLPDVE-----TAAQQYMQKSSDLSK---QI
A0A374THP7      HFITERLGVIERELGDVDKNISAFKS-SNLLPDVE-----AAAQQYMQKSTEVDK---QI
A0A6G1VND1      HFITERLGVIERELGDVDKNISAFKS-SNLLPDVE-----AAAQQYMQKSTEVDK---QI
A0A0A2EVS5      QFINERLSVIEQELGAVDSDISSFKS-KNLIPDVR-----TASEMYMTQAGEAGT---QI
A0A1T4NAJ7      QFINERLSVIEQELGAVDSDISSFKS-KNLIPDVR-----TASEMYMTQAGEAGT---QI
A0A255T941      QFIGERLGVIEGELGHVDANISSFKS-ANLLPDVQ-----AASALYMNQSAESKK---AI
A0A3N2KCL3      NFINERLGVIESELGNVDSDISSYKS-ANLIPDVS-----AASSMYMSQNQQISQ---QI
A0A4P7VSV0      NFINERLGVIESELGNVDSDISSYKS-ANLIPDVS-----AASSMYMSQNQQISQ---QI
A0A2V1IJY1      NFINERLGVIESELGNVDSDISSYKS-QHLIPDVS-----AASSMYMSQNQQISQ---QI
A0A4P7VXK7      NFINERLGVIESELGNVDSDISSYKS-QHLIPDVS-----AASSMYMSQNQQISQ---QI
A0A1Y4CHN5      MFINDRLKVIENELGTVDADIASYKG-ENLLPDIQ-----AASSMYMSQSQETNA---QI
A0A1M6I2S6      QFIGDRLSVIESELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A0A1Y3V692      QFIGDRLSVIESELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
F3PXM2          QFIGDRLGVIENELGHVDANIAGYKS-EHLLPDVQ-----AASSLYLMQSAENKK---EL
A0A3E4ZNL4      QFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----TASNLYMNQSAENKK---EI
A0A174AHH7      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A174JCE8      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A3E4JMC4      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A412SND6      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A414IEQ9      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A415UKN5      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A6I0U0V8      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A6I2PDH7      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A0M1W8D8      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A3R6GKX5      RFIGERLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EI
A7V4S1          RFIGERLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EI
B0NU19          RFIGERLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EI
D4V601          RFIGERLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EI
A0A4Q0U3M9      RFIGERLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EI
A0A4R4H1Q2      RFIGERLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EI
A0A6I0GII7      RFIGERLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EI
A0A6I0KYU7      RFIGERLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EI
A0A397WLT5      RFIGERLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EI
A6KY94          RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A173UQR8      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A3R6HK75      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A412B7D1      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A412VNY9      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A414LTU9      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
I9Q4U4          RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A6A2J529      RFIGERLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EI
A0A3R6GM96      RFIGERLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASNLYMSQSAENKK---EI
A0A015XH67      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A078RZN2      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A4R4I3T9      RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A6L0K5          RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A7ACT5          RFIGERLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMSQSAENKK---EI
A0A373ISF0      QFIGDRLSVIESELGHVDENISSFKS-EHLLPDVQ-----AASSLYMAQSAENKK---EL
U6RF62          QFIGDRLSVIESELGHVDENISSFKS-EHLLPDVQ-----AASSLYMAQSAENKK---EL
A0A662ZZD5      QFIGDRLSVIENELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A0A3A5TI83      QFIGDRLSVIENELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A0A415NEB6      QFIGDRLSVIENELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A0A6I0I238      QFIGDRLSVIENELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A7AJ60          QFIGDRLSVIENELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A0A6A2JF01      QFIGDRLSVIENELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A0A6I0Y2Y2      QFIGDRLSVIENELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A0A6I2Q447      QFIGDRLSVIENELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A0A395YYT3      QFIGDRLSVIENELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A0A015UXN7      QFIGDRLSVIENELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A0A5M5W148      QFIGDRLSVIENELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A0A6I2NTL0      QFIGDRLSVIENELGNVDENIAGYKS-EHLLPDVQ-----AASSLYLSQSAENKK---EL
A0A016E4F9      QFIGDRLSVIESELGNVDENIAGFKS-EHLLPDVQ-----AASSLYMAQSAENKK---EL
A0A4Q5CFJ7      QFIGDRLSIIESELGNVDENIAGFKS-EHLLPDVQ-----AASSLYMAQSAENKK---EL
A0A6H9P0U9      QFISDRLGVIESELGHVDENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
A0A108TH71      QFISDRLGVIESELGHVDENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
I8VXH0          QFISDRLGVIESELGHVDENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
A0A412S0N6      QFISDRLGVIESELGHVDENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
A0A412IIJ0      QFISDRLGVIESELGHVDENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
A0A0P0FM97      QFISDRLGVIESELGHVDENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
R6KTP3          QFISDRLGVIESELGHVDENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
A0A139LU87      QFISDRLGVIESELGHVDENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
A0A1C6B3Y5      QFISDRLGVIESELGHVDENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
E2NMQ4          QFISDRLGVIESELGHVDENISSYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
A0A412YDB9      QFISDRLGVIENELGHVDENIAGYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
R7DY01          QFISDRLGVIENELGHVDENIAGYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
A0A414LGK8      QFISDRLGVIENELGHVDENIAGYKS-EHLLPDVQ-----AASSLYMAQSAENNK---EL
A0A415IPQ4      QFISDRLGVIESELGHVDENISSYKS-EHLLPDVQ-----AASSLYMAQSAENKK---EL
A0A3E5BRW7      QFISDRLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASSLYMTQSAENNK---EL
K9DXS6          QFISDRLGVIENELGHVDENISSYKS-EHLLPDVQ-----AASSLYMTQSAENNK---EL
A0A1M6KFV3      QFISDRLDVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMAQSAENKK---EL
A0A1Q6G7L3      QFISDRLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMAQSAENKK---EL
A0A413H235      QFISDRLGVIENELGHVDENISNYKS-EHLLPDVQ-----AASSLYMAQSAENKK---EL
A0A1M5B2J8      MFINERLGVIEGELGNVDNDISSYKS-QHLLPDVQ-----AAANMYMAQASEANA---AI
A0A255RCT5      MFINERLGVIEGELGNVDNDISSYKS-QHLLPDVQ-----AAANMYMAQASEANA---AI
A0A1Y4GLF5      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASNMYMMQSSETNS---QI
A0A1H3XSC0      MFINERLRVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSNQTNA---LI
A6LE40          MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A4Y1VPX5      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
B3JI46          MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
R6NN15          MFINDRLGVIESELGHVDENISTFKS-ENLLPDVQ-----AASQLYMTERSQAQS---QI
A0A358R8U0      MFINERLGVIERELGNVDENISTYKS-ENLLPDVQ-----AASSLYMAQSSETNA---QI
R6WSB6          MFINERLGVIERELGNVDENISTYKS-ENLLPDVQ-----AASSLYMAQSSETNA---QI
A0A401LPX7      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAASMYMTQANEANT---AI
A0A6I0J0P8      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----VAANMYMTQANEANA---EI
A0A6I1BFM0      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----VAANMYMTQANEANA---EI
A0A6G0GNY9      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----VAANMYMTQANEANA---EI
A0A3A5Z900      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
A0A285TGL6      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
A0A3A5RFX4      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
A0A1Q6IUW9      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
A0A3R6NPG7      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
A0A413XDP6      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
K6AP24          MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
A0A6I2NHV3      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
A0A662ZYI7      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
A0A078RYI7      MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
C7XEQ8          MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
D7INX6          MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
K5ZG55          MFINERLGVIEGELGNVDDDISSFKS-EHLLPDVQ-----AAANMYMTQANEANA---AI
A0A3N2N9B8      QFINDRLGVIESELGNVDQDISSYKS-AHLIPDVQ-----AASSMYMSENRQIAS---GI
A0A3N2NMI0      QFINERLNVIEGELGNVDNDISSFKS-EHLIPDIA-----AASSMYMSQNQQIAS---EI
A0A359I8H7      SFIDDRLRLIERELGNVDNEIFDFKR-DHRVPNLE-----EAAKTQMKQSVEMSN---KM
A0A3N2KA63      SFIDDRLRLIERELGNVDNEIFDFKR-DHRVPNLE-----EAAKTQMKQSVEMSN---KM
A0A4Q0IMT7      SFIDDRLRLIERELGNVDNEIFDFKR-DHRVPNLE-----EAAKTQMKQSVEMSN---KM
A0A3B9FAU3      KFINERLAIIERELSGIDSDISSYKS-SNLLPSVQ-----AASQMSMQQSQESQK---QV
A0A3C1E5L7      KFINERLAIIERELSGIDSDISSYKS-SNLLPSVQ-----AASQMSMQQSQESQK---QV
A0A4Q0UAV1      QFITDRLNVIENELGDVESNISNYRS-SNLIGDGS-----STANGAMQQRQQSQN---AI
A0A354SN68      KFINERLKVIEKDLGLVDEDISSYKS-MNYVPNIG-----IATGMVMSQENSLDN---TI
A0A3N2N595      NFINERLGVIEGELGHVDSDISSYKS-ENLIPDVD-----AASTLYMGESQRISQ---EI
A0A0A2DUD9      LFIDERLGLIEKDLGEVDKNITKYKS-QHLLPDVQ-----TASNLFLNQAAQVDN---QI
A0A3P1ZBJ5      KFINERLRVIESDLGNVDKNISSYKS-SNLLPDVE-----SASKLYMQKTSANDD---KL
R5FHS9          AFIDDRLKKIELELGNVDNSISSFKS-KNLITDVD-----AVATSYLDQSTAANA---KL
A0A413TW79      HFITERLGVIERELGDVDKDISSFKS-RNLLPDVE-----TAAQQYMQKSGDVDK---QI
A0A3E5E9M7      HFITERLGVIERELGDVDKDISSFKS-RNLLPDVE-----TAAQQYMQKSGDVDK---QI
A0A3E4SK73      HFITERLGVIERELGDVDKDISSFKS-RNLLPDVE-----TAAQQYMQKSGDVDK---QI
A0A415GGC6      HFITERLGVIERELGDVDKDISSFKS-RNLLPDVE-----TAAQQYMQKSGDVDK---QI
A0A413DBH9      HFITERLGVIERELGDVDKDISSFKS-RNLLPDVE-----TAAQQYMQKSGDVDK---QI
A0A1Y4PQK7      LFISDRLAVIEGELGNVDENISSYKS-EHLLPDVQ-----TASNLYMAQNSQISS---QI
A0A1Y4IH41      LFISDRLAVIEGELGNVDENISSYKS-EHLLPDVQ-----AASNLYMAQSSQTSS---QI
A0A3A6AAP4      LFISDRLAVIEGELGNVDENISSYKS-EHLLPDVQ-----AASNLYMAQSSQTSS---QI
A0A6I0ZRD2      LFISDRLAVIEGELGNVDENISSYKS-EHLLPDVQ-----AASNLYMAQSSQTSS---QI
A0A1Y4DYA7      MFINERLEVIEQELGHVDENISSYKS-ENLLPDVQ-----AAANMYMTQSNATNS---QI
A0A1Y3X4I9      MFINERLGVIEQELGNVDENISSYKS-ENLLPDVQ-----AAASMYMTQSSETSS---QI
A0A1Y4FNK8      AFISDRLGVIEQELGNVDENISSYKS-EHLLPDVQ-----AAASMYMAQSSETNA---QI
A0A355FD59      MFINDRLKVIATELGDVDEDISSFKS-KNLLPDVE-----AASGMYMEQSRETSN---LL
A0A359CEZ9      MFINDRLKVIATELGDVDEDISSFKS-KNLLPDVE-----AASGMYMEQSRETSN---LL
A0A353Q7B4      MFINDRLKVIATELGDVDEDISSFKS-KNLLPDVE-----AASGMYMEQSRETSN---LL
F8X3A5          LFITDRLSGIERELGDVDEDISSYKR-QNLVPDVD-----AASSMYMAQSRETSN---LM
A0A1M3KVR9      LFITDRLSGIERELGDVDEDISSYKR-QNLVPDVE-----AASSMYMAQSRETSN---LM
A0A4Y9IJS3      LFITDRLSGIERELGDVDEDISSYKR-QNLVPDVE-----AASSMYMAQSRETSN---LM
A0A495WI87      MFINERLGVIEKELGSVDEDISSYKS-EHLLPDVQ-----AASSMYMAQVNETDA---QL
A0A354M4S6      MFINERLGVIEKELGSVDEDISSYKS-EHLLPDVQ-----AASSMYMAQVSETDA---QL
R7DH52          MFINERLGVIEKELGSVDEDISSYKS-EHLLPDVQ-----AASSMYMAQVSETDA---QL
A0A4Q5E7L5      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----TASSMYMAQSSQTNA---QI
A0A4P8LP09      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A4R4GZU7      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A016CWA4      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A1C6H117      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A0M1W0V2      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A139KA16      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A174VQ92      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A1Q6HCG0      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A1Y4JYM9      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A3A5QW67      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A3A5RQE6      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A3A6BP07      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A3E5E153      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A3Q9IP20      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A412WV15      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A413ICP6      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A414KYB9      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A5B3FWR2      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A6I0WNS4      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
E5WX00          MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
K0X3P3          MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A415TAH7      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSQTNA---QI
A0A078T2W6      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSEANA---QI
A0A6I1AQV4      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A5C6L2P1      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A412MJT7      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A3E4WKT5      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A3A5YY33      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A078TAH2      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A1E9CFZ7      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A373FYU5      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A3A5TZ72      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A3A5XBP2      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A3A6MEG9      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A3E4JP35      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A3E4KP40      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A3E4NX82      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A3E4XFU8      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A412RG70      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A412TD37      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A413GAA4      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A414M7I4      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A496BTA0      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A496D2V6      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A4Q5G1P5      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A5C6KCA6      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A5M5AHM5      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A6I0KZV6      MFINERLGIIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A6I0Y5K7      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A6I1BFB8      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A6I2P5W5      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
E5UZA2          MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A069SMG6      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
C3RFN5          MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A3A5Z014      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A6I0ING7      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A6I2P894      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A078S3Q8      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A069SJV7      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A3E5DXI5      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A3E5EM98      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A3E5F453      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
I9T3G6          MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A3E4SYU0      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSIYMAQSSQTNA---QI
A6LGY1          MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
K5ZSH4          MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A6A2RTB3      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A6I0VY00      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSAANA---QI
A0A1M4YZ07      MFINERLGVIEQELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A4Q5E5M7      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A0P0FQW1      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A5M5C0W6      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A6I0H151      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A6I0HI59      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A642LZ22      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A6I0IP89      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A642NJ89      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A6I0HI52      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A6I0YVB5      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A6G0G4T5      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A6I0HFG9      MFINERLGVIERELGNVDEDISSYKS-EHLLPDVQ-----AASSMYMAQSSATNA---QI
A0A416GA42      RFVVDRLAILEKELGNVDNQIASYRS-ANQLID-G-----TQSGLYLQRADQFQN---EA
A0A1T3IYP5      NFIKDRLEIIEGELGSVESNIEDLKI-ANQGIDIA-----TAGGTFLTEKNQYRS---EG
A0A3P1Z8V4      EFIDERLTLISRELSDVEHRLATFKQ-NNSIVDLT-----ATATAMTQQSIQARQ---KT
A0A060RD97      IFIMERLAKLSKDLEGVDTDIADYKQ-QSNVLDFS-----AAANMYMQTSNEIRR---DA
A0A3C1ITV0      KFIDERLMSIERELGNVDSDIERFKS-SNRLLDMN-----AETAQVTQESSKYSE---QA
R7HN19          KFIDERLMSIERELGNVDSDIERFKS-SNRLLDMN-----AETAQVTQESSKYSE---QA
A0A350IHV0      AFINDRLVVIENELGGVEESLKQYKE-THKITDIA-----SISEAYLKESTDYSA---KS
R5RVP0          AFINDRLIVIEKELGGVEENLKDYKS-SHKITDIR-----SLSAAYLEESTEYKA---KS
R6A0L2          KFIDDRIQIIGRELSSVENQLASFKK-RNQLVDFD-----KTPQAMIDESSTARQ---QS
R7LG80          RFIDERLKLIGTELSDVENNLASFKK-RNSVLDFE-----TTAQSITQESSLARQ---KT
A0A2L2WX98      IFIDERIRIIDGERIASRDQMAKFLS-DNKLTDFE-----QSAQMYLTESSAARK---QR
A0A285T4L1      EFINERLLIIERELGGVETELEAFKQ-SNQLMDIG-----SLAGQYMGEAQTYSA---DA
G5GD56          NFIDRRVALIGQELTQVENRLASFKQ-QNRVIDFQ-----QAAGTVTAQSADARQ---QA
R5KD55          KFLDERLAIIERELDNVDNDISRYKS-KNLLPDVE-----KAYSLSMERADKNSA---IL
A0A174QNT3      RFIDDRIVIISHELGEVEDQLTIFKQ-EHRIVDIN-----ANANIYLQEGSKAKE---ES
A0A4S2FGS1      RFIDERIVIISRELGDVENKLTTFKQ-EHRIVDIN-----SNANLYLQEGSKAKE---ES
R9I0H0          RFIDERIVIISRELGDVENKLTTFKQ-EHRIVDIN-----SNANLYLQEGSKAKE---ES
K5BUT9          KFIDERISIISRELSDVEEDLTDFKQ-RNQIVDMS-----ANATQYLAESSKVKE---ES
A0A174FPA3      KFIDERISIISRELSDVEEDLTDFKQ-RNQIVDMS-----ANATQYLAESSKVKE---ES
R6S9Y6          KFIDERISIISRELSDVEEDLTDFKQ-RNQIVDMS-----ANATQYLAESSKIKE---ES
A0A642LIH6      KFIDERISIISRELSDVEEDLTDFKQ-RNQIVDMS-----ANATQYLAESSKVKE---ES
C9KX15          KFIDERISIISRELSDVEEDLTDFKQ-RNQIVDMS-----ANATQYLAESSKVKE---ES
A0A6H0KRK1      KFIDERIAVIGKELGDVEEELTDFKQ-RNRIIGSE-----GNGTQFLAESSRMKT---ET
R6DAG6          KFIDERIAVIGKELGDVEEELTDFKQ-RNRIIGSE-----GNGTQFLAESSRMKT---EN
A0A3L8AAP1      KFIDERIAVIGKELGDVEEELTDFKQ-RNRIIGSE-----GNGSQFLAESSRMKT---EN
A0A4S2AYX2      KFIDERIAVIGKELGDVEEELTDFKQ-RNRIIGSE-----GNGSQFLAESSRMKT---EN
A0A4Y9H477      KFIDERIAVIGKELGDVEEELTDFKQ-RNRIIGSE-----GNGSQFLAESSRMKT---EN
A0A0E2M2Y7      AFIDERLAMIGGELGTVDTEIETFKK-SNNITDIS-----TDVGAFLKSNADLQK---DQ
A0A0K2J6Z0      AFIDERLAMIGGELGTVDTEIETFKK-SNNITDIS-----TDVGAFLKSNADLQK---DQ
B2RKZ8          AFIDERLAMIGGELGTVDTEIETFKK-SNNITDIS-----TDVGAFLKSNADLQK---DQ
A0A212GC82      AFIDERLAMIGGELGTVDTEIETFKK-SNNITDIS-----TDVGAFLKSNADLQK---DQ
A0A254MU12      AFIDERLAMIGGELGTVDTEIETFKK-SNNITDIS-----TDVGAFLKSNADLQK---DQ
R6CQ93          KFINERLIIIQRELGGVETELESFKQ-SNQLMDIG-----SLAGRYMGEAQTYSA---DA
A0A3D1NQW3      QFIDNRLEIISEELSEVDRNIEKFKK-DNKIYDIV-----SEAEQTITESAQYKT---DG
B0MT10          QFIDNRLEIISEELSEVDRNIEKFKK-DNKIYDIV-----SEAEQTITESAQYKT---DG
R7JGW9          QFIDNRLEIISEELSEVDRNIEKFKK-DNKIYDIV-----SEAEQTITESAQYKT---DG
A0A3D2BF46      DFIDKRLRIIGSELDAVDRKISTYKK-DNEMYDIT-----AQATQSLTESSQFKT---AG
A0A358R538      DFIRARLDVIGRELGDVDRGIEELKR-SNRMIDLQ-----SEAARNVTESSRYKA---EG
A0A1Y4AAB8      DFIHSRLEIIGSELNDVDRDIENFKR-DNRMVDLA-----SEATRNVEESSQFKA---EG
A0A1Y3WWY9      EFIKSRLEVIGRELGDVDRDIENLKK-DNQMVDIA-----SEATRSVTESSQYKA---EG
A0A1Y4U5L4      EFIKSRLEVIGRELGDVDRDIENLKK-DNQMVDIA-----SEATRSVTESSQYKA---EG
A0A1Y3VCJ1      EFIKSRLEVIGRELGEVDRDIENLKK-DNRMVDIS-----SEATRSLTESSQYKA---EG
A0A1Y3QTW7      AFIKERMLAIGRELGVVDSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EG
R6XWY7          AFIKERMLAIGRELGVVDSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EG
A0A4Y1X9Y9      AFIKERMLAIGRELGVVDSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EG
A0A4Y1WM66      AFIKERMLAIGRELGVVDSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EG
A0A174AVF1      AFIKERMLAIGRELGVVDSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EG
A0A656Q4F4      AFIKERMLAIGRELGVVDSEIEGIKK-SNQMIDIT-----SEATRSITESSKFKV---EG
A0A1Q6EIY0      DFIKERMQVIGRELGDVDRDIEDIKK-SNKMIDIT-----SEATRTITESTRYKA---ES
A0A5B5VN71      DFIKERMQVIGRELGDVDRDIEDIKK-SNKMIDIT-----SEATRTITESTRYKA---ES
E4M8L3          DFIKERMQVIGRELGDVDRDIEDIKK-SNKMIDIT-----SEATRTITESTRYKA---ES
I3YQ50          DFIKERMQVIGRELGDVDRDIEDIKK-SNKMIDIT-----SEATRTITESTRYKA---ES
R5UEY8          DFIKERMQVIGRELGDVDRDIEDIKK-SNKMIDIT-----SEATRTITESTRYKA---ES
A0A1H4D866      EFIKARLAVIGRELGDVDRDIEDIKK-DNQMVDIT-----SEAARSVSESSKYKA---EG
A0A5B3G4Y7      KFIKARLDVIGRELGDVDRNIEDIKK-DNRMVDIT-----SEAARSVSESSRYKT---EG
A0A374A9J5      KFIKARLDVIGRELGDVDRNIEDIKK-DNRMVDIT-----SEAARSVSESSRYKT---EG
A0A5B3GQN5      KFIKARLDVIGRELGDVDRNIEDIKK-DNRMVDIT-----SEAARSVSESSRYKT---EG
A0A1Q6E9S3      KFIKARLDVIGRELGDVDRNIEDIKK-DNRMVDIT-----SEAARSVSESSRYKT---EG
D4IJ36          KFIKARLDVIGRELGDVDRNIEDIKK-DNRMVDIT-----SEAARSVSESSRYKT---EG
A0A414Q925      RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
A0A415PUS9      RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
A0A108TCU0      RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
A0A413BA42      RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
S3Y344          RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
A0A4Q5G8Y8      RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
A0A412TGL3      RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
A0A413VJ33      RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
A0A414L0W6      RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
A0A412DP39      RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
A0A413ZSE8      RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
B0NP84          RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
R6AK43          RFIGERLEIIEADLAAVDAEIENYKK-KNRLTDIA-----SESALYLQSSSMLDT---EG
A0A412N2D9      KFINDRLEIIEADLATVDAEIENYKK-KNKLTDIA-----SESALYLKSSSMLDT---EG
A0A1Y4JYS9      KFINDRLEIIEADLATVDAEIENYKK-KNKLTDIA-----SESALYLQSSSMLDT---EG
R6LHA4          KFINDRLEIIETDLATVDAEIENYKK-KNKLTDIA-----SESALYLQSSSMLDT---EG
A0A3E5HPT8      EFIKERLQIIEHELGSVETDIEDLKR-ANNGVDIN-----TVAGMYIQDSRQYES---SI
C6IJ48          EFIKERLQIIEHELGSVETDIEDLKR-ANNGVDIN-----TVAGMYIQDSRQYES---SI
Q8A3U2          EFIKERLQIIEHELGSVETDIEDLKR-ANNGVDIN-----TVAGMYIQDSRQYES---SI
A0A3R6S1H6      NFINERLIIIEQELGGVESEIETFKK-ENLLTDIV-----SETGIYLQNSNLYQQ---EG
A0A3R6SD81      NFINERLIIIEQELGGVESEIETFKK-ENLLTDIV-----SETGIYLQNSNLYQQ---EG
A0A354WXN6      NFIAERLLIIEKELGSVDANIESFKR-ENQLTDIT-----SETGMYLQNTSQYNQ---ES
R5IP14          RFIDDRLEIISQELGDVDSQIETFKK-ENELTDIT-----SEAGMSLTMKSGYMS---EG
A0A316SZX7      NFIDERLLIIGKELGEVDSEIANFKS-TNKLTDIS-----SEAQSQLQQSSAFKK---EG
A0A1Y4AIY1      EFIAERLVIIEQELGSVDTDIETFKR-EHQLTDIT-----SETGMYLQNTSQYRK---EG
A0A0J6CIR2      NFINDRLIIIEEELGSVDADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EG
A0A3D8HG59      DFINDRLIIIEKELGNVDSHIESFKR-ENQLTDIV-----SETGMYLKESSEYSR---EG
A0A3R6S408      DFINDRLIIIEKELGNVDSHIESFKR-ENQLTDIV-----SETGMYLKESSEYSR---EG
F3ZRU7          EFINERLIIIEKELGGVDTQIETFKK-TEKLTNIT-----SDAEMFITETTGLKK---EE
A0A1C5Q1F3      NFINERLIVIEQELGGVESQIADYKS-QHNLADIS-----TQTGSFMERSNRYQQ---EG
R7A239          NFINERLIVIEQELGGVESQIADYKS-QHNLADIS-----TQTGSFMERSNRYQQ---EG
A0A3R6HIK7      EFIADRLVIIEQELGSVDANIETFKR-ENQLTDIK-----SETGMYLQNTSQYKQ---EG
K5ZVW7          EFIADRLVIIEQELGSVDANIETFKR-ENQLTDIK-----SETGMYLQNTSQYKQ---EG
A0A1Y4D5Z0      DFIADRLVIIEQELGDVDANIEAFKR-ENQLTDIS-----SETGMYLQNTSKYKQ---EG
A0A413VXJ7      NFINERLIIIERELGGVDANIEAFKR-ENQLTDIT-----SETGMYLANTSLYRQ---EG
I9RSN9          NFINERLIIIERELGGVDANIEAFKR-ENQLTDIT-----SETGMYLANTSLYRQ---EG
U6RJK5          NFINERLIIIERELGGVDANIEAFKR-ENQLTDIT-----SETGMYLANTSLYRQ---EG
A0A1Q6GA32      NFINERLIIIERELGGVDANIEAFKR-ENQLTDIT-----SETGMYLANTSLYRQ---EG
I9RPU6          KFINERLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EG
I8YFS5          KFINDRLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLANTSRYKQ---EG
A0A6H9LTF8      KFINDRLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLQNTSRYKQ---EG
I8Y597          KFINDRLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLQNTSRYKQ---EG
A0A1Q6GBF5      KFINERLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EG
I8YFZ3          KFINERLIIIERELGSVDANIENFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EG
A0A6H9M1J1      KFINERLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EG
A0A1Q6GDH2      KFINERLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EG
U6RSB0          KFINERLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EG
I9GXM2          KFINERLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EG
I9SIK1          KFINERLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EG
A0A6H9LZ74      KFINERLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EG
I9TP59          KFINERLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLANTSRYQQ---EG
R5S343          SFINERLKIIDRDLGLVDSSIASFKS-EHRLTDAG-----LETGVFLQESSLYNQ---TG
A0A1M6K7I9      NFINERLIIIEKELGTVDADIESYKR-ENQLTDIT-----SETGMYLQTTTKYKQ---EG
A0A5M6A8C8      NFINERLIIIEKELGTVDADIESYKR-ENQLTDIT-----SETGMYLQTTTKYKQ---EG
A0A6H9LT84      KFINERLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLQNTSRYKQ---EG
A0A6H9LUV5      KFINDRLIIIERELGSVDANIESFKR-ENQLTDIT-----SETGMYLQNTSRYKQ---EG
A0A3R5ZMK1      NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A0A3E4ZTK7      NFINDRLIVIEKELGSVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSRNQQ---EG
A0A1Y3ZIA4      NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
K5Y1A4          NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A0A4Q5CIT0      NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A0A3R6K8X4      NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A0A414GI87      NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A0A415BDM7      NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A0A412DM15      NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A7AEU7          NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A0A1Q6I3T6      NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A0A414XX40      NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A0A3R6BKI7      NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A0A414LPI6      NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A0A412M2W1      NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
K5ZX55          NFINDRLIVIEKELGDVDSDIESYKR-EHQLTDIS-----SETGMYLQTSSQYRQ---EG
A0A5F0U645      NFINDRLIIIEKELGNVDAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EG
K5ZBN2          NFINDRLIIIEKELGNVDAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EG
A0A0J6CKW3      NFINDRLIIIEKELGNVDAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EG
A0A0F5IQM7      NFINDRLIIIEKELGNVDAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EG
A0A496CDT3      NFINDRLIIIEKELGNVDAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EG
A0A6G1ZKM3      NFINDRLIIIEKELGNVDAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EG
S0GLB0          NFINDRLIIIEKELGNVDAEIEVFKR-ENQLTDIH-----SEAGMYLQEGSQYSQ---EG
A0A3R6NLC1      NFINDRLIIIEKELGSVDAEIEVFKR-ENQLTDIH-----SEAGLYLQEGSQYSQ---EG
A0A416WYC9      NFINDRLIIIEKELGSVDAEIEVFKR-ENQLTDIH-----SEAGLYLQEGSQYSQ---EG
A0A0F5IT40      NFINDRLIIIEEELGSVDADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EG
A0A496CX20      NFINDRLIIIEEELGSVDADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EG
A0A5F0UBI0      NFINDRLIIIEEELGSVDADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EG
A0A6G1ZHG0      NFINDRLIIIEEELGSVDADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EG
S0GSI7          NFINDRLIIIEEELGSVDADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EG
K5YB65          NFINDRLIIIEEELGSVDADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EG
A0A0F5IWP9      DFINDRLIIIEKELGSVDADIETYKR-ENQLTDIS-----SETGMYLQESSQYSQ---EG
A0A0F5IZT8      DFINDRLIIIEKELGSVDADIETYKR-ENQLTDIS-----SETGMYLQESSQYSQ---EG
A0A417LKQ2      NFINDRLIIIEKELGSVDADIETYKR-ENQLTDIS-----SETGMYLQESSQYSK---EG
A0A416TME1      NFINERLIIIEKELGSVDADIETYKR-ENRLTDIS-----SETGMYLQESSQYSK---EG
A0A416XPE8      NFINERLIIIEKELGSVDADIETYKR-ENRLTDIS-----SETGMYLQESSQYSK---EG
A0A3B0C2S4      EFIDERFAYLSGELDSIEVGKEDFKR-LNNLSYIE-----SDVDFSLQRKAVAQD---EV
L8JI02          QFIDSQLSGVSDSLKRVEGWLENFRA-KSNIQDIS-----YTAENLSKNLDRLES---EK
A0A4Q5WS95      SFVDERMRIVQRELNAVEKQIQSYKA-QKGIVDLS-----EQGKLYLKNVGEIDQ---KL
A0A501VZX6      EFVEDRIKLVEEELKDLENKVVKYKS-SEGVVNLS-----EQGKLYLESVEGRDL---KM
A0A399SH26      AFIEDRMQKVEKELDKLESRVQKYKT-SKGIVDLS-----EQGRTFLQNMSANDS---KV
A0A501W1A9      AFVESRIQLLEKELQGLEEKIVEFRS-TKGAVNLN-----EQGRMFLQNVGENDR---RL
A0A0E3ZGV6      AFVEERIQLIEKELQNLEDKIVKYKS-TQGAVNLN-----EQGKLFLQSVDNNDR---RL
A0A1I2N4S1      AFVEDRIQLIEKELKVLEEQIVKYRA-SNGAVNLN-----EQGKLYLQSVDFNDR---RM
A0A2T5YE44      AFVEDRIQLIEKELKVLEEQIVKYRS-SNGAVNLN-----EQGKLYLQSVDFNDR---RM
A0A1V9FHD0      AFIETRLKSVRHELDSIEGKIQTFRT-NQGVVDLT-----EQGKQYLENVGTNDR---KI
A0A4V4H170      EFIETRLGRVEKELDSIEHIIQSFRT-DKGVVNLG-----EQSRQYLENVGSNDR---KI
A0A1V9F098      EFIETRLAKVEKELDSIEQRIQTFRT-DKGVVDLS-----AQGRQYLENVGSNDR---KM
A0A4R2VU64      EFIENRLFKVERELDSIEQKIQTFRT-EKGVVDLG-----AQGRQYLDNVGSNDR---KM
A0A4S8HY23      TFIETRLSKVEKELDSIERTVQSFRT-DKGIVDLG-----EQSKQYLENVGSNDR---KM
A0A1V9F383      EFIEARLLKVERELDSIESVVQTFRT-DKGVVDLG-----EQSKMYLENVGDNDR---KI
G8TRZ6          NFIEVRLGKVERELDSIESVVQTFRT-DKGVVDLG-----EQGKMYLDNVGDNDR---KI
A0A543WA52      AFIEERMGKVGTELAELEMEIQKYRS-SQGVVDLS-----EQGKLYLKDVGDYDR---EI
A0A1M5BA90      SFIEGRISNVAKELDSIENRLQKFRN-QKGVVDLS-----EQGKLYLQNVGDNDR---KM
A0A512B879      SFVETRIKYVVRELDSIENQLRKFKT-DKGVVDIS-----EQGRLYLQNVGDNDR---KM
A0A559PPI3      KFIEARIRNIGNELDTLESENEQYRS-SKGVVDLS-----QQSRIYLQDAGHNDQ---RI
A0A1T5CS78      TFIDERIENVEEELDELEYKIQQYKS-NEGVVDLS-----EQGRLYLQDVGENDK---QI
A0A0Q9Z8F1      TFIDERIENVEAELDELEYNIQEYKS-NQGVVDLS-----EQGRLYLQDVGENDK---QI
A0A2N0U0M7      TFIDERIENVEADLDELEYKIEEYKS-NQGVVDLS-----EQGRLYLQDIGENDK---QI
A0A2N3U785      SFLDERIKFLSSELTDVEENVERYKR-SNEVTNLD-----SDARMYVEKAADYNR---QI
A0A0D3L8Q3      EFINERLQFLTEELTDVEKDVEEYKR-ERRLTNVG-----TEAQLYLQGRTGYDQ---QL
A0A0E3ZG78      DFIDERLRYLTSELSGVEKDVEQYKR-QHELTDVN-----IQASNYLNIASGYNK---QL
A0A1I6BRK6      KFLDERLKFVTTELSTVEKGVASYKS-TNSLTDIA-----AQATSYAEQATNYDS---QI
A0A243WAB1      KFLDERLKYITAELSGVEKGVEKYKS-VNGLTDIS-----TQASDYTAQASDYNK---QL
A0A6G8C8X6      KFLDDRLKYITAELSGVEKGVEKYKS-IHGLTDIS-----TQASNYTNQASDYNK---QL
A0A5B6TJH8      AFIDERLKYLTTELTGVEKNVEQYKS-QNEVTDVN-----TQASDYLAQASDYNK---QL
A0A519U664      KFLDERLRLITAELSGVEKGVEKFKS-QNALTDIS-----SQASGYETQASNYTQ---QL
A0A519UDD1      RFLDDRLAYLTSDLSSVEKLVEQYKS-TKGLTDVS-----TQASVYTSQASTYNT---QL
A0A519MA34      KFLDERLRLITAELSGVEKGVEKYKS-QNALTDIA-----SQASGYETQAASTTQ---QL
A0A519UCX0      KFLDERLRLITAELSGVEKGVEKFKS-VNALTDIT-----SQASDFQAQNSTTTQ---QL
A0A4R5DL69      AFIDQNLHLVSLELKDIEEKIESFRR-KNHITDMA-----EQSRLLLANSSLYDK---EK
A0A1M4YED3      ATIEKRLTFVAKDLDSIERTIQQYKS-QKGIVDIS-----EQGKEFLRTVSDNER---QA
A0A2H3NSN0      EFLETQLDRREEDIEEVENEWQQFAR-RHDVAIDG-----QDGNRVATDYVEMMG---QR
A0A2P6C324      EFLETQLEKRKDDIRAIENEWEAFAR-SNAIVTEG-----LDGQNVAAEYAELQS---QR
A0A1M6XHU0      EFVEKQVEQRRQELEALERQWEAFAR-SRQVVRLG-----PQGERLVAEVAQLEA---QR
A0A5S9C8G0      AFVEKQVEQRRQELEELERQWEAFAR-SRQVVRLG-----PQGERLVAEVAQLEA---QR
G2SF81          EFVEKQVEQRRQELEELERQWEAFAR-SRQVVRLG-----PQGERLVAEVAQLEA---QR
A0A5S9EYW1      EFVEKQVEQRRQELEELERQWEAFAR-SRQVVRLG-----PQGERLVAEVAQLEA---QR
D0MHQ9          EFVEKQVEQRRQELEELERQWEAFAR-SRQVVRLG-----PQGERLVAEVAQLEA---QR
A0A126PFG0      HFIDSRLASLRGELSQAEADEAGYRS-QQGLTDIA-----SQSKVYLENAQANDS-----
A0A3M1N7Z3      GYIDTLVNFFQNQLLVA----------QDTLYRVE-----TKEDILFMEARKDRALSLYQ
                                                                            

A0A1T5MMH4      YELSRRL----DEINKLMDGL----------QTGN----------FSVN-PSIRQA-LPE
A0A2W4R1L8      YQLTTRI----TGINELLDDM----------SNGV----------YLVN-PVHRLY-FPQ
A0A2E5CV79      YNTRSEL----NMRRERISFL---NSKLSAEEKNF----------ATKI-STDINA-QMI
A0A2D4ZVH1      QKLEVGL----VAVMSGIAQY----------ENQL----------NEIK-PGLADL-YSD
A0A0K8QSK7      VVLESQL----KYYRYLRNYI-------I--QNQE----------LESI-MAPSAM-GVE
A0A1V6CN82      QELETQN----KYYNYLKTYI-------L--ENRD----------VGSI-LVPSSV-GIN
A0A1M4XZ45      VALETQN----KYYHYLRDYI-------STSSSQE----------METV-IAPSAM-GIQ
A0A399D319      VTLETQN----KYYHYLRDYI-------HSDTNKE-----------ETI-IAPSAM-GIQ
A0A1M6GR99      AELMTQK----RYYDYIKEYN---------SDNSD----------DTQI-VPPSAM-GVQ
A6EBM4          SILRIQL----IAIDQLRNTI---------TTEQT----------NTPL-NLSLEG-TID
A0A1M6TTV4      FKIRNQI----TAIELASEQL---------DEGTP----------ISPV-DMPKEI----
A0A4Q8RX32      EEKESHL----QYLEFLNSNF---------NKDDD----------FTDY-SLTILS-DLN
K0X1U5          LEAETQY----SIISMVDSFL--------NKPENK----------YSLV-PVTTGL-PDR
R5EXK3          LEAETQY----SIISMVDSFL--------NKPENK----------YSLV-PVTTGL-PDR
A0A401UAP7      FTINSRL----RLIRKLKEDL---------KDGKT----------ERYV-SLTDKE-TLP
A0A1W2GF52      YNLREHL----AEVDLVGENF---------RNGQQ----------VSIF-KMPTRI----
A0A2G5L7B8      FNIRTQI----AAVELANKQL---------GEGTP----------ITTL-GLPKPF----
A0A523GAC0      VILEKKL----TGIHQLQSNV--GNQTGAPERLLQ----------YSSY-NEDI------
L8JW09          FQLTKRI----QAFDQLLADL--ENNKTEFLGISQ-----------ETY-PKHI------
A0A364XUP5      YEFASRM----QELNQLSDGL------------RS----------KKFF-VSPGLR-KIL
A0A1M5RLA9      YELTNRI----VEVNTLMDGM------------KA----------GDLS-ISLTQL-HAL
A0A385SFR9      YELTNKI----VEVNTLMEGL------------KT----------GDLF-ISLTQL-HAL
A0A5M4A9J4      EQLSTQK----SYYTYLLNYL---------KSNND----------LKQI-AAPSTV-GIN
A0A5M4B1C7      EQLTTQQ----AYYRYLLQYL---------KSNNS----------IEQI-AAPSTM-GVD
A0A0D3LFR6      VATRRQL----NNLTNLSSRI-------KSEDTYF----------AQSL-VNRAGD-DFP
M7N6D4          VQLRKQL----SSITSLASRI-------EAEDSYF----------AQSL-VNRQDG-NFP
A0A4D7K1D4      RALKIYQ----IKIDKVQAQL---------GNNEQ----------LEFG-SLTLEN-FPE
A0A5C7MX19      RMLTQDI----LSIKSFKKIF---------KDTEF----------SSIP-LVALQE-KDI
A0A1Q3ZMZ7      YLANNNL----STLKDLKRRI-----NSTSSETEI----------SNIL-IEIANE-EYS
A0A2D8JJW3      VAQQLKL----DDLINAKEIY---------------------------------------
A0A2W2AFF7      TQSEVQL----SIVESLQKYL--------HENVNN----------RRVV-PSSLVL-QDP
R7PCR1          LDYETQL----SVARYLESYL---------HSKSK----------DDEF-IPMLDL-GDA
A0A2N5YXE2      LNVDFEI----MTLEKVSEKI------EKDPELKT----------YEIL-AMLSGQ-QSE
A0A1G9E2A9      ITYEQQL----PALDELEAYV------NRVDSTLE----------VEFI-PSTRAI-RDE
A0A098LL25      QVLKSRI----SMLGELKDLI--------LGDQEV----------NSFI-PALSQV-ENP
A0A6C0GJI1      TELNSQL----SLLRNLQNII--------ETEGDL----------ASFI-PSIPLL-TDQ
A0A2T2YJE8      INLHLQI----SLLNEVDQLL--------NKSSNL----------DQMI-PSLKEL-DDA
A0A127B287      YDLRFRN----SLLSD------IQQRIRKGDDLSL----------VISS-LQLQEQ-QDP
A0A3M9N829      LEQRFLL----TLYNT------IQSKMQQDEDLGL----------IVAG-LQGQPN-QDP
A0A0P0CSF9      LELRFQL----SLLNT------IQTKVQRNEDLGM----------IASS-IQGQEN-QDP
A0A5M8QQB8      LELRFQL----SLLNT------IQAKVQRNEDLGM----------VVSG-LQGQEG-QDP
A0A3M9MNC3      LELRFQL----SLLNT------IQSKVQKNEDLGM----------IAST-IQGQEN-QDP
A0A5B6TAX2      LELRFQL----SLLNT------IQAKVQRNEDLGM----------VVSG-LQGQGN-QDP
A0A5N1IQ33      EELRLKI----NALADLTGLI-GQNRVFVREGQSL----------EQSI-PAIGAL-ENP
A0A512AYT3      RELDIQI----GLLKDVARLV-SQAGQDEQESD-L----------EQVI-PSLKAV-EDQ
A0A5M6CYN7      LDLSMRI----SLLRDVAQLI-N------NDSE-L----------DQVI-PSLKAV-EDQ
A0A369QP10      VDLRMEL----SLLNEIDQLI--------GRNTSL----------DQMI-PSLKEL-DDE
A0A126PDF2      LKLNQNL----VLLSEISRMV-QQTHITRNEDETI----------EQSI-PGLGDI-NDP
A0A2Z3GKA1      LKLNQNL----VLLSEISRMVQQQTHITRNENETI----------EQSI-PGLGDI-NDP
A0A502GZP7      LKLNQNM----VLLNDIARVV-QQAHITRNENETI----------EQSI-PGLGDI-NDP
A0A519SBU8      LELEQKQ----RLLAEVRRLM-DSEQLTRNDDETV----------ADNI-PGLAEI-EDP
A0A4Q3JNZ3      LKLQDKL----RLLAEVGRMM-NRDQLTRTDDETV----------ADNL-PGLIEL-ADP
A0A519Q9V3      QKLQDKL----RLLSDISRLM-NRDQLTNNDDETV----------TDNL-PGLAEL-EDQ
A0A0M3RW20      IELQKRL----DLLNGVARLI-QRERITRDENVSV----------EQSV-PGLVTL-EDP
A0A495VFX4      IELQKRL----DLLIGVARSV-QREHITRDENTSV----------EQSV-PGLVTL-EDP
A0A1S9B3W0      EKLLRKA----TVLTEITRLV-EQERLT-KDDETV----------EQSI-PGLAAL-EDP
A0A1W1VRL3      QNLLQKQ----GLLADLSSLV-EQDQLTANEDSTV----------AQSI-PGLAEL-EDG
A0A1M6R305      LRLVEKI----RLLNEVAALA-EQGTITAREDLTV----------EESI-PALATI-ENP
A0A4Z0PHK3      LKMVEKA----RLLGEITRLV-EEDRLTQSEDATL----------EQSI-PGIAAF-EDG
A0A2M9B9H9      LKLVEKA----RLLGEISRLV-EQDRLTQNEDATL----------EQSI-PGIAAV-EDA
A0A4Z0QCY9      LKIVEKA----RLLGEITRLV-EQDRLTANEDATL----------EQSI-PGIAAI-EDN
A0A418R9X5      EELQEQA----DMLAELSRLV-EQERLTSRQDGDV----------MQTI-PALSTI-EDA
A0A428JSJ3      EKLQEEA----DMLADLARLV-EQERLTDREDGDV----------FQTI-PALSTI-KDG
A0A428KI59      EQLQEQA----DMLAELARLI-EQERLTDREDGDV----------FQTI-PALSTI-KDG
W8F1I6          EQLQEQA----DMLAELARLI-EQERLTDREDGDV----------FQTI-PALSTI-KDG
A0A246FQC0      TKLQQQA----DMMNDVARLV-EQDRLTVRPDGDV----------MQSI-PALAEV-KDG
A0A372E5P8      AKLQEQS----EMMSDVGQLL-DREQLTTRADGDV----------MQSI-PALADV-KDG
A0A1H3EMW1      AKLQEQG----EMMGDVGRLL-QQEQLTTRADGDV----------MQSI-PALAEV-KDG
A0A1H9ZSN3      AKLQEQG----EMMNDVGQLL-DREQLTTRADGDV----------MQSI-PALAEV-KDA
A0A5N1J2M4      QALRLKI----ALLDDVSALL-AKN-------THV----------DQII-PTLGSL-QDQ
A0A519S476      FELEGKL----RLLAEVGRIM-ARDQLTRSDDETV----------AENL-PGLSEI-EDE
A0A4Q3JRW8      QKLQDKL----RSLSDISRLM-NREQLTRNDDETV----------ADNL-PGLAEL-DDP
A0A519M923      QKLQDKL----RLLADVSRLM-NRDQMTRNDDETV----------AETL-PGLVEL-DDP
A0A4Z0ENW1      LKLEQKL----TLLSEVSRLT-SAEYLTPSDEVTV----------DQTI-PGLALL-EDP
A0A519UDB4      SELEQRL----GLLTEVGRLA-SQELIMTNENSTL----------AESI-PGLAIL-NDG
A0A3S0QKV1      ETLQRKA----SLLTQVSRLV-QQERITSRDDETV----------EQSI-PGLALL-EDP
A0A328BL48      EQILRRQ----GVLQELSRVV-ETERLIGSDELTV----------EESI-PGLAVL-QDP
A0A5R8WLY4      EEIQRRQ----GVLQELSRVV-EKDRVVGSDELTV----------EESI-PGLAVL-QDP
A0A1I5WSL8      LKLTDKM----ILLTEIEVMA-RQDRLTRDETQTV----------EQSM-PAIVGI-EDA
A0A0U3JVM7      LKLTDKI----NMLGEIAQMA-SQGSLTRDETQTV----------EQSI-PALAGI-EDP
A0A1G1SSV2      LKLTDNI----AMLAEIANMA-NQDRLTRDETQTV----------EQSL-PALAGI-EDA
A0A1G1SXV7      LKLTDNI----ALLAAITNMA-NQERLTRDETQTV----------EQSL-PALAGI-EDA
A0A6G8CBJ6      QELLQRQ----SLLADLSRLV-EQDQITSNEDSTV----------AQSI-PGLAEL-EDN
A0A0W8EDI5      EQLLRKA----GAIGEIAQLV-EQNQVMVQEGDDI----------EQSI-PALAIL-EDA
A0A3B7RBP8      VELQRKA----GALAEVASLV-QQNRVLTREGETI----------EQSI-PALTVL-EDA
A0A3R9P8H7      EKLQEQV----DMLNDVARLI-EQDRLTDRADGDV----------LQSI-PALTDA-KDG
A0A238WIA7      QELQEQI----NLLRNLSNQI-ESNQFVAREDVSA----------EQSI-PALAEI-KAP
A0A212UCJ7      QKLQEQL----TLLRSLNSQI-AQNRIVASEERSA----------EQSI-PALAEL-KAP
A0A4Z0MQE1      QKLQEQL----SLLRSLNSQI-EQNRIIAVEGRSA----------EQSI-PALAEV-KAP
A0A4Z0PCF4      QELQEQL----TLLRNLNGQI-EQNRFVAVEGVSA----------EQSI-PALAEL-KSP
A0A5D6VDG1      QALQRRL----ELLTSVARLT-SRDRIARDENASI----------DQSV-PGLSQL-EDP
A0A6H1CVS0      QALQRRL----ELLTSVARLT-SRDRIARDENASI----------DQSV-PGLSQL-EDP
A0A243WHR7      LQLQQQI----DLLDEIVALV-ESNQLTNSEEASI----------SESI-PGLKQL-GDE
A0A5B8A0P6      RKLDEKS----RLLEEVSRLV-EQERLTTSEDLTV----------EKSI-PGLALL-EDP
A0A076HRT9      LKLSEKI----RLLNEVADLA-ERGTITSREDLTV----------EQSI-PALATL-ENS
A0A4Z0PVM7      LELEEKA----RLLGEITNLV-EQGRLTESEDATL----------EQSI-PGISAI-EDN
A0A1M6DHW8      QKLAEKA----RLLSNVARLV-EQDRLIASDEATL----------EEGI-PGIALL-DDS
A0A4Q5LC61      LKLTEKA----RLLGEVTRLV-EQDRLVASEEATL----------EESI-PGLATL-EDS
A0A2U1FKU2      LIVERNL----SLAKYIQAFL--R------QTNSD----------NELM-PANLGL-TEQ
A0A0A2F954      LIVERNL----SLAKYIQSFL--R------QTSTD----------NELM-PANLGL-TER
A0A0A2FW91      LVVERNL----SLAKYIQSFL--R------QTSTD----------NELM-PANLGL-TER
A0A2D2N2N1      LIVERNL----SLAKYIQSFL--R------QTSTD----------NELM-PANLGL-TER
Q7MWZ2          LIVERNL----SLAKYIQSFL--R------QTSTD----------NELM-PANLGL-TER
T2NDT6          LIVERNL----SLAKYIQSFL--R------QTSTD----------NELM-PANLGL-TER
W1R7P9          LIVERNL----SLAKYIQSFL--R------QTSTD----------NELM-PANLGL-TER
A0A1R4AFZ0      LIVERNL----SLAKYIQSFL--R------QTSTD----------NELM-PANLGL-TER
A0A1R4DVZ7      LIVERNL----SLAKYIQSFL--R------QTSTD----------NELM-PANLGL-TER
A0A2A8CVM9      FELEQEE----EALRLLRDQL--AQFEP--GLRET----------VQQE-QEASGL-RSE
A0A5M4B212      SLLETQH----QYYQYLEEYL--S------KNEDL----------ESLV-APTTVG-IND
A0A3D1KEX9      NKTQAEL----SVAKYLREYV--V------KNASN----------TNLI-PDLNLG-DNG
A0A358Y7S2      LELEEEL----STLYLVQGKL--TSNP---NRLDI----------YKVI-PEMIGK-KSF
A0A1X7J248      YGINYQL----GEIENIQKQL--EKDTLSFDKINY----------LVLP-SNM-------
E4TQD2          YGINYQL----AEINNIQSQL--DKDTLSFDKINY----------LVLP-SNM-------
A0A2J6HHN3      SKTKYEK----EVLSAFILSV--EN-----EENDV----------LFLI-SMLTGT-ESY
A0A1Y3WMT8      LEAETQY----SIISMVDSFM--N------SPENK----------YSLV-PITTGL-PDR
A0A1Y4GQU1      LEAETQY----SIISMVDSFL--N------RPENK----------YSLV-PVTTGL-PDK
A0A6A0R272      RIAELRI----LNFNIVENEL---------NQGKK----------LSEI-SINAEG-NMD
A0A1V5W8T5      KQYDTQL----QSLQKVNKQI--AAG----KDFNA----------VELI-SILSGS-SSE
A0A2T8HKA9      RELETQL----SLAEMMRDYI--Y------DAGRS----------EKLI-PSNMGL-ADL
A0A2I0QZ80      RNIIEEI----RVLKVVKEKL--NSDP---NSNDV----------YRLI-PNIIGQ-SYE
A0A3E1F1A3      NNALEEM----RVLETVKKKI--EGNP---NSLDV----------YRLI-PIIIGK-SYE
A0A2U2XBJ3      RQGMEEL----RVLNSVQDKL--EGNP---NSLDV----------YRLI-PVIIGK-SYE
A0A4Q4KU94      RNGLEEL----RILNSVESKL--KGNP---NSLDV----------YRLI-PVIIGK-SYE
A0A3B8INU3      GTARSKQ----KSVNRMFSSV--IDSADIPDQSLL----------FPHL-----------
A0A2W1NDY9      LQADLEY----DLILGLVEGI--NSK----NRVSI----------YNLI-PTLAGT-RFQ
A0A5C8AQR5      YTIEDEL----STLRMVSGKL--KAEP---NRLEI----------YKIL-PEMLGK-SYE
A0A1G0CI31      FMLEEER----SALKLVSSKL--RNDP---NRLEI----------YRLI-PEMLGK-SFE
A0A556N0M0      FELENEL----ATLKTVHSKL--KLEP---NRLDI----------YRLI-PEMLGK-SYE
F2IKD6          FDLENEL----TTLKVVNSKL--KTEP---NRLDI----------YRLI-PEMLGK-SYE
A0A1I7BM74      EKLKIEH----QDLKRIKTEI--NNSP---RSTEV----------YKLL-PVLIEK-SYQ
A0A2G2FJ17      FELQDEL----NTLEMISLKL--KQSP---ESLDV----------YKLI-PELIGK-SFE
A0A2E3R1D0      DQAQVNL----VTKRAELAAL--QSELSRLES-QL----------GTRL-SSNLDS-ELA
A0A2T2USC0      DELQIEL----DMESSALQSL--KEELANIRP-NL----------AERI-ASGLGE-ELS
A0A2T2V0F3      DELRIEL----DMKQSALTSK--QEELANIRP-NL----------AERI-SSGLEE-ELS
A0A2T2S682      DELRIEL----DMAESALNTK--KKELKRIRP-RL----------AERL-SSGIQT-ELK
D5H561          EQARIEL----RMEQSSLESL--REELESIQPGQL----------SDQL-ASTVDQ-EIS
A0A2H3NWA9      AQLRIEL----EMTRARFNAQ--QDNIESIEP-QL----------AERL-ASNIDS-ELA
A0A2A8CVB6      RQLQIEL----QLARTSLDEK--RSELEKIEP-QI----------SDRL-SSTTGD-VLE
A0A2P6C1S6      AELRIEL----DMQQAALETQ--KEELGTIEP-KL----------AERL-SSSLGQ-RLS
A0A2T2UTM4      ARLRIEL----DMKQATLETR--KEELRQIEP-KL----------AERL-SSDLGE-KLS
A0A414ZBF2      LSIENEV----VMAEYIKDYL--Q------DNSKT----------AELI-PSSIGI-NDN
A0A1Q3Q573      IASENQL----YLLQNFKMLL---------QKTKD----------YSTL-PILQFK-EEE
A0A662BAY3      VVLETKN----KYYKYLREYI---------INNQE----------LETI-IAPSAM-DID
A0A4U3L369      NQLELQL----AIIKNLKEYL--Q------DERNN----------KRIV-PSNLVT-SDP
A0A357YNR3      MDIESQL----SIVSNLNDYV--Q------NINNH----------EQLI-PANSGI-NSQ
A0A5E8AX52      YDLQNKL----TNIQMAQEQM--DKGE-------------------PLL-LANYNS-RSL
F4KK08          VELNNSI----SIAQFVRGHL--K------DKNQM----------ESLI-PANVGI-ASP
A0A6B5PK86      FNLEDEL----STLQFINQRM--NENS---NRLEI----------YRIL-PELLGK-SYE
A0A2G2F510      FLIEDEL----NSLITVHKMI--GSSP---NRLEV----------YKML-PEMLGK-SYE
A0A316JZ08      SDIDKEV----ASLIAIDNQL--ERAP---NRLEV----------FRMI-PEMLGK-SYE
A0A496LCF9      KQIRLRD----EYFKYLRNYL--K------SNIDR----------ESLA-SPATLG-IQE
A0A5P2G2A9      NQAQVQL----AIVNTMLDYV--L------NTKNN----------QRPV-PSLLAT-PDP
A0A3C0ZQC7      DAADIEL----QALSKTLTSY--QEELAK-QEPNV----------AKAI-GEANDP-YIR
A0A419VXB7      SMAEMQL----EYYKNLRGYI--G------EDGNM----------KNIV-FPSVVG-ITD
A0A0B0BTJ4      LKTEIQL----EMLSAIGDIL---------NGKEE----------IGIL-PVNIGI-ENQ
A0A3B9CNN6      LKTEIQL----EMLSAIGDIL---------NGKEE----------IGIL-PVNIGI-ENQ
R5X290          LKTEIQL----EMLSAIGDIL---------NGKEE----------IGIL-PVNIGI-ENQ
A0A1Q6E6I7      LKTEIQL----EMLSAIGDIL---------NGKEE----------IGIL-PVNIGI-ENQ
C3J7R8          TEVNNKL----AVANYLKDYL--K------SPSSK----------DELI-PANVGL-NEA
A0A1G8BVM8      LGLENQL----SIANYMKNYL--H------DNANK----------SELI-PGNLGI-NNS
A0A1I1FXP9      IELEIQN----SLLMDLRNTI--I------NNQDI----------RKII-PALKHI-NDQ
A0A3N4H5N3      SDISSKI----EILESLENLI--NSQSSQ-GDLIP----------SSLV-SLDPAL----
A0A2P8EAX2      SELSNKI----EILESIESLI--AVQGSG-NETIP----------SSFV-TLDPTL----
A0A4V2F6N9      SELSNKI----EILESLENLI--AVQGNG-NETIP----------SSFV-TLDPTL----
A0A3B9FXJ0      LDVQLEE----RSLKWLLDYA--N------NNIED----------LDAL-SGYFGN-LKF
R5GSU5          LQAEVQL----SVAEYLEDFL--K------NNSKA----------DQVI-PVLNDM-VDQ
A0A2A3UE91      LQAQMEE----TLITEIQANI--AKN----KNIDI----------YQLI-SLMSGT-EYE
A0A0A2G557      IEVNNAL----AVAGFIKEHL--T------NPSSA----------NGLI-PASSGL-EDL
A0A2N2WFW8      AANISEL----ESLDRFYNTF--ES-----GNSDF----------VVLL-SLLSGL-ESQ
A0A1F3IU95      SENSSEV----ESLEIFYKAF--SS-----GNADI----------ITLL-PLISGI-ESQ
A0A3D0VUF6      SENSSEV----ESLEIFYKAF--SS-----GNADI----------ITLL-PLISGI-ESQ
A0A1T4PT95      IEINNSL----AIARFIKEHL--T------NPSTA----------GGLI-PASSGL-EDL
A0A6I6JYY3      VALETQN----KYYHYLRDYV--GNN-------QE----------LETL-IAPSAM-GIN
A0A2A4PYG9      MDLELET----SMLDEVADMI--KKK----DDIDV----------YNLL-PALTGS-SFQ
A0A1F3K695      LNLDFEL----ITLKRIQEQI--NSK----ANLNI----------FELI-ALLSGT-KSG
A0A353KZR1      LNLDFEL----ITLKRIQEQI--NSK----ANLNI----------FELI-ALLSGT-KSG
A0A2N2WYB5      INIEFEL----VTLQRISTQV--NVD----NELNI----------YELI-ALLSGT-KSE
A0A1F3K4G0      INIDFEL----VALQRINQQV--AND----HDLNI----------YELI-ATLSGT-KSE
A0A356H8Y3      INIDFEL----VALQRINQQV--AND----HDLNI----------YELI-ATLSGT-KSE
A0A351HSA6      INIDFEL----VALQRINQQV--AND----HDLNI----------YELI-ATLSGT-KSE
A0A1F3Q014      ISLELEE----NVLNKIETTL--SNS----KNIDT----------YTLI-AMLAGT-TTE
A0A2A4YXP3      IDVDLQQ----SVLKEVKKSI--SLNN---DDIDV----------YDLL-PILAGT-DYA
A0A2D5KD44      VELEIEI----ATLEEIKKQI--KEGG---EQIDI----------YEFL-PILVGS-QFE
A0A1F3R158      VDIDLQK----NVLEEINNSV--KGKI---KDINV----------YNLL-PILSGT-EYE
A0A2M8ADX2      VDIDLQK----SVLEEINNSV--KGKI---KEINV----------YNLL-PILAGT-EYE
A0A1J5B2H0      SKLELEE----NMLNEVEITF--NAS----ENVDI----------YKLI-ATIAGS-EFQ
A0A1V5N756      LKLEIEI----AKLKRVEEFV--NQS----KDLDV----------YELY-ALVAGS-QFQ
A0A651GU15      MELEYEE----KLLGELEKVA--LANP---EETDI----------YALI-PLIVGT-RLE
A0A3Q9FR88      SSLKNEK----KKYQKLRHFL--EAD-------SS----------IVYI-QAYATI-LTD
A0A553GEX3      SSLKNEK----KKYQKLRHFL--EAD-------SS----------IVYI-QAYATI-LTD
A0A150ADJ9      NELKGER----KKYQKLRHFL--EAD-------SS----------IVYI-QAYATI-LTD
A0A1B1FWQ4      NSLKSEK----KKYQKLRTLL--QAD-------SS----------IVYI-QAYATI-LTD
A0A1S1Z228      NQLKSEK----KKYQKLRHFL--EAD-------SS----------IVYI-QAYATI-LTD
A1ZKR2          IVFNEQL----AAIKELDDLV--N------KQGDL----------SEFL-PTLTTP-IQG
A0A1Q3GX01      LALSDEL----AGIKELENLM--E------QDKEL----------VLYL-PETSAG-LQG
A0A349DQI4      LKFTDEL----AGIKEIENLI--A------EDKEL----------VLYL-PENTSG-LQS
A0A4P5TMD1      EGLNLDE----KNLNYYLGYF--N------LYKDS----------SKLL-LGIVDQ-KYV
A0A2N3IIZ0      YKINAKL----QTIIELEIFV--NQRF---VDSKN----------IPLM-PDVDGA-I--
A0A1F3SJM1      YRLEEEQ----LSLDILDQKL--NAKV---SRLNV----------YRMI-PEMLGK-SYE
A0A2G2EB96      FELEEEY----NGLLNVKQKL--SKTP---NRLEV----------YKLL-PELLGR-SYE
A0A2G6PRA9      FELEEEY----NGLLNVKRKL--SKSP---NRLEV----------YKLL-PELLGR-SYE
A0A497D5Z2      VMLETKD----KYYNYLRDYI---------RNNQH----------LGNV-IAPSAM-GID
A0A662B170      VMLETKD----KYYNYLRDYI---------RNNQH----------LGNV-IAPSAM-GID
A0A2A5FYT6      INLELEE----SVLKEIEKKI--TANE---KEIDP----------YTII-PVLTGT-HFE
A0A2E6SYP1      IELQASL----SDFTQFQLKL--SENP---SNEEL----------YSIL-LLNSTN-KYL
A0A2E5RLE8      TKTESTL----NDFRNFYSAI--SNKI---NHEEL----------YSIL-LLNSKN-QYI
A0A2E7TQF6      TKTESTL----NDFRNFYSAI--SNKI---NHEEL----------YSIL-LLNSKN-QYI
A0A2E6GVY9      TKLETTL----IDFKNFYSSI--SNKI---SHEEL----------YSVL-LLNSKN-QYI
A0A350JJ90      VELELKI----SLLSELRGGI--QIEK---TGVDI----------YNLL-PVLAGT-EFE
A0A3M1CDV2      LQIELNE----KLLDEILNNI--QTQ----KNIDL----------YQLI-SLASGT-SYE
A0A6C1QGZ7      VMLQLEK----SIFSEIEKSL--QFE----DEADI----------FRLI-AILSGS-EFR
A0A4P5U6G4      IMLNIKD----NMLYSYQDYF--N------RYEDS----------TRLF-SGIVDV-QFS
A0A2E2TFD1      IKQELEQ----EILIQVKQAA--TSSS---DSVEV----------HQLI-PLLTGT-QFE
A0A2E4ELE6      IKLELEK----DILDELKAAS--DGEK---DSVDV----------YDLL-PLLAGT-QFE
A0A522EYA6      ISLELRA----NVLVELEKSI--EGK----KEVDS----------YQLV-SLLTGI-EFE
A0A2E3XZI5      TVINSNI----NLLNQFDLMF--DENLSSKITTSS----------IKNI-SLLTNI-FYE
A0A6I7QXV0      LELSFNL----QAIEWLENYI--SGQ----EDLSS----------IPKG-INIANL-EQY
A0A2M7NLQ9      VEMDNEL----KLYREISTLL--EDD--------S----------TLLV-ALTYSS-MLK
I4AFR0          LDIDNEL----KLYKEISTLL--END--------S----------TLLI-ALTYST-ILK
A0A2N2Y3E5      EGIKVEV----DTYNNLLDYL--KK-----KDLSA----------VELI-AIIPQN-LNS
A0A2D9D7T6      LENEEEL----VTLYLIKSKI--TPNP---DRIQI----------YKLI-PEMLGK-KNL
A0A1F3PPL5      MNIEFEL----VTLNRIKSEV--AEN----KNIDV----------YELI-ALLSGT-KSE
A0A357QK06      MNIEFEL----VTLNRIKSEV--AEN----KNIDV----------YELI-ALLSGT-KSE
A0A662AEA4      LNIDFQL----VTLNRIQKQI--VKG----KDSNI----------YEII-AILSGT-KFD
A0A0S2HYK8      TTLDFEL----ITLKNVKTQL--ETN----QQLNT----------YEMI-ATLAGT-NSE
A0A2N5ZWN6      TQLDFEI----FTLENVNDQL--KKQ----GQINI----------YEMI-ATLAGT-SSE
A0A2E0FJ09      VKLDVDE----EILNEIATVI--TDNP---LELDI----------YNVL-PILIGS-EFE
A0A1F3FZ62      LNIEVEE----KMLEELEKNF--SSI----KDLDV----------YKLI-AFISGT-EVN
A0A1F3K211      LNIEVEE----KMLEELEKNF--SSI----KDLDV----------YKLI-AFISGT-EVN
A0A1V6I2U9      LNVDFEI----MTLEKMLDKL--KSN----PEINT----------YELL-AMLSGQ-KSE
A0A2H0B957      DITDIEI----SSLKQILDEI--SKT----PNINA----------YNLI-SLLPLK---D
A0A1F3CFW6      DNVEIDI----SNLKQILDEI--SKT----PNIKV----------YDLI-SLLPSK---N
A0A2M7E2T8      DNVEIDI----SNLKQILDEI--SKT----PNIKV----------YDLI-SLLPSK---N
A0A2M7NC69      DNVEIDI----SNLKQILDEI--SKT----PNIKV----------YDLI-SLLPSK---N
A0A1F3KLL5      LKTDFEL----ATLKRIEKQL--SAG----ENLKY----------YDLY-SLLSGT-KSE
A0A359D1M1      LKTDFEL----ATLKRIEKQL--SAG----ENLKY----------YDLY-SLLSGT-KSE
A0A0F2NS19      IDIDFQT----SVLKEISKSV--TGKI---NTIDI----------YNLL-PTLTGT-EYE
A0A2A5H8X6      IDIDFQT----SVLKEISKSV--TGKI---NTIDV----------YNLL-PTLTGT-EYE
A0A2H0GAU8      IDIDFQR----NVLTEISKSV--SGKL---NTIDV----------YNLM-PTLTGT-EYE
A0A2M8FTK1      IDIDFQR----NVLTEISKSV--SGKL---NTIDV----------YNLM-PTLTGT-EYE
A0A2A5B3B0      FNIDLQK----KILEEIKTSI--SSND---KDIDV----------YELL-PILAGT-EYA
A0A5C6RXM7      IDIELQK----NVLVEISSSI--ESEL---KNVDV----------YKLL-SILAGT-DYS
A0A1F3C1M2      LNIEFEY----STLKRINEYV--NKN----SNLNI----------LDLI-AILSGT--KS
A0A1F3DS87      LNIEFEY----STLKRINEYV--NKN----SNLNI----------LDLI-AILSGT--KS
A0A6A0R6K9      VDLEVQI----SLLEEVKKEI--DKN---GENIDI----------YKLL-PLLIAS-TYD
A0A2E7CT70      VQNQVDI----TLLNQFQEMF--QSTLSKKISSNS----------IKSL-S-LSKI-FYD
A0A2D5V560      AKXQIDI----DLXNQFSDMF--ENXLSTEINSTS----------MKNI-SLLTAI-FYN
A0A2D7K5A8      VKIQLDI----DLMDQFSNMF--ENNLSTEINSSS----------VKNI-SLLTTI-FYG
A0A2E1XQ82      VKIQLDI----DLMDQFSNMF--ENNLSTEINSSS----------VKNI-SLLTTI-FYG
A0A5C8A5B4      SNILKRR----NYCSSVLSKI--------RSSSDL----------RNVPAPSSSGI-DDP
A0A4Y9ITE2      VTAETEY----EILEMTRELM--------NDPNHR----------YD---LIPTPY-GAE
A0A5M8NYX7      IELQNQM----SVISSVKNYL--------SNPDNK----------NNGA-PANVGI-TDP
A0A3D5KRY6      ANLDLRL----ESFNNLKYYL--------ENRDQN----------KDLVFPSIEQL-TDP
A0A1V5IPN7      EAALTEQAVKAKTLDVLRKQL--------QDQDSL----------LV---KVENVL-QAP
A0A0E3V905      NQVQIQL----ATLNDLQKYI--------EGKGDT----------RGNT-PAVVGL-SDP
A0A553ETH6      LSIK-------NKSKDIKIFL--------KNLEAD----------KVS--EVNYEQ-LPR
A0A640Q161      LDAQTALKLNAVIYKQTRNDV--------SLDDIA---------------RLPEVL-NHP
A0A640QU49      LDAQTALKLNAVIYRQTRNDV--------SLNDIA---------------RLPEVL-NHP
A0A1Q3PII2      KELAVRM----KIVELLAAHL--------RAKPTM----------AI---PSALYP-RED
A0A351BXT2      NAARIELNSKQEEYNSLKSEI--------ERMDPT----------LVNF--LQGKV-DEL
A0A2K8Z965      IQVNVQL----AALNDLQKYV--------ETKSEN----------RGNTPPAVVGL-NDP
A0A418M8U8      NQVNIQL----SALSDLQRYI--------NNRSLD----------RGAT-PALVGL-NDP
I2GTA4          NQVNIQL----TTLSDLQRYI--------NNRSLD----------RSAT-PALVGL-NDP
A0A2K8ZAJ2      NDVNMRL----GALADVERYV--------QSHSGR----------KGVA-PATLGL-SEP
A0A368JPA3      NRVAIQL----STLGDVEKYV--------RSKGEN----------RGVL-PTTLKF-SDP
A0A5N1JI29      NRVAIQL----STLGDVEKYV--------RSKGEN----------RGVL-PTTLKF-SDP
A0A3P1BT12      NQVAIQL----STLGDVEKYI--------RAKGEN----------RGML-PATLKF-NDP
A0A3P1CI15      NQVAIQL----SSLGDVEKYI--------RSKKDN----------RAAL-PATLKF-NDP
A0A4R8CUK1      SQLAVQL----SALGDVEQYI--------REEGTH----------YCSL-PAMLDF-SDP
A0A3D0MYJ7      NLGKIELNAVEIQINNLRRKI--------SEISPE-----------VDL-YVNSQA-NQS
A0A662AH13      DATFIEMVATERTINVYKAEI--------DKKNPT-----------LSK-YIENYA-STP
A0A5C7QA01      ------------------------------------------------------------
A0A3D3LS70      NASEVELITSRRTYDALKSEL--------EKLDPQ-----------LIT-YVESQI-SQS
A0A1G1TM36      NTAQVQL----AVVESIERYL--------RNPQPA-----------ATV-PTTLGI-TDE
A0A1G7ZF38      KQLAMHL----KIVGLLEAHL--------RE-KSA-----------TAI-PSALYP-QES
C6VS52          REWATHL----KIVQLLEDHL--------RK-SPS-----------TAI-PSLLYP-QES
A0A2A4G4B1      NTLSTQL----ELALLMKKSV--------LEGG------------IQLL-PTNIGL-DHS
A0A0P7X1V8      QGIQVKL----VAANSALEAY--------QQELDR------------LT-PGLSEQ-LTA
A0A5C8KAD6      SEISNHL----SVLDQIEKFV--------VSRNSS----------TGSI-PSTLGI-NDP
A0A5N1J695      ADINIQL----AVLQKVENYV--------ISKNKA----------TGIV-PSTLGV-NDP
A0A1H4ADG3      AAQQVQL----SITNSLIEYM--------HSQNGN----------DRVV-PASLTI-NDG
A0A5B8VUR8      ATQQVQL----SITNSLIGYM---------SQNGN----------DRVI-PASLTI-NDG
A0A3N2M1H3      LNIENQL----SITTYMKDFL--------DDSANK----------FNII-PANTGL-DNP
A0A4S2G8T2      LNIENQL----SITTYMKDFL--------DDSANK----------FNII-PANTGL-DNP
A0A1T5K9D4      SQVETNL----SIAEYLRDYV--------RGSMDS----------FEVI-PANTGL-NDA
A0A077ENE7      TKIETDI----RLAEMMRSYL--------MNKGKQ----------NNLI-PNNTGL-VDS
A0A6I5UW06      TKIETDI----RLAEMMRSYL--------MNKGKQ----------NNLI-PNNTGL-VDS
T0NN57          TKIETDI----RLAEMMRSYL--------VNKNKR----------NDLI-PNNTGL-VDA
X5K347          TKIETDI----RLAEMMRSYL--------VNKNKR----------NDLI-PNNTGL-VDA
A0A212K7W5      QALSTQH----TIAKYILSHL--------KDSRTK----------DMLL-PANLGI-EGT
F5IU11          QALNTQY----TIAKYILSHL--------KNPRTK----------DILL-PANLGI-EGA
A0A6I1IYY4      LQMETEL----SIAQSIKSYL--------MDVTRN----------NQLI-PNVSGV-GDA
K0XJ09          VQLETEY----AIARAVERYL--------TDNENG----------KQLI-PNVSGV-GDS
R5EUZ0          VQLETEY----AIARAVERYL--------TDNEHS----------KQLI-PNVSGV-GDS
W0EQS0          VQLEMEY----AIAQAVQKAF--------SGKENN----------KQLI-PNVSGV-GDA
A0A1Y3WE15      VQLETEY----AIAQAVQRAF--------ANEKGD----------KQLI-PNVSGV-GDA
A0A1Y4GUK3      VQLETEY----AIAQAVHRAF--------TNDKDN----------KQLI-PNVSGV-GDA
A0A352Z1R7      AEVIFQK----KQVEFALDAL--------NSTLRK----------GNIY-SPAIMR-DDP
A0A3N2N6F7      LGVMTQM----EITRFLIDYM--------QSPANK----------GKLL-PGNLGI-ENQ
A0A4P7VVU7      MQVSTQI----AISKFILDYI--------KNPDTN----------GQLV-PANAGL-ENP
A0A2V1ILM4      MQVSTQI----AISKFILDYI--------KNPDTN----------GQLV-PANAGL-ENP
A0A3N2L0E8      MQVSTQI----AISKFILDYI--------KNPDTN----------GQLV-PANAGL-ENP
A0A3N2LFC5      MQVSTQI----AISKFILDYI--------KNPDTN----------GQLV-PANAGL-ENP
A0A0A2F501      LDLSNQL----YMARYIRQHL--------GTDTNA----------TQLI-PAISGI-GNK
R5B7P0          QDVSNQL----YMARYIKDYI--------GKEDNR----------NQPL-PANMGL-SSQ
R5B0L5          LELNNQL----QMTRYLRNYL--------GSESSR----------NQPL-PVNVGS-GSP
A0A6I1TEC0      MDFNSRL----SIAQYIRSSL--------VGRVSK----------NQVL-PSNTGI-DSP
A0A3R5XWG1      MDLNSRL----SIAQYIRSSL--------VGRVSK----------NQVL-PSNTGI-DSP
A0A646GTR1      MDLNSRL----SIAQYIRSSL--------VGRVSK----------NQVL-PSNTGI-DSP
A0A5P0Y910      MDLNSRL----SIAQYIRSSL--------VGRVSK----------NQVL-PSNTGI-DSP
A0A414YFM3      MDLNSRL----SIAQYIRSSL--------VGRVSK----------NQVL-PSNTGI-DSP
A0A6A7UIA7      MDLNSRL----SIAQYIRSSL--------VGRVSK----------NQVL-PSNTGI-DSP
A0A6A7VPS3      MDFNSRL----SIAQYIRSSL--------VGRVSK----------NQVL-PSNTGI-DSP
A0A374THP7      MDLNSRL----AIAQYIRNYL--------TGKVGK----------NQLL-PSNTGI-ESP
A0A6G1VND1      MDLNSRL----AIAQYIRNYL--------TGKVGK----------NQLL-PSNTGI-ESP
A0A0A2EVS5      LALNNQL----YMARYIRGHI---------TGGQG----------RELL-PVNSGI-NSP
A0A1T4NAJ7      LALNNQL----YMARYIRGHI---------TGGQG----------RELL-PVNSGI-NSP
A0A255T941      LELNSQL----TTAQYIRHEL---------TSKSI----------DQTL-PTNSGI-ANA
A0A3N2KCL3      MDLKNQL----KQTLYIKSYL--------GAASDN----------EKML-PMNSGV-ANV
A0A4P7VSV0      MDLKNQL----KQTLYIKSYL--------GAASDN----------EKML-PMNSGV-ANV
A0A2V1IJY1      MDLRNQL----KQTLYIKSYL--------GAASDN----------EKML-PMNSGV-ANV
A0A4P7VXK7      MDLRNQL----KQTLYIKSYL--------GAASDN----------EKML-PMNSGV-ANV
A0A1Y4CHN5      LELSMQL----SMAKYIKSYL--------AAGESQ----------NQLL-PANSGI-SGG
A0A1M6I2S6      LALNSQL----STAQYIRREL---------NNKEL----------SQLL-PTNSGI-ANV
A0A1Y3V692      LALNSQL----STAQYIRREL---------NNKEL----------SQLL-PTNSGI-ANV
F3PXM2          LALNNQL----STARYIRGEL---------NGKGL----------TQLL-PANSDI-GNS
A0A3E4ZNL4      QALSNQL----STAQYIRREL---------NSKDM----------NQPL-PTNSGI-SSV
A0A174AHH7      QTLTNQL----TTAQYIRREL---------NSKDM----------NQPL-PTNSGI-ANV
A0A174JCE8      QTLTNQL----TTAQYIRREL---------NSKDM----------NQPL-PTNSGI-ANV
A0A3E4JMC4      QTLTNQL----TTAQYIRREL---------NSKDM----------NQPL-PTNSGI-ANV
A0A412SND6      QTLTNQL----TTAQYIRREL---------NSKDM----------NQPL-PTNSGI-ANV
A0A414IEQ9      QTLTNQL----TTAQYIRREL---------NSKDM----------NQPL-PTNSGI-ANV
A0A415UKN5      QTLTNQL----TTAQYIRREL---------NSKDM----------NQPL-PTNSGI-ANV
A0A6I0U0V8      QTLTNQL----TTAQYIRREL---------NSKDM----------NQPL-PTNSGI-ANV
A0A6I2PDH7      QTLTNQL----TTAQYIRREL---------NSKDM----------NQPL-PTNSGI-ANV
A0A0M1W8D8      QTLTNQL----TTAQYIRREL---------NSKDM----------NQPL-PTNSGI-ANV
A0A3R6GKX5      QALTNQL----TTAQYIRREL---------NSKEM----------NQPL-PTNSGI-ANV
A7V4S1          QALTNQL----TTAQYIRREL---------NSKEM----------NQPL-PTNSGI-ANV
B0NU19          QALTNQL----TTAQYIRREL---------NSKEM----------NQPL-PTNSGI-ANV
D4V601          QALTNQL----TTAQYIRREL---------NSKEM----------NQPL-PTNSGI-ANV
A0A4Q0U3M9      QALTNQL----TTAQYIRREL---------NSKEM----------NQPL-PTNSGI-ANV
A0A4R4H1Q2      QALTNQL----TTAQYIRREL---------NSKEM----------NQPL-PTNSGI-ANV
A0A6I0GII7      QALTNQL----TTAQYIRREL---------NSKEM----------NQPL-PTNSGI-ANV
A0A6I0KYU7      QALTNQL----TTAQYIRREL---------NSKEM----------NQPL-PTNSGI-ANV
A0A397WLT5      QALTNQL----TTAQYIRREL---------NSKEM----------NQPL-PTNSGI-ANV
A6KY94          QTLTNQL----ATAQFIRREL---------GGKEM----------NQPL-PTNSGI-ANV
A0A173UQR8      QTLTNQL----ATAQFIRREL---------GGKEM----------NQPL-PTNSGI-ANV
A0A3R6HK75      QTLTNQL----ATAQFIRREL---------GGKEM----------NQPL-PTNSGI-ANV
A0A412B7D1      QTLTNQL----ATAQFIRREL---------GGKEM----------NQPL-PTNSGI-ANV
A0A412VNY9      QTLTNQL----ATAQFIRREL---------GGKEM----------NQPL-PTNSGI-ANV
A0A414LTU9      QTLTNQL----ATAQFIRREL---------GGKEM----------NQPL-PTNSGI-ANV
I9Q4U4          QTLTNQL----ATAQFIRREL---------GGKEM----------NQPL-PTNSGI-ANV
A0A6A2J529      QALTNQL----TTAQYIRREL---------NSKEM----------NQPL-PTNSGI-ANV
A0A3R6GM96      QALTNQL----TTAQYIRREL---------NSKEM----------NQPL-PTNSGI-ANV
A0A015XH67      QTLTNQL----ATAQFIRREL---------GGKEM----------NQPL-PTNSGI-ANV
A0A078RZN2      QTLTNQL----ATAQFIRREL---------GGKEM----------NQPL-PTNSGI-ANV
A0A4R4I3T9      QTLTNQL----ATAQFIRREL---------GGKEM----------NQPL-PTNSGI-ANV
A6L0K5          QTLTNQL----ATAQFIRREL---------GGKEM----------NQPL-PTNSGI-ANV
A7ACT5          QTLTNQL----ATAQFIRREL---------GGKEM----------NQPL-PTNSGI-ANV
A0A373ISF0      LTLNTQL----STARYILKEL---------KEKSL----------SQPL-PTNSGI-ANS
U6RF62          LTLNTQL----STARYILKEL---------KEKSL----------SQPL-PTNSGI-ANS
A0A662ZZD5      LALNSQL----STAQYIRKEL---------NNKKL----------SQLL-PTNSGI-ANV
A0A3A5TI83      LALNSQL----STAQYIRKEL---------NNKKL----------SQLL-PTNSGI-ANV
A0A415NEB6      LALNSQL----STAQYIRKEL---------NNKKL----------SQLL-PTNSGI-ANV
A0A6I0I238      LALNSQL----STAQYIRKEL---------NNKKL----------SQLL-PTNSGI-ANV
A7AJ60          LALNSQL----STAQYIRKEL---------NNKKL----------SQLL-PTNSGI-ANV
A0A6A2JF01      LALNSQL----STAQYIRKEL---------NNKKL----------SQLL-PTNSGI-ANV
A0A6I0Y2Y2      LALNSQL----STAQYIRKEL---------NNKKL----------SQLL-PTNSGI-ANV
A0A6I2Q447      LALNSQL----STAQYIRKEL---------NNKKL----------SQLL-PTNSGI-ANV
A0A395YYT3      LALNSQL----STAQYIRKEL---------NNKKL----------SQLL-PTNSGI-ANV
A0A015UXN7      LALNSQL----STAQYIRKEL---------NNKKL----------SQLL-PTNSGI-ANV
A0A5M5W148      LALNSQL----STAQYIRKEL---------NNKKL----------SQLL-PTNSGI-ANV
A0A6I2NTL0      LALNSQL----STAQYIRKEL---------NNKKL----------SQLL-PTNSGI-ANV
A0A016E4F9      LALNSQL----STARYIRKEL---------NNKEL----------DQLL-PTNSGI-ANV
A0A4Q5CFJ7      LALNSQL----STARYIRKEL---------NNKEL----------GQLL-PTNSGI-ANV
A0A6H9P0U9      STLNNQL----STAQYIRREL---------NTKQL----------DQTL-PANSGI-VSA
A0A108TH71      STLNNQL----STAQYIRREL---------NTKQL----------DQTL-PANSGI-VSA
I8VXH0          STLNNQL----STAQYIRREL---------NTKQL----------DQTL-PANSGI-VSA
A0A412S0N6      STLNNQL----STAQYIRREL---------NTKQL----------DQTL-PANSGI-VSA
A0A412IIJ0      STLNNQL----STAQYIRREL---------NTKQL----------DQTL-PANSGI-VSA
A0A0P0FM97      STLNNQL----STAQYIRREL---------NTKQL----------DQTL-PANSGI-VSA
R6KTP3          STLNNQL----STAQYIRREL---------NTKQL----------DQTL-PANSGI-VSA
A0A139LU87      STLNNQL----STAQYIRREL---------NTKQL----------DQTL-PANSGI-VSA
A0A1C6B3Y5      STLNNQL----STAQYIRREL---------NTKQL----------DQTL-PANSGI-VSA
E2NMQ4          STLNNQL----STAQYIRREL---------NTKQL----------DQTL-PANSGI-VSA
A0A412YDB9      SALNNQL----STAQYIRREL---------NTKQL----------NQTL-PTNSGI-VSA
R7DY01          SALNNQL----STAQYIRREL---------NTKQL----------NQTL-PTNSGI-VSA
A0A414LGK8      SALNNQL----STAQYIRREL---------NTKQL----------NQTL-PTNSGI-VSA
A0A415IPQ4      SALNNQL----STAQYIRREL---------NAKQP----------DQPL-PTNSGI-VNA
A0A3E5BRW7      SALNNQL----STAQYIRREL---------NAKLL----------DQPL-PANSGI-VNA
K9DXS6          SALNNQL----STAQYIRREL---------NAKLL----------DQPL-PANSGI-VNA
A0A1M6KFV3      SALNNQL----STAQYIRREL---------NSKQL----------NQPL-PANSGI-VNA
A0A1Q6G7L3      SALNNQL----STAQYIRREL---------NSKQL----------NQPL-PANSGI-VNA
A0A413H235      SALNNQL----STAQYIRREL---------NSKQL----------NQPL-PANSGI-VNA
A0A1M5B2J8      KSLNNQT----YMARYIRNYL--------TSETNR----------FQLL-PANSGI-DNP
A0A255RCT5      KSLNNQT----YMARYIRNYL--------TSETNR----------FQLL-PANSGI-DNA
A0A1Y4GLF5      LALNNQL----YMARYIRNYL--------ANDANK----------SQLL-PANSGI-DNG
A0A1H3XSC0      LTLNNQL----YMTRYIRNYL--------TNDANK----------NQLL-PANSGI-ESA
A6LE40          LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A4Y1VPX5      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
B3JI46          LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
R6NN15          LTLNTQL----SMARYIRNYL--------TAASSR----------NQLL-PANSGL-ESA
A0A358R8U0      MALSNQL----YMTRYVRNYL--------SDENNR----------TQLL-PANSGI-EST
R6WSB6          MALSNQL----YMTRYVRNYL--------SDENNR----------TQLL-PANSGI-EST
A0A401LPX7      RELNNQA----YMARYIKNYL--------TDENNK----------YQLL-PANSGI-ENA
A0A6I0J0P8      RELNNQV----YMARYIKNYL--------TNENNK----------HQLL-PANSSI-ENA
A0A6I1BFM0      RELNNQV----YMARYIKNYL--------TNENNK----------HQLL-PANSSI-ENA
A0A6G0GNY9      RELNNQV----YMARYIKNYL--------TNENNK----------HQLL-PANSSI-ENA
A0A3A5Z900      RELNNQT----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
A0A285TGL6      RELNNQA----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
A0A3A5RFX4      RELNNQA----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
A0A1Q6IUW9      RELNNQA----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
A0A3R6NPG7      RELNNQA----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
A0A413XDP6      RELNNQA----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
K6AP24          RELNNQA----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
A0A6I2NHV3      RELNNQA----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
A0A662ZYI7      RELNNQA----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
A0A078RYI7      RELNNQA----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
C7XEQ8          RELNDQA----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
D7INX6          RELNNQA----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
K5ZG55          RELNNQA----YMARYIKNYL--------TNENNK----------HQLL-PANSGI-ENA
A0A3N2N9B8      MDINNQL----QMTRFVRNYL--------TAESSR----------NQLL-PANSGL--VG
A0A3N2NMI0      LAINNQI----QMARFVRTYL--------TAEDSR----------NQLL-PANSGL--VG
A0A359I8H7      LEVTNQM----SMSIYLRDYL--------NNPGNA----------KSVI-PVNTGI-GSP
A0A3N2KA63      LEVTNQM----SMSIYLRDYL--------NNPGNA----------KSVI-PVNTGI-GSP
A0A4Q0IMT7      LEVTNQM----SMSIYLRDYL--------NNPGNA----------KSVI-PVNTGI-GSP
A0A3B9FAU3      LALNTQR----SMAQYVKGML--------TRGAKS----------RKLL-PTNAGL-EST
A0A3C1E5L7      LALNTQR----SMAQYVKGML--------TRGAKS----------RKLL-PTNAGL-EST
A0A4Q0UAV1      LELNNRL----SLVKYLRREV--------QN-ASL----------DQPL-PNPAGI-EGT
A0A354SN68      VSTNNKI----HMAYFIKEYL--------SNVKNR----------NQLL-PVNSGI-GNE
A0A3N2N595      MGLRNQL----QMTRYIRNYL--------SADNDN----------TKLL-PIPSEV-ENV
A0A0A2DUD9      VELRSRE----YMARQVRNLL--------KN-LDK----------SRLL-PVNSFV-NNP
A0A3P1ZBJ5      MELNNQL----YMTRYVSQML--------TNEKNK----------FDLL-PANSGI-NSS
R5FHS9          LDLNTQR----AMAQYVLSYI--------TNPKQR----------NHVL-PANFGL-TDQ
A0A413TW79      LELNSRL----SMARYLRDFL--------TGKVGK----------NQLL-PANIGI-DSP
A0A3E5E9M7      LELNSRL----SMARYLRDFL--------TGKVGK----------NQLL-PANIGI-DSP
A0A3E4SK73      LELNSRL----SMARYLRDFL--------TGKVGK----------NQLL-PANIGI-DSP
A0A415GGC6      LELNSRL----SMARYLRDFL--------TGKVGK----------NQLL-PANIGI-DSP
A0A413DBH9      LELNSRL----SMARYLRDFL--------TGKVGK----------NQLL-PANIGI-DSP
A0A1Y4PQK7      LALNTQL----SLVRYIRNYL--------ATTAGQ----------NQLL-PANSGL-ENV
A0A1Y4IH41      LALSTQL----SMVRYIRNYL--------ATTAEQ----------NQLL-PANSGL-ENV
A0A3A6AAP4      LALSTQL----SMVRYIRNYL--------ATTAEQ----------NQLL-PANSGL-ENV
A0A6I0ZRD2      LALSTQL----SMVRYIRNYL--------ATTAEQ----------NQLL-PANSGL-ENV
A0A1Y4DYA7      LVLNTQL----AMTRYVRNYL--------TNNNNK----------NQLL-PANSGI-ESS
A0A1Y3X4I9      LALNTQL----AMTRYVRNYL--------TGGNSR----------NQLL-PANSGI-ESS
A0A1Y4FNK8      LALNTQL----SMARYIRNYL--------TNATSK----------NQLL-PANSGI-ESP
A0A355FD59      LSLKSQL----SMANYIRNYL--------TGPAYT----------NQLL-PANSGI-ENS
A0A359CEZ9      LSLKSQL----SMANYIRNYL--------TGPAYT----------NQLL-PANSGI-ENS
A0A353Q7B4      LSLKSQL----SMANYIRNYL--------TGPAYT----------NQLL-PANSGI-ENS
F8X3A5          LDLNTRL----SMARYMRNHL--------MTSTNN----------NQLI-PANSGI-ESA
A0A1M3KVR9      LDLNTRL----SMARYMRNHL--------MTSTNN----------NQLI-PANSGI-ESA
A0A4Y9IJS3      LDLNTRL----SMARYMRNHL--------MTSTNN----------NQLI-PANSGI-ESA
A0A495WI87      LALNNQL----YMARYIRNYL--------GGESNK----------YQLL-PANSGI-ENS
A0A354M4S6      LALNNQL----YMARYIRNYL--------GGESNK----------YQLL-PANSGI-ENS
R7DH52          LALNNQL----YMARYIRNYL--------GGESNK----------YQLL-PANSGI-ENS
A0A4Q5E7L5      LALNNQL----YMTRYIRNYL--------TNDANR----------TQLL-PANSGI-ENA
A0A4P8LP09      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A4R4GZU7      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A016CWA4      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A1C6H117      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A0M1W0V2      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A139KA16      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A174VQ92      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A1Q6HCG0      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A1Y4JYM9      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A3A5QW67      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A3A5RQE6      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A3A6BP07      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A3E5E153      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A3Q9IP20      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A412WV15      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A413ICP6      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A414KYB9      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A5B3FWR2      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A6I0WNS4      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
E5WX00          LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
K0X3P3          LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A415TAH7      LALNNQL----YMTRYIRNYL--------SNDANR----------TQLL-PANSGI-ESA
A0A078T2W6      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A6I1AQV4      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A5C6L2P1      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A412MJT7      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3E4WKT5      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3A5YY33      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A078TAH2      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A1E9CFZ7      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A373FYU5      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3A5TZ72      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3A5XBP2      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3A6MEG9      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3E4JP35      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3E4KP40      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3E4NX82      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3E4XFU8      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A412RG70      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A412TD37      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A413GAA4      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A414M7I4      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A496BTA0      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A496D2V6      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A4Q5G1P5      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A5C6KCA6      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A5M5AHM5      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A6I0KZV6      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A6I0Y5K7      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A6I1BFB8      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A6I2P5W5      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
E5UZA2          LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A069SMG6      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
C3RFN5          LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3A5Z014      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A6I0ING7      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A6I2P894      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A078S3Q8      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A069SJV7      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3E5DXI5      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3E5EM98      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3E5F453      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
I9T3G6          LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A3E4SYU0      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A6LGY1          LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
K5ZSH4          LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A6A2RTB3      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A6I0VY00      LSLNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESA
A0A1M4YZ07      LALNNQL----YMTRYIRNYL--------TNDANR----------TQLL-PANSGI-ESA
A0A4Q5E5M7      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESV
A0A0P0FQW1      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESV
A0A5M5C0W6      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESV
A0A6I0H151      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESV
A0A6I0HI59      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESV
A0A642LZ22      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESV
A0A6I0IP89      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESV
A0A642NJ89      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESV
A0A6I0HI52      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESV
A0A6I0YVB5      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESV
A0A6G0G4T5      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESV
A0A6I0HFG9      LALNNQL----YMTRYIRNYL--------ANDANR----------TQLL-PANSGI-ESV
A0A416GA42      VQLQTEL----ELTRYLKEFL--------LQPKND----------KSLI-PVNIGV-SET
A0A1T3IYP5      AKVETDI----RLAEMMRSYL--------SAKGKQ----------NNLI-PNNTGL-VDA
A0A3P1Z8V4      IELETEL----SVASFLADHL--------RSSGKG----------KEVI-PAVAGF-TNA
A0A060RD97      AEVENQI----AMANYIKDYL--------LDPINA----------NALI-PRVSGA-QNL
A0A3C1ITV0      FLANNQL----AVARFIREYL--------VDNTRQ----------YDLL-PSNSGV-GSQ
R7HN19          FLANNQL----AVARFIREYL--------VDNTRQ----------YDLL-PSNSGV-GSQ
A0A350IHV0      FEVNNQL----AIAKFIKEYL--------KDPQHD----------GALI-PSNLGL-DSK
R5RVP0          FDVNNQL----AIAKFIKEYL--------ENPAHS----------GALI-PANSGL-TST
R6A0L2          LQAETQL----NVAKYLDEYL--------HTHSNS----------HDLI-PA-LNV-GDA
R7LG80          LEAETQL----NVAQYLYNYL--------DNQTND----------RDLI-PA-LSL-KDA
A0A2L2WX98      LELETQV----AVARYLTQYL--------QNSSKR----------NETV-PV-LSL-PEA
A0A285T4L1      LEQETQL----KLAQFIKEYL--------TDPTKN----------RDLI-PSGTGI-SDA
G5GD56          LQLETQL----SVARYLQEFL--------QNNSNE----------HQII-PA-INL-ERA
R5KD55          LDLNTKL----SVAGYIRDYI--------TNRANT----------NQLL-PANMGL-DDG
A0A174QNT3      IQLEAQL----NVVEFIKKYV--------TDKSKS----------ADLI-PNVSGV-GDA
A0A4S2FGS1      IQLEAQL----NVVEFVKNYV--------TDKTRS----------SDLI-PNVSGV-GDV
R9I0H0          IQLEAQL----NVVEFVKNYV--------TDKTRS----------SDLI-PNVSGV-GDV
K5BUT9          AQLETEL----SIARSIKSYL--------ADVTRK----------DQLI-PNVTGV-GDV
A0A174FPA3      AQLETEL----SIARSIKTYL--------ADVTRK----------DQLI-PNVTGV-GDV
R6S9Y6          AQLETEL----SIARSIKTYL--------ADVTRK----------DQLI-PNVTGV-GDV
A0A642LIH6      AQLETEL----SIARSIKTYL--------ADVTRK----------DQLI-PNVTGV-GDV
C9KX15          AQLETEL----SIARSIKTYL--------ADVTRK----------DQLI-PNVTGV-GDV
A0A6H0KRK1      LQMETEL----SIAQSIKSYL--------LDATRN----------NQLI-PNVSGV-GDA
R6DAG6          LQMETEL----SIAQSIKSYL--------LDATRN----------NQLI-PNVSGV-GDA
A0A3L8AAP1      LQMETEL----SIAQSIKSYL--------LDATRN----------NQLI-PNVSGV-GDA
A0A4S2AYX2      LQMETEL----SIAQSIKSYL--------LDATRN----------NQLI-PNVSGV-GDA
A0A4Y9H477      LQMETEL----SIAQSIKSYL--------LDATRN----------NQLI-PNVSGV-GDA
A0A0E2M2Y7      LVVERNL----SLAKYIQSFL--------RQTSTD----------NELM-PANLGL-TER
A0A0K2J6Z0      LVVERNL----SLAKYIQSFL--------RQTSTD----------NELM-PANLGL-TER
B2RKZ8          LVVERNL----SLAKYIQSFL--------RQTSTD----------NELM-PANLGL-TER
A0A212GC82      LVVERNL----SLAKYIQSFL--------RQTSTD----------NELM-PANLGL-TER
A0A254MU12      LVVERNL----SLAKYIQSFL--------RQTSTD----------NELM-PANLGL-TER
R6CQ93          MEQETQL----KLAQFIKEYL--------TDPTKS----------RDLI-PSGTGI-SDA
A0A3D1NQW3      LSLENQI----RMTEFLKEYL--------LDPTKT----------NELI-PGTLSI-NSP
B0MT10          LSLENQI----RMTEFLKEYL--------LDPTKT----------NELI-PGTLSI-NSP
R7JGW9          LSLENQI----RMTEFLKEYL--------LDPTKT----------NELI-PGTLSI-NSP
A0A3D2BF46      LSVENQI----SMAQYIRDYL--------LNDTKL----------RDLI-PANVAI-TNV
A0A358R538      LSLENQI----AVARFVSDYL--------RDPAHA----------GELI-PMAASV-ASE
A0A1Y4AAB8      LSLENQI----NVAEFIRSYL--------LDREHA----------GDLI-PAMAAI-ANS
A0A1Y3WWY9      LSLDNQI----NVAQFIRSYL--------SDPSKA----------GELI-PAMASV-TNA
A0A1Y4U5L4      LSLDNQI----NVAQFIRSYL--------SDPSKA----------GELI-PAMASV-TNA
A0A1Y3VCJ1      LSLDNQI----NIAEFVRGYL--------ADPAKS----------GELI-PAMAAI-SNG
A0A1Y3QTW7      LSIENQI----SVANYIRDYL--------NNPTHA----------GELI-PMVASL-TNN
R6XWY7          LSIENQI----SVANYIRDYL--------NNPTHA----------GELI-PMVASL-TNN
A0A4Y1X9Y9      LSIENQI----SVANYIRDYL--------DDPSHA----------GDLI-PMVASL-TNN
A0A4Y1WM66      LSIENQI----SVANYIRDYL--------DDPSHA----------GDLI-PMVASL-TNN
A0A174AVF1      LSIENQI----SVANYIRDYL--------DDPSHA----------GDLI-PMVASL-TNN
A0A656Q4F4      LSIENQI----SVANYIRDYL--------DDPSHA----------GDLI-PMVASL-TNN
A0A1Q6EIY0      LTIENQI----SVADFIREYL--------NDPSHA----------GDLI-PMVASM-TNN
A0A5B5VN71      LTIENQI----SVADFIREYL--------NDPSHA----------GDLI-PMVASM-TNN
E4M8L3          LTIENQI----SVADFIREYL--------NDPSHA----------GDLI-PMVASM-TNN
I3YQ50          LTIENQI----SVADFIREYL--------NDPSHA----------GDLI-PMVASM-TNN
R5UEY8          LTIENQI----SVADFIREYL--------NDPSHA----------GDLI-PMVASM-TNN
A0A1H4D866      LSLENQI----NVAEFIRTYL--------NDPKNA----------GELI-PMMASV-TNQ
A0A5B3G4Y7      LSLENQI----NVAEYIRTYL--------NDPKNV----------GELI-PAMAAAGTNT
A0A374A9J5      LSLENQI----NVAEYIRTYL--------NDPKNV----------GELI-PAMAAAGTNT
A0A5B3GQN5      LSLENQI----NVAEYIRTYL--------NDPKNV----------GELI-PAMAAAGTNT
A0A1Q6E9S3      LSLENQI----NVAEYIRTYL--------NDPKNV----------GELI-PAMAAAGTNT
D4IJ36          LSLENQI----NVAEYIRTYL--------NDPKNV----------GELI-PAMAAAGTNT
A0A414Q925      LSVENQL----NMAQYMKEYL--------QDNSKT----------TELV-PASIGI-DDM
A0A415PUS9      LSVENQL----NMAQYMKEYL--------QDNSKT----------TELV-PASIGI-DDM
A0A108TCU0      LSVENQL----NMAQYMKEYL--------QDNSKT----------TEPV-PASIGI-DDM
A0A413BA42      LSVENQL----NMAQYMKEYL--------QDNSKT----------TEPV-PASIGI-DDM
S3Y344          LSVENQL----NMAQYMKEYL--------QDNSKT----------TEPV-PASIGI-DDM
A0A4Q5G8Y8      LSVENQL----NMAQYMKEYL--------QDNSKT----------TEPV-PASIGI-DDM
A0A412TGL3      LSVENQL----NMAQYMKEYL--------QDNSKT----------TEPV-PASIGI-DDM
A0A413VJ33      LSVENQL----NMAQYMKEYL--------QDNSKT----------TEPV-PASIGI-DDM
A0A414L0W6      LSVENQL----NMAQYMKEYL--------QDNSKT----------TEPV-PASIGI-DDM
A0A412DP39      LSVENQL----NMAQYMKEYL--------QDNSKT----------TEPV-PASIGI-DDM
A0A413ZSE8      LSVENQL----NMAQYMKEYL--------QDNSKT----------TEPV-PASIGI-DDM
B0NP84          LSVENQL----NMAQYMKEYL--------QDNSKT----------TEPV-PASIGI-DDM
R6AK43          LSVENQL----NMAQYMKEYL--------QDNSKT----------TEPV-PASIGI-DDM
A0A412N2D9      LSVENQL----NMAQYMKEYL--------QDNSKT----------TDPI-PASIGI-DDM
A0A1Y4JYS9      LSVENQL----NMAQYMKEYL--------QDNSKT----------TDPI-PASIGI-DDM
R6LHA4          LSVENQL----NMAQYMKEYL--------QDNSKT----------TDPI-PASIGI-DDM
A0A3E5HPT8      KELDTQL----QLVSFIKQYL--------QDSNKD----------DELI-PSNIGL-SDL
C6IJ48          KELDTQL----QLVSFIKQYL--------QDSNKD----------DELI-PSNIGL-SDL
Q8A3U2          KELDTQL----QLVSFIKQYL--------QDSNKD----------DELI-PSNIGL-SDL
A0A3R6S1H6      LGLENQL----SLARSIKEYL--------HDPQHE----------RDLI-PSNTGI-PDV
A0A3R6SD81      LGLENQL----SLARSIKEYL--------HDPQHE----------RDLI-PSNTGI-PDV
A0A354WXN6      LSLQSQL----QLAKYIKEYL--------IDPSHN----------ADLI-PANTGV--DV
R5IP14          VSLENQI----SLVNFIKDYL--------SDPVKI----------NDLI-PANTGI-ESA
A0A316SZX7      LSLENQI----NLALFIKEYL--------SDEKHV----------SELL-PANTGV-ADL
A0A1Y4AIY1      LSLENQL----SVAQYIRDYL--------SDPQKA----------LDLI-PANT-I-TDV
A0A0J6CIR2      LGLENQV----TLAKYIRDYL--------TDPHKS----------SDLI-PANTGI-ADV
A0A3D8HG59      LSLENQL----TLARYIRSYL--------VDPSKE----------AELI-PANTGI-SDS
A0A3R6S408      LSLENQL----TLARYIRSYL--------VDPSKE----------AELI-PANTGI-SDS
F3ZRU7          LEVLNQL----SLGQYIKDYL--------IDPANR----------GKLI-PANTGI-SDN
A0A1C5Q1F3      VTLENQR----TLALYIRDYL--------ADPAKS----------GELI-PSNTGI-SDG
R7A239          VTLENQR----TLALYIRDYL--------ADPAKS----------GELI-PSNTGI-SDG
A0A3R6HIK7      LSLENQV----AVAKYIRDYL--------SDPQKA----------LELI-PANT-I-TDM
K5ZVW7          LSLENQV----AVAKYIRDYL--------SDPQKA----------LELI-PANT-I-TDM
A0A1Y4D5Z0      LSLENQL----AMAKYVREYL--------SDPHKA----------SDLL-PANT-L-SDV
A0A413VXJ7      LSLENQL----SIAKYIKDYL--------VDPQKN----------ADLI-PANTGI-SDN
I9RSN9          LSLENQL----SIAKYIKDYL--------VDPQKN----------ADLI-PANTGI-SDN
U6RJK5          LSLENQL----SIAKYIKDYL--------VDPQKN----------ADLI-PANTGI-SDN
A0A1Q6GA32      LSLENQL----SIAKYIKDYL--------VDPQKN----------ADLI-PANTGI-SDN
I9RPU6          LSLENQL----SIARYIKEYL--------TDPQKN----------SDLI-PANTGI-SDN
I8YFS5          LSLENQL----SIVKYIKEYL--------VDPQKS----------SDLI-PANTGI-SDT
A0A6H9LTF8      LSLENQL----SIVKYIKEYL--------VDPQKG----------SDLI-PANTGI-SDN
I8Y597          LSLENQL----SIVKYIKEYL--------VDPQKG----------SDLI-PANTGI-SDN
A0A1Q6GBF5      LSLENQL----SIARYIKEYL--------TDPLKN----------SDLI-PANTGI-SDN
I8YFZ3          LSLENQL----SIVRYIKEYL--------TDPQKN----------SDLI-PANTGI-SDN
A0A6H9M1J1      LSLENQL----SIARYIKEYL--------TDPQKS----------SDLI-PANTGI-SDN
A0A1Q6GDH2      LSLENQL----SIAKYIKEYL--------TDPQKN----------SDLI-PANTGI-SDN
U6RSB0          LSLENQL----SIARYIKEYL--------TDPQKS----------SDLI-PANTGI-SDN
I9GXM2          LSLENQL----SIAKYIKEYL--------TDPQKS----------SDLI-PANTGI-SDN
I9SIK1          LSLENQL----SIAKYIKEYL--------TDPQKS----------SDLI-PANTGI-SDN
A0A6H9LZ74      LSLENQL----SIAKYIKEYL--------TDPQKS----------SDLI-PANTGI-SDN
I9TP59          LSLENQL----SIAKYIKEYL--------TDPQKS----------SDLI-PANTGI-SDN
R5S343          LGLDNQL----SLAKYIREYL--------TDTRTR----------GKLI-PANTGL-TDM
A0A1M6K7I9      LSLENQL----SLAEYIKQYL--------VDPSKV----------ADLI-PANTGI-TDA
A0A5M6A8C8      LSLENQL----SLAEYIKQYL--------VDPSKI----------ADLI-PANTGI-TDA
A0A6H9LT84      LSLENQL----SISKYIKEYL--------VDPQKN----------SDLI-PANTGI-SDN
A0A6H9LUV5      LTLENQL----SIAKYIKEYL--------IDPQKN----------SDLI-PANTGI-SDN
A0A3R5ZMK1      LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
A0A3E4ZTK7      LSLENQL----SLAKYIKNYL--------TDPGKS----------SELI-PANTGI-SDV
A0A1Y3ZIA4      LSLENQL----SLAKYIKNYL--------TDPGKN----------SDLI-PANTGI-SDV
K5Y1A4          LSLENQL----SLAKYIKNYL--------TDPGKN----------SDLI-PANTGI-SDV
A0A4Q5CIT0      LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
A0A3R6K8X4      LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
A0A414GI87      LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
A0A415BDM7      LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
A0A412DM15      LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
A7AEU7          LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
A0A1Q6I3T6      LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
A0A414XX40      LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
A0A3R6BKI7      LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
A0A414LPI6      LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
A0A412M2W1      LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
K5ZX55          LSLENQL----SLAKYIKNYL--------TDPGKS----------SDLI-PANTGI-SDV
A0A5F0U645      LGLENQL----TLAKYIREYL--------TDPHKG----------ADLI-PANTGI-SDV
K5ZBN2          LGLENQL----TLAKYIREYL--------TDPHKG----------ADLI-PANTGI-SDV
A0A0J6CKW3      LGLENQL----TLAKYIREYL--------TDPHKG----------ADLI-PANTGI-SDV
A0A0F5IQM7      LGLENQL----TLAKYIREYL--------TDPHKG----------ADLI-PANTGI-SDV
A0A496CDT3      LGLENQL----TLAKYIREYL--------TDPHKG----------ADLI-PANTGI-SDV
A0A6G1ZKM3      LGLENQL----TLAKYIREYL--------TDPHKG----------ADLI-PANTGI-SDV
S0GLB0          LGLENQL----TLAKYIREYL--------TDPHKG----------ADLI-PANTGI-SDV
A0A3R6NLC1      LGLENQL----TLAKYIREYL--------TDPHKG----------ADLI-PANTGI-SDA
A0A416WYC9      LGLENQL----TLAKYIREYL--------TDPHKG----------ADLI-PANTGI-SDA
A0A0F5IT40      LGLENQV----TLAKYIRDYL--------TDPHKS----------SDLI-PANTGI-ADV
A0A496CX20      LGLENQV----TLAKYIRDYL--------TDPHKS----------SDLI-PANTGI-ADV
A0A5F0UBI0      LGLENQV----TLAKYIRDYL--------TDPHKS----------SDLI-PANTGI-ADV
A0A6G1ZHG0      LGLENQV----TLAKYIRDYL--------TDPHKS----------SDLI-PANTGI-ADV
S0GSI7          LGLENQV----TLAKYIRDYL--------TDPHKS----------SDLI-PANTGI-ADV
K5YB65          LGLENQV----TLAKYIRDYL--------TDPHKS----------SDLI-PANTGI-ADV
A0A0F5IWP9      LGLENQL----TLAKYIRDYL--------IDPHKS----------SDLI-PANTGI-ADV
A0A0F5IZT8      LGLENQL----TLAKYIRDYL--------IDPHKS----------SDLI-PANTGI-ADV
A0A417LKQ2      LGLENQR----TLAKYIRDYL--------TDPHKS----------SDLI-PANTGI-ADV
A0A416TME1      LGLENQR----TLAKYIRDYL--------TDPHKS----------ADLI-PANTGI-ADV
A0A416XPE8      LGLENQR----TLAKYIRDYL--------TDPHKS----------ADLI-PANTGI-ADV
A0A3B0C2S4      TNLETQI----SLAALLKNAV--------LGQSA-----------YGLL-PVDVGL-ENS
L8JI02          ADLQVKL----KYYTYISESL--------AEGRFG----------DVVA-PSTFGL-EDP
A0A4Q5WS95      AEVNMKM----AVLGQVEQYV--------SAKQRD----------GSLV-PSTLGI-DDP
A0A501VZX6      SDIDLQL----AVLDKVENYV--------IAKEKA----------RGIV-PSTLGL-NDA
A0A399SH26      EDINLQL----AVLAKIENYI--------IAKDKS----------AGIV-PSTLGI-NDP
A0A501W1A9      GEINLQL----AVLDNVESYV--------KAKNNT----------AGIV-PATLGV-NDP
A0A0E3ZGV6      NEINLQL----AVLDNVERYV--------VRKNKD----------LGIV-PSTLGV-SDP
A0A1I2N4S1      NEINLQL----AVLDNVEKYV--------LSKEEN----------IGIV-PSTLGV-SDP
A0A2T5YE44      NEINLQL----AVLDNVEKYV--------LSKEQN----------IGIV-PSTLGV-SDP
A0A1V9FHD0      ADLSMEL----AALDEMERYA--------NSKDNN----------TETV-PSTMDI-PDP
A0A4V4H170      ADLSMQL----AALGEMERYV--------NSNENN----------GNIV-PATLGI-SDP
A0A1V9F098      ADLSMQL----ASLNEMERYV--------NSKENK----------GDII-PATIGI-SDP
A0A4R2VU64      VDISMQL----ASLNEMERFV--------SSKDNN----------ADML-PATMGI-TDP
A0A4S8HY23      ADLSMQL----AALEEMERYV--------KSNENK----------GDVV-PATLGI-SDP
A0A1V9F383      ADLSMQK----AALDEMENYV--------TSRSNK----------GDLV-PATLGI-TDP
G8TRZ6          ADLSMQI----AAVDEMENYV--------NQKSNT----------GDLI-PSTLGI-ADP
A0A543WA52      ANLNRQL----DVLNRVESYV--------ISKNNE----------GGLV-PSTMGI-NDP
A0A1M5BA90      TDINMQL----AMLNEVEKYV--------LSKNNQ----------IGIV-PSVVGV-KDP
A0A512B879      TEVNMEM----AMLNEVEKYV--------QAKDSQ----------IGIV-PSIAGL-KDP
A0A559PPI3      ADIRLKL----SVLDKVENYI--------LSKDGG----------GSIV-PSTLGI-DDP
A0A1T5CS78      SELELQL----AVLNNVENYV--------ISKGSA----------GGMV-PSTLGI-SDP
A0A0Q9Z8F1      SELELQL----AVLNNVENYV--------ISKGSA----------GGMV-PSTLGI-SDP
A0A2N0U0M7      SELELQL----AVLNNVENYV--------ISKGSA----------GGMV-PSTLGI-SDP
A0A2N3U785      SEWQVQI----DVLQTIEDYL--------TKSKNK----------SILV-PSTLNI-KDP
A0A0D3L8Q3      SEYELQL----EILNSIEDYL--------RREGNE----------VGIV-PSTLSI-TDH
A0A0E3ZG78      SDWAIQI----EILESIESYL--------NKDENQ----------YKMV-PSTLSI-QDV
A0A1I6BRK6      AEWATQS----EVLESLENYL--------KNNNN------------SIV-PNSLGI-KDE
A0A243WAB1      SEWGIQI----DVLESIENYL--------KRTNGQ----------YSMV-PSTLGI-KDE
A0A6G8C8X6      SEWAIQI----DVLESIETYL--------RKTSGQ----------YSMV-PSSLGI-QDP
A0A5B6TJH8      SEWAIQI----DILRSIEKYL--------SQDKGE----------YRMV-PSSLGI-QDQ
A0A519U664      AEWATQI----DLLESLESYL--------RKNTGQ----------YSIV-PSSLGL-KDE
A0A519UDD1      SELAIQI----DVLESLERYL--------VTTAGR----------YTTV-PSSLGI-KDG
A0A519MA34      SEGATQI----DLLESLEGYL--------RKNAGQ----------YSIV-PSSLGL-KDE
A0A519UCX0      SEWATQI----DLLESLESYL--------RKNAGQ----------YSIV-PSTLGL-KDE
A0A4R5DL69      LQVNLEL----DMISSLQAFI--------KKNPNGIIP-------------SSIVL-QSS
A0A1M4YED3      TSINMQV----STLDQIERYV--------TSRNNK----------DGVA-PATLGL-NDR
A0A2H3NSN0      DQLEFQL----QEEQRTLDML--------VNQLNEAESSFRSDVEGE----QSVQS-MQN
A0A2P6C324      DALTFQL----EQEKRTLSIL--------EDQMERAQPSLRSAVLKE----QEVQS-LRT
A0A1M6XHU0      DAARFQL----EQEKSALQFI--------EQELQKLEPGLVNELVKS----RQVAT-LEA
A0A5S9C8G0      DAARFQL----EQEKSALQFI--------EQELQKLEPGLVDELVKS----RQVST-LEA
G2SF81          DAARFQL----EQEKSALQFI--------EQELQKLEPGLVDELVKS----RQVST-LEA
A0A5S9EYW1      DAARFQL----EQEKSALQFI--------EQELQKLEPGLVDELVKS----RQVST-LEA
D0MHQ9          DAARFQL----EQEKSALQFI--------EQELQKLEPGLVDELVKS----RQVST-LEA
A0A126PFG0      RLNEAQV----QLAV-----------------VSTIERTLRDPRPTATV-PTALGI-TDA
A0A3M1N7Z3      DLNKLDK----SLSVEYLNAF--------SEKLRRVLDTLRQDPAAEVA-FLPLGA-LPE
                                                                            

A0A1T5MMH4      YM--FKDIDEVQSLL--LQ-------------QERLKL---------SYNE-NTLAY---
A0A2W4R1L8      AI--NDNLDKLSELQ--MS-------------FDRLKL---------SYSE-VTFAF---
A0A2E5CV79      VL--RKEINQLESQS--IQ-------------NAMIYG------------E-NHSAV---
A0A2D4ZVH1      AI--GPVIERYQYAL--AELETNKL-------LYLTKNP--------GISE-NNPEI---
A0A0K8QSK7      DPMMTSLTQELNTLT--LE-------------KSRLGNV--------RVS----PRL---
A0A1V6CN82      DPLLSGLLSQYNQLT--VE-------------KSKMSDV--------LIS----PRL---
A0A1M4XZ45      DPLLNSLILQLNELI--TE-------------KSSQTSI--------RKGS-EHPTI---
A0A399D319      DPLLNSLILRLNELI--TE-------------KSSQTSI--------KRGS-QHPII---
A0A1M6GR99      DPLLNNLIEELSTAQ--TQ-------------KDNLIQ---------NNQQ-RNPIV---
A6EBM4          PLL-ATLAQNLNSLL--HE-------------KEELLK---------VYNG-DAQAV---
A0A1M6TTV4      ----MQLLVDYNKLK--NE-------------RMLKLE---------SYNE-NTQVI---
A0A4Q8RX32      NQVLNDLLNEYVDLV--GR-------------KRHLIE---------NRQD-KSPQL---
K0X1U5          GA--AEAINEYNKLL--LE-------------RMRLLR---------TAKD-SNLAL---
R5EXK3          GA--AEAINEYNKLL--LE-------------RMRLLR---------TAKD-SNLAL---
A0A401UAP7      QEV-INDVLAYQKKR--EA-------------INELKL---------SYKE-STFAY---
A0A1W2GF52      ----TELVNSYNDLV--ND-------------RALKLN---------SYNE-NTQVI---
A0A2G5L7B8      ----LEMLAEYNELK--NE-------------RLLKLD---------TYNE-NTQII---
A0A523GAC0      ----NTTLSKLGDLV--RE-------------RELLKI---------SYHK-NTFAV---
L8JW09          ----ADAYNELSVQI--SE-------------RDKLRL---------SYNE-TTFAL---
A0A364XUP5      PEYISKNLDRVQELF--LT-------------QEKLKL---------SYNE-TTFAY---
A0A1M5RLA9      PPTVAKNLEQLEDLY--RD-------------QEKLKL---------SYNE-ATFAY---
A0A385SFR9      PPTIAKNLEQLEDLY--RD-------------QEKLKL---------SYKE-VTFAY---
A0A5M4A9J4      NPMLVSLLQQLAGQT--LD-------------LTTLET---------TVIDKNHPTL---
A0A5M4B1C7      DPMIVNLLQQLTSQT--LS-------------LKTLKT---------AVIDPNHPSV---
A0A0D3LFR6      ADI-KTLLDQLNKLI--SE-------------KEVLLE---------HYNE-NTQAA---
M7N6D4          AEL-KGLVEELNTLT--SE-------------KEILLA---------SQNE-NTQAV---
A0A4D7K1D4      SI--TELIEEINVLE--TE-------------RLQLLE---------KYNE-NTYAV---
A0A5C7MX19      DV--NDLITRINVLK--NE-------------RNLVLL---------DVTP-DHPKV---
A0A1Q3ZMZ7      GII-RTQIETLQEMI--TD-------------RDILLN---------KVQK-SNPEI---
A0A2D8JJW3      --------------------------------EQEIGK----------------------
A0A2W2AFF7      TF--VALIDKYNGVQ--LE-------------RERMLM---------STTE-ENPMV---
R7PCR1          GI--QQEISAYNDIL--IE-------------KKNLEQ---------NST--NSPVI---
A0A2N5YXE2      TFI-AGMINSLQELL--NK-------------KEILLF---------DVTA-NNHKI---
A0A1G9E2A9      QL--LSLVNQLNTKR--IE-------------QSTLLV---------STKP-TTQAY---
A0A098LL25      QL--SAAINSLNTLQ--EE-------------RNRLLN---------SQRE-NTLVV---
A0A6C0GJI1      QL--GELTQNINKLQ--QE-------------KALALA---------SSKS-TTFAI---
A0A2T2YJE8      QL--LKQIAQLSDLQ--LD-------------RNLMVQ---------SYKT-TTKAY---
A0A127B287      QL--AQLLTELNDLQ--AQ-------------RRKVLT---------TTRG-NTLSV---
A0A3M9N829      QL--SELLTELSQLQ--AR-------------SRTARM---------TSRG-NTAAD---
A0A0P0CSF9      QL--AEQLTELSDLQ--AQ-------------QRTRRL---------TSRG-NTLAD---
A0A5M8QQB8      QL--TEQLTELSDLQ--AR-------------IRTQSM---------TSRG-NTTAE---
A0A3M9MNC3      QL--AEQLTELSDLQ--AQ-------------QRTRKL---------TSRG-NTLAD---
A0A5B6TAX2      EL--AEQLTELSDLQ--AR-------------LRTVRL---------TSRG-NTTAD---
A0A5N1IQ33      QI--AEQISILNEQQ--GD-------------LNRLLE---------SYRP-TTTAV---
A0A512AYT3      EL--SSRISELSNLQ--LY-------------YKLLKR---------SYKD-STEAV---
A0A5M6CYN7      EL--SQRIAELSDMQ--LY-------------YKLLLR---------SYKP-ETEAV---
A0A369QP10      QL--SNRISQLSNLQ--LD-------------RSLMMQ---------SYKT-TTKAY---
A0A126PDF2      IL--SQLLSQLNGMQ--WE-------------QERIRR---------SYTG-ATEAV---
A0A2Z3GKA1      VL--SQLLSQLNGMQ--WD-------------QERIRR---------SYTG-ATEAV---
A0A502GZP7      LL--SQLLSQLNGMQ--WD-------------QERVSR---------SYTG-ATEAM---
A0A519SBU8      IL--EKLLDQLDNEQ--RE-------------LRLTLK---------SQTD-KTFAV---
A0A4Q3JNZ3      VL--TGMLEQLDAQQ--RS-------------LRLTLK---------SQTD-QTFAV---
A0A519Q9V3      VL--TGLLEQLDGQQ--RS-------------LRLTLK---------SQTD-KTFAV---
A0A0M3RW20      IL--TQQITELNLAQ--QD-------------LRRVLR---------SSTE-ATEAV---
A0A495VFX4      VL--TQQITELNLSQ--QD-------------LRRVLR---------SNTE-ATEAV---
A0A1S9B3W0      VL--SQQIGFLNEQQ--RE-------------MRKVLQ---------SYQPNATTAV---
A0A1W1VRL3      RL--TQEIEALNDQQ--WD-------------LRRVLR---------SYKE-TTEAV---
A0A1M6R305      QL--SQQLTEVNSLQ--WN-------------LRRLSR---------SYKE-TTEAV---
A0A4Z0PHK3      QL--TGQLAELNNLQ--WN-------------LRRLLR---------SYNE-TTEAV---
A0A2M9B9H9      QL--TQQLSELNALQ--WN-------------LRRLLR---------SYNE-TTEAV---
A0A4Z0QCY9      QL--TSQLTELNSLQ--WN-------------LRRLLR---------SYNE-TTEAV---
A0A418R9X5      QL--TKRITELSDLQ--LD-------------LSQLLK---------SYQE-TTTAV---
A0A428JSJ3      QL--LQRITELSNLQ--LD-------------LSQLLK---------SYQE-TTTAV---
A0A428KI59      QL--TQRIIELSDLQ--LD-------------LSQLLK---------SYQE-TTTAV---
W8F1I6          QL--TQRIIELSDLQ--LD-------------LSQLLK---------SYQE-TTTAV---
A0A246FQC0      QL--VQRITELSDAQ--LD-------------LKRALL---------SYQPGATLAM---
A0A372E5P8      QL--IQRITELSDAQ--LD-------------LKRALL---------SYQPGATVAM---
A0A1H3EMW1      QL--VQRITELSDAQ--LD-------------LKRALL---------SYQPGATVAM---
A0A1H9ZSN3      QL--VQRITELSDAQ--LD-------------LKRALL---------SYQPGATLAM---
A0A5N1J2M4      QL--SEKIKELGTLQ--TR-------------REVVLA---------SNQP-GTFAV---
A0A519S476      SL--VSLLEELDTRQ--RR-------------LRLTLK---------SQTD-KTTAV---
A0A4Q3JRW8      TL--VALLDQLDGQQ--RQ-------------LRLTLK---------SQTD-KTFAV---
A0A519M923      VL--MGMLDQLDGQQ--RS-------------LRLTLK---------SQTD-KTLAV---
A0A4Z0ENW1      AL--SQQLNNLNILQ--QN-------------LRRIRR---------SYQD-RLEAV---
A0A519UDB4      PI--TQQLNDLHILQ--QN-------------LRRVER---------SYTD-KTEAL---
A0A3S0QKV1      QL--TQLMSVLNEQQ--RD-------------MRKILE---------SYQPNATAAV---
A0A328BL48      QI--SQQLTVLNEQQ--RE-------------LRQVLQ---------SYQP-TTTAV---
A0A5R8WLY4      QI--SQQLTALNEQQ--RE-------------LRQVLQ---------SYQP-TTTAV---
A0A1I5WSL8      QL--LQQLNELNNLQ--WN-------------LRRISR---------SYTD-KTETV---
A0A0U3JVM7      QL--AQQLNELNDLQ--WQ-------------LRRASR---------SYTD-KTEAI---
A0A1G1SSV2      QL--GQELNQLNSLQ--WR-------------LRRVSR---------SYNE-STEAV---
A0A1G1SXV7      QL--GQELNQLNSLQ--WR-------------LRRVSR---------SYNE-STEAI---
A0A6G8CBJ6      RL--IQEIEALNSQQ--WD-------------LRRVLR---------SYKE-TTEAV---
A0A0W8EDI5      QL--TQQIGVLNDQQ--AD-------------MNRLLE---------SYKP-TTTAV---
A0A3B7RBP8      QL--SQQIALLNDQQ--AD-------------LNRVLE---------SYKS-TTTAV---
A0A3R9P8H7      QL--VARIQELSDAQ--LD-------------LKRALL---------SYQPGATTAM---
A0A238WIA7      EL--TERIGELYGLQ--LD-------------LNRASV---------GYKP-TTTAI---
A0A212UCJ7      EL--AARIGELYDLQ--LQ-------------INRVSN---------SYTP-ETQTI---
A0A4Z0MQE1      EL--TERISELYGLQ--LE-------------INRISN---------SYTP-ATQAI---
A0A4Z0PCF4      EL--TERVSELYGLQ--LD-------------INRISN---------SYTP-ETQTI---
A0A5D6VDG1      VL--TQQITELNAAQ--QD-------------LRRVLR---------SNTE-ATEAV---
A0A6H1CVS0      VL--TQQITELNAAQ--QD-------------LRRVLR---------SNTE-ATEAV---
A0A243WHR7      QV--TQQINRLNDLQ--WN-------------LRRILR---------SYQP-TTFTV---
A0A5B8A0P6      GL--TEQLTELNNQQ--YN-------------LQRLLR---------SYKE-TTEAV---
A0A076HRT9      QL--SQQLGELNDLQ--WN-------------LRRLLR---------SYKE-TTEAV---
A0A4Z0PVM7      QL--TSQLTELNSLQ--WN-------------LRRLLR---------SYNE-TTEAV---
A0A1M6DHW8      PL--TQQLSELNDLQ--RN-------------LRRILR---------SYTP-ATEAV---
A0A4Q5LC61      PL--TQQLEELNQLQ--QN-------------LRRILR---------SYTP-ATEAV---
A0A2U1FKU2      GI--DNSIAQYNELK--LR-------------YDRLKQ---------SSSE-NSPAV---
A0A0A2F954      GI--DNSITLYNELK--LK-------------YERLKQ---------SSSE-NSPAV---
A0A0A2FW91      GI--DNSITLYNDLK--LK-------------YDRLKQ---------SSSE-SNPLV---
A0A2D2N2N1      GI--DNSITLYNELK--LK-------------YDRLKQ---------SSSE-NSPAV---
Q7MWZ2          GI--DNSITLYNELK--LK-------------YDRLKQ---------SSSE-NSPAV---
T2NDT6          GI--DNSITLYNELK--LK-------------YDRLKQ---------SSSE-NSPAV---
W1R7P9          GI--DNSITLYNELK--LK-------------YDRLKQ---------SSSE-NSPAV---
A0A1R4AFZ0      GI--DNSITLYNELK--LK-------------YDRLKQ---------SSSE-NSPAV---
A0A1R4DVZ7      GI--DNSITLYNELK--LK-------------YDRLKQ---------SSSE-NSPAV---
A0A2A8CVM9      ISVLERKIGEMRAEA--AQYYVANDGLEGDTDRIETEFP--------QLAD-LLERI---
A0A5M4B212      PLL-VNLLQELSQLN--IE-------------LTTLSAT--------VKDP-EHPRM---
A0A3D1KEX9      AM--QGQIGKYNDAV--IQ-------------YTRLSA---------NSSN-SSSVI---
A0A358Y7S2      EGAVIRQIEELNDLL--EK-------------KEELLK---------DVTL-ENEAI---
A0A1X7J248      ----QPLFEEFSELK--EE-------------YQLSKT---------RYKK-ESQVL---
E4TQD2          ----QPLFEEFSELK--RD-------------YQMAKT---------RYKK-ESQVL---
A0A2J6HHN3      TYL-SPYLTSLQDLE--FK-------------RQEYLI---------TMTE-NSTVI---
A0A1Y3WMT8      GA--AEAINEYNKLL--LE-------------RMRLLR---------TAKD-SNLSL---
A0A1Y4GQU1      GA--AEAINEYNKLL--LE-------------RMRLLR---------TAKD-SNLSL---
A0A6A0R272      PTL-NQLITAFNNLK--IQ-------------KATLGV---------NFTI-DSKKA---
A0A1V5W8T5      SMV-LNFLNGIQQLQ--KQ-------------KEQLLI---------TVTP-DNHKV---
A0A2T8HKA9      NV--DRYISDYNSAL--LR-------------RNRLLE---------GNNS-NNPYV---
A0A2I0QZ80      GSL-TKQIQELYELI--ER-------------KEDLSY---------KVTQ-NNDII---
A0A3E1F1A3      SSL-NQQIQELYELI--EE-------------KEDLLF---------QVTP-QNEKI---
A0A2U2XBJ3      SSL-NSQIQELYNLI--EE-------------KEDLLY---------QVTP-QNENI---
A0A4Q4KU94      SSL-SIQIQELYNLI--EQ-------------KEDLLY---------QVTP-ENENI---
A0A3B8INU3      ----NTALQEYGNLK--VE-------------LDQLLL---------SHDP-RTLIV---
A0A2W1NDY9      PLL-EGQIEKLYRLL--ED-------------QEDASY---------RMTM-ENDGL---
A0A5C8AQR5      SSL-SKQIEDLHQML--EK-------------KEDLLF---------DVKP-DNSVI---
A0A1G0CI31      ISL-TRQITDLHALL--QR-------------KEDLLF---------DVTE-NNTEI---
A0A556N0M0      LSL-TKQITDLNTLL--ER-------------KEELLT---------NVSE-NNSEL---
F2IKD6          SSL-TKQITDLNTLL--ER-------------KEELLT---------NVTE-NNSEL---
A0A1I7BM74      NAL-KDQIETLFSKL--EQ-------------RENLLY---------TVTE-ESRTI---
A0A2G2FJ17      GSL-NLQVKELHELL--ET-------------KEDLLY---------KVTP-ENDMI---
A0A2E3R1D0      AA--RERIQQLNAEL--EVFYRQNPALRN---DTNPPA---------NIAR-LRTEL---
A0A2T2USC0      QV--QKEKAEVASEI--NAVRRNNPNLEPGD-SSPKAR---------EFAR-LEEKS---
A0A2T2V0F3      QV--QREKAQVTAEI--NAVKRNNPDLDPGG-TSPKAR---------EFAR-LKERA---
A0A2T2S682      QV--QQEKANVAAEI--NRVKTRNPNLDADA-STARAK---------NLRQ-LQRRA---
D5H561          SL--QSEIAKLELSK--QQLELQS----GAP-TPADSA---------QAAQ-IDRRI---
A0A2H3NWA9      RV--QEERAELKQQL--DQALERNSNLSPNPNGNALER---------ELAR-TQERI---
A0A2A8CVB6      SV--QEEKARLQARI--DQIERENPNLGA---GGTLQR---------DLRR-MKERV---
A0A2P6C1S6      SL--QTEQAELESKI--DRVERNNPDLEP---TSQLGR---------ELQR-MKTRA---
A0A2T2UTM4      TF--QTEKAELEVKI--DRVERRNPDLDP---TSRLGQ---------ELQR-MKARA---
A0A414ZBF2      GI--QNQINEYNTTL--TK-------------KNKLMA---------NSSA-NNPIV---
A0A1Q3Q573      MSI-AGEIENINQLQ--RS-------------REIKLL---------ERTE-DHPEV---
A0A662BAY3      DPLLNALILELNNLS--IE-------------KSSMTS---------VKNT-EHPKL---
A0A4U3L369      TF--TELVGKYNTLM--IE-------------RDRVSL---------NYPD-TNPLL---
A0A357YNR3      SL--NNQINSYNNLV--LE-------------RNRLAR---------IASS-SNQSM---
A0A5E8AX52      PEFISGSLTEYNKLF--GE-------------REVLLG---------SYNE-NTHAV---
F4KK08          SI--EAAIAKYNEFL--LK-------------RDQLQA---------NSSS-QNPLV---
A0A6B5PK86      SAI-AGHIEALHLLL--EE-------------KEDVLF---------RLTP-ESSEV---
A0A2G2F510      TSL-VKHIEELHLLL--ER-------------KEDLLY---------RVTP-ENSEV---
A0A316JZ08      ASL-VTHITDLHDML--EQ-------------KEDLLV---------SLTP-NNEKV---
A0A496LCF9      PRL-IALVDKYNELQ--IK-------------LL-------------DLGA-KNPQY---
A0A5P2G2A9      AL--ESILTQYNALV--LQ-------------KERYAT---------TNTS-ENPGM---
A0A3C0ZQC7      LLQEQLAMLEVRRDV--TV-------------AQNPTYV--------GQDI-YTQKL---
A0A419VXB7      VGL-NSMVVRLSELN--SK-------------KETLSY---------SVHS-KNPGI---
A0A0B0BTJ4      AL--SNAINKYNELV--LE-------------RMRLGT---------ETSD-DNPVI---
A0A3B9CNN6      AL--SNAINKYNELV--LE-------------RMRLGT---------ETSD-DNPVI---
R5X290          AL--SNAINKYNELV--LE-------------RMRLGT---------ETSD-DNPVI---
A0A1Q6E6I7      AL--SNAINKYNELV--LE-------------RMRLGT---------ETSD-DNPVI---
C3J7R8          SA--DNLIREYNSLL--LR-------------RDQLIA---------NAET-QNPVV---
A0A1G8BVM8      GI--ESQIARYNETM--TL-------------RNKLLA---------NSTS-NNPII---
A0A1I1FXP9      ELV--DLAEALSDLQ--NQ-------------KEMMSY---------TAKE-GTLAA---
A0A3N4H5N3      ----GDLLTRYNDLQ--RD-------------RQRLSR---------VVQP-NNQQI---
A0A2P8EAX2      ----SELLSKYNDLL--RE-------------RQRISR---------IVQP-NNQQL---
A0A4V2F6N9      ----SDLLAKYNDLL--RE-------------RQRISR---------IVQP-NNQQL---
A0A3B9FXJ0      NNF-APYFNSLSELE--KQ-------------KANLML---------SLPP-TDPKV---
R5GSU5          GI--QQQITEYNKLV--LE-------------RNRLAP---------NTGE-NSPVM---
A0A2A3UE91      SVI-KDVTQNIQKLL--SE-------------KENLLY---------AVTP-NSENI---
A0A0A2G557      AS--NSLIKEYNTLY--LY-------------REQLLS---------ESGQ-TNPLI---
A0A2N2WFW8      VYL-APYLQSLKELE--MK-------------KQDLLV---------HITE-NSTAV---
A0A1F3IU95      VYL-SPYLQSLKDLE--MR-------------KQELLL---------RVTE-NSTAI---
A0A3D0VUF6      VYL-SPYLQSLKDLE--MR-------------KQELLL---------RVTE-NSTAI---
A0A1T4PT95      SS--NTLINEYNTLY--LY-------------RERLLS---------ESGQ-TNPLI---
A0A6I6JYY3      DPLLNSLILQLNDLI--TQ-------------KSSLTSV--------RANS-QHPAI---
A0A2A4PYG9      DEI-SDLVQSLHKLL--AK-------------KEEILY---------TATK-ESEAV---
A0A1F3K695      NVI-EGILNTLQSLI--TQ-------------KEVLLN---------DVTN-NNHQI---
A0A353KZR1      NVI-EGILNTLQSLI--TQ-------------KEVLLN---------DVTN-NNHQI---
A0A2N2WYB5      AIL-VSVLNNLQQLI--SE-------------KEQLLN---------DVTP-NNLKI---
A0A1F3K4G0      TIV-VNVLNNLQELI--NK-------------KEQLLN---------DITR-DNLKI---
A0A356H8Y3      TIV-VNVLNNLQELI--NK-------------KEQLLN---------DITR-DNLKI---
A0A351HSA6      TIV-VNVLNNLQELI--NK-------------KEQLLN---------DITR-DNLKI---
A0A1F3Q014      SNI-TSAVEALHKLL--IQ-------------KEEMLY---------DVKP-NSEAT---
A0A2A4YXP3      GGI-MSLITSLKEFL--IQ-------------KENLQF---------EVTK-DSEII---
A0A2D5KD44      SSI-SSLIEQLNDLL--LK-------------KQELLF---------TMRE-NSNRI---
A0A1F3R158      IRI-TTLITDLQTLL--LQ-------------RQKILN---------EATK-ESDLI---
A0A2M8ADX2      IRI-TSLITDLQSLL--IQ-------------RQKMLT---------EATK-ESDLI---
A0A1J5B2H0      GII-SSLLNNLQDLL--LK-------------REQLLY---------EVTL-NSSQI---
A0A1V5N756      SSV-SGNLQAIQNLL--MQ-------------KEELLY---------NVTA-YNSQI---
A0A651GU15      NSL-SGLITDLREIL--LR-------------KEEMGF---------NVKG-NHGAV---
A0A3Q9FR88      GSI-SSSLDELAKLE--TE-------------ALRIKD---------SYTS-NTIAS---
A0A553GEX3      GSI-SSSLDELAKLE--TE-------------ALRIKE---------SYTS-NTIAS---
A0A150ADJ9      GSI-ASNLSELAKLE--VQ-------------ANRIKN---------SYTE-RTVAS---
A0A1B1FWQ4      GSI-SSSLDELAKLE--TE-------------ALRIRE---------SYTS-NTVAS---
A0A1S1Z228      GSI-SSSLSELAKLE--TE-------------ALRIKE---------SYTS-NTVAS---
A1ZKR2          LGQLQPLISKLNQLQ--EN-------------KKILAL---------KATG-SSIVV---
A0A1Q3GX01      LTQ---IMNQINKLQ--EE-------------KKLLDL---------KVNN-SSMVF---
A0A349DQI4      LTE---ILKKISKLQ--ED-------------KKLLDL---------RATS-SSMII---
A0A4P5TMD1      GL--QSYVEALDKLQ--SD-------------KREKLL---------KLKP-ANPQI---
A0A2N3IIZ0      ----LQQISELNRLR--QI-------------RQNQEL---------SETS-ATYSY---
A0A1F3SJM1      TAL-VGHIESLHTLL--EK-------------KEDLLY---------NVTE-ENEEV---
A0A2G2EB96      RAL-EGHLNQLHDFL--ER-------------KEDLLF---------EVTE-ANSEI---
A0A2G6PRA9      ASL-AGHLRELHEFL--ER-------------KEDLLF---------EVTE-NNSEI---
A0A497D5Z2      DPLLNSLIAELNTLI--VE-------------KSSLTS---------VKNM-EHPKL---
A0A662B170      DPLLNSLIAELNTLI--VE-------------KSSLTS---------VKNM-EHPKL---
A0A2A5FYT6      KNI-SRQINSLHQLL--IK-------------KEEMLY---------SETE-KSEKI---
A0A2E6SYP1      ----SSVGTSLKQLL--AK-------------RRELSF---------RVTE-ESYEV---
A0A2E5RLE8      ----STTSSRLRNLL--SE-------------KRSLSF---------RITE-ESYQV---
A0A2E7TQF6      ----STTSSRLRNLL--SE-------------KRSLSF---------RITE-ESYQV---
A0A2E6GVY9      ----STTASRLRKLL--SD-------------KRSLSF---------RITE-ESYQV---
A0A350JJ90      NSV-KGQIEELQNLV--LT-------------RNRLLG---------GATM-DNPNI---
A0A3M1CDV2      ESI-KNITSNIQKLL--LE-------------KENLLY---------QVTP-NSEQI---
A0A6C1QGZ7      GNI-SGMLRTLQDQL--LD-------------RERLLY---------EVTA-ESRQI---
A0A4P5U6G4      AL--QEFVRMLDKLQ--AD-------------KRYFLL---------SKTA-NNPEV---
A0A2E2TFD1      DNL-LQQIAYLQELQ--IE-------------KDQSLY---------EVTQ-SSGRV---
A0A2E4ELE6      IGI-KKQIQFLHELL--LE-------------REQSLY---------EVTA-DNGRV---
A0A522EYA6      SAL-NNQINSLQELL--KS-------------REELLY---------QVTP-TSEKI---
A0A2E3XZI5      DELIKIMITQLQEDV--LK-------------RDLLLK---------EVTK-NNKNF---
A0A6I7QXV0      ----THYLEAISDLE--KE-------------KNALLL---------NVKS-NHPQV---
A0A2M7NLQ9      DTNLKNRIEKVYDEE--KE-------------KKFMLD---------RLTK-QTAAY---
I4AFR0          EPSLKIRLEEVYEEE--KE-------------KKFMLD---------RVTK-QTGAY---
A0A2N2Y3E5      SVL-TSILSEIQSLI--KE-------------KEKAMN---------NLTT-QSFQI---
A0A2D9D7T6      EANVIKQVEELNALL--EK-------------KENLLT---------GLTP-QNKEI---
A0A1F3PPL5      GYI-SNILESIQQKN--DQ-------------KDMLLN---------DVTN-NNHKI---
A0A357QK06      GYI-SNILESIQQKN--DQ-------------KDMLLN---------DVTN-NNHKI---
A0A662AEA4      GVI-VNVLNNLQKLI--SK-------------KQQLLN---------DVTS-NNYQI---
A0A0S2HYK8      KVL-VSILTNLQNLI--NE-------------KNQLLN---------DVTE-NNMRI---
A0A2N5ZWN6      KVL-VNILSNLQQLI--NE-------------KNQLLN---------DVTE-NNMRI---
A0A2E0FJ09      SNL-YTLISVLHKKL--ML-------------YEDLIS---------ERTG-DHEEI---
A0A1F3FZ62      KIV-KGNLDAIQSIL--LQ-------------KEKMLY---------EITP-DNRQI---
A0A1F3K211      KIV-KGNLDAIQSIL--LQ-------------KEKMLY---------EITP-DNRQI---
A0A1V6I2U9      VFL-SSMINSLQELL--NR-------------KEVLLF---------DLTS-NSHKI---
A0A2H0B957      NNILLSLLNQIQNLI--TQ-------------RDAYLN---------NQTK-NSYQI---
A0A1F3CFW6      DGILISLLNQMQNLI--NQ-------------RDLYLN---------NQTQ-NSFQI---
A0A2M7E2T8      DGILISLLNQMQNLI--NQ-------------RDLYLN---------NQTQ-NSFQI---
A0A2M7NC69      DGILISLLNQMQNLI--NQ-------------RDLYLN---------NQTQ-NSFQI---
A0A1F3KLL5      NVV-SRLLEEINKLE--ND-------------REQMLS---------DVTA-NNYKI---
A0A359D1M1      NVV-SRLLEEINKLE--ND-------------REQMLS---------DVTA-NNYKI---
A0A0F2NS19      ASI-TALITNLQNLM--VQ-------------KQNLLS---------EVTV-NSGSV---
A0A2A5H8X6      ASI-TALITNLQSLM--VQ-------------KQNLLS---------EVTV-NSGSI---
A0A2H0GAU8      ASI-SALITNLQGLL--VQ-------------KQNLLG---------EVTV-SSEAS---
A0A2M8FTK1      ASI-SALITNLQGLL--VQ-------------KQNLLG---------EVTV-SSEAS---
A0A2A5B3B0      GGI-MSLITTLKELL--FR-------------QENLQY---------EVTK-NNEVV---
A0A5C6RXM7      SGI-TSLVTELKRLL--LL-------------KENMLY---------EVTD-NSGAI---
A0A1F3C1M2      EGLIVSILNKLQDLI--NQ-------------KEILLN---------DVTK-NNHQI---
A0A1F3DS87      EGLIVSILNKLQDLI--NQ-------------KEILLN---------DVTK-NNHQI---
A0A6A0R6K9      NSL-KQLVDNLNQEL--IH-------------KQKLLF---------SNKE-DNSLL---
A0A2E7CT70      NLVIQNMIESLEKNV--IK-------------RDELLR---------DVTE-SNENV---
A0A2D5V560      ESLTSKMIEQLQEDV--NK-------------RDQLLK---------DITP-NNKNI---
A0A2D7K5A8      ESLTSKMIDQLEKDV--IQ-------------RDELLK---------DITP-NNKNI---
A0A2E1XQ82      ESLTSKMIAQLEEDV--NQ-------------RDELLK---------DITP-NNKNI---
A0A5C8A5B4      VL--NNLVIEITKLSADLA-------------AQNLS----------TGAR-SNPTV---
A0A4Y9ITE2      AA--VDAIAEYNKLI--LE-------------RMKLVN---------NAKT-NNNAAL--
A0A5M8NYX7      MV--ISLMNAYNTEI--FE-------------KNRATL---------GLKP-TNSIV---
A0A3D5KRY6      AL--IETVKKLNGLY--SN-------------REVLSY---------TVQE-KNPVL---
A0A1V5IPN7      YI--GELRRQITNTQATIA-------------RLRTNE---------NYSE-NHPQM---
A0A0E3V905      VL--LSLINNLTQLE--QQ-------------RDHLLH---------TTSE-LNPLL---
A0A553ETH6      FI--GENIRLLNELF--LE-------------REQLRL---------SYSE-TTFAL---
A0A640Q161      TI--RDVRRDEAKAM--TR-------------VSELSN---------VYGP-KHPRM---
A0A640QU49      TI--RDVRRDEAKAM--TR-------------VSELSK---------VYGP-KHPRM---
A0A1Q3PII2      NF--ADLVTKYNDML--LS-------------RVKALS---------QLSP-GHPDF---
A0A351BXT2      YL--TEIQSKIAELE--SQ-------------RD--VE---------ASIP-NDEKLREK
A0A2K8Z965      VL--LGLITNLTTLE--QQ-------------RDQMAR---------TTSE-QHPML---
A0A418M8U8      VL--FSLIEKLTQLD--LQ-------------RSQLAR---------TTSD-QNPLL---
I2GTA4          VL--FSLIEKLTQLD--LQ-------------RSQLVR---------TTSE-QNPLI---
A0A2K8ZAJ2      IL--TSLLTKAAELE--LK-------------REDLLK---------TTSS-GSPLI---
A0A368JPA3      TL--TALIGKLTELE--TQ-------------RTVLLR---------NSPE-PSAVL---
A0A5N1JI29      TL--TALIGKLTELE--TQ-------------RTVLLR---------NSPE-PSPVL---
A0A3P1BT12      AL--TSLISKLNDLE--QQ-------------RSLLVR---------NSSD-SNPVL---
A0A3P1CI15      TL--TSLLGKLTDLE--VQ-------------RNLLAR---------NSSE-SSPLL---
A0A4R8CUK1      AV--TAFVTKIQDLE--RQ-------------RDRLVR---------TTSE-ANPIV---
A0A3D0MYJ7      KF--TTISNEIASLE--VK-------------RDIELS---------T--V-ENPQVYAK
A0A662AH13      RM--LALQEAIGNYE--LQ-------------RDIALS---------DTTV-SDASK-PI
A0A5C7QA01      -----------IELK--QQ-------------QADLVV---------KYTD-DHPAM---
A0A3D3LS70      YV--EEIQKTIANVE--AE-------------RDMELT---------I--P-KDPKLIEK
A0A1G1TM36      AL--NNLVGRLTSLQ--LQ-------------RETLLT---------TTPA-GNPLF---
A0A1G7ZF38      NF--AAMVSKYNETQ--LA-------------LTRALA---------SLAP-GHPEV---
C6VS52          NF--SALASTFNEMQ--LN-------------RVKALT---------TLAP-NHPAV---
A0A2A4G4B1      GV--KETIDNFNQLI--LE-------------KNQLLE---------SASE-NHPTI---
A0A0P7X1V8      SI--APRINQLQVFL--AD-------------RETQRTLLLSRNPQLRNTP-DDPSL---
A0A5C8KAD6      IL--SDLLQKLQNLE--IQ-------------YQKLKN---------TTAE-NNPIL---
A0A5N1J695      VL--EQLLQKLYNAE--TQ-------------YNNLKN---------TTAE-NNPIL---
A0A1H4ADG3      SL--SAIIDNYNKLL--LQ-------------KERVLL---------SATP-DHPVV---
A0A5B8VUR8      NL--NTIIDSYNKLL--LQ-------------KERALL---------SATA-DHPVV---
A0A3N2M1H3      SI--EKDIATYNTIL--LA-------------RNNLVS---------NSSE-RNPLV---
A0A4S2G8T2      SI--EKDIATYNTIL--LA-------------RNNLVS---------NSSE-RNPLV---
A0A1T5K9D4      NL--DQAISQYNDLV--IK-------------RDRLEK---------ASSS-VSPAV---
A0A077ENE7      GV--EGQIAEYNKAL--LK-------------RNRLAE---------GGNS-SNPVV---
A0A6I5UW06      GV--EGQIAEYNKAL--LK-------------RNRLAE---------GGNS-SNPVV---
T0NN57          SV--EGQIAEYNMAL--LK-------------RNRLAE---------GGNT-SNPVV---
X5K347          SV--EGQIAEYNMAL--LK-------------RNRLAE---------GGNT-SNPVV---
A0A212K7W5      NI--DRQINEYNTLL--LK-------------RNTLLA---------NSSD-NNPLV---
F5IU11          NI--EGQINEYNTLL--LK-------------RNTLQA---------NSSD-NNPLV---
A0A6I1IYY4      SV--QNQITAYNELM--LQ-------------RNHLLA---------ESGE-KNPVV---
K0XJ09          GL--QNQITTYNEIL--LQ-------------RERLAA---------NSGE-NNPLV---
R5EUZ0          GL--QNQITTYNEIL--LQ-------------RERLAA---------NSGE-NNPLV---
W0EQS0          GL--QSQIEAYNAMI--LQ-------------RERLVA---------NSGE-SNPLV---
A0A1Y3WE15      GL--QKQIESYNEML--LQ-------------RERLAA---------NSGE-NNPLV---
A0A1Y4GUK3      GL--QSQIEAYNEML--LQ-------------RERLAA---------NSGE-NNPLV---
A0A352Z1R7      LV--AGLATKLSELE--IQ-------------KRTLLT---------DYTE-NHPAV---
A0A3N2N6F7      GI--VAQITEYNNLQ--LE-------------RDQLLS---------TTGE-NSPLV---
A0A4P7VVU7      GI--EAQINEFNQLQ--LE-------------RDKLSN---------STGD-TNPLL---
A0A2V1ILM4      GI--EAQINEFNQLQ--LE-------------RDKLSN---------STGD-TNPLL---
A0A3N2L0E8      GI--EAQINEFNQLQ--LE-------------RDKLSN---------STGD-TNPLL---
A0A3N2LFC5      GI--EAQINEFNQLQ--LE-------------RDKLSN---------STGD-TNPLL---
A0A0A2F501      LI--DQQIGEYNQKM--LE-------------RNSLRA---------NSSD-ENPIV---
R5B7P0          TI--ENGISEYNSKI--LQ-------------RNNLVA---------NSGE-ENVLV---
R5B0L5          AI--ESQIAQYNDAM--LE-------------RNQLAA---------NSSH-THPMV---
A0A6I1TEC0      GI--EQQIAEYNKTL--LE-------------RNNIVA---------NSSE-QNPLV---
A0A3R5XWG1      GI--EQQIAEYNKTL--LE-------------RNNIVA---------NSSE-QNPLV---
A0A646GTR1      GI--EQQIAEYNKTL--LE-------------RNNIVA---------NSSE-QNPLV---
A0A5P0Y910      GI--EQQIAEYNKTL--LE-------------RNNIVA---------NSSE-QNPLV---
A0A414YFM3      GI--EQQIAEYNKTL--LE-------------RNNIVA---------NSSE-QNPLV---
A0A6A7UIA7      GI--EQQIAEYNKTL--LE-------------RNNIVA---------NSSE-QNPLV---
A0A6A7VPS3      GI--EQQIAEYNKTL--LE-------------RNNIVA---------NSSE-QNPLV---
A0A374THP7      GI--EQQIAEYNKSQ--LE-------------RNNLVA---------NSSE-QNPLV---
A0A6G1VND1      GI--EQQIAEYNKSQ--LE-------------RNNLVA---------NSSE-QNPLV---
A0A0A2EVS5      VI--EREISEYNETL--LQ-------------LNRLLS---------NSSE-KNPLV---
A0A1T4NAJ7      VI--EREISEYNETL--LQ-------------LNRLLS---------NSSE-KNPLV---
A0A255T941      NI--ETQINNYNNMV--LD-------------RNRLIS---------NSSE-ANPLV---
A0A3N2KCL3      DI--QSQITDYNNLV--LQ-------------RNSLLA---------KSSD-KNPLV---
A0A4P7VSV0      DI--QSQITDYNNLV--LQ-------------RNSLLA---------KSSD-KNPLV---
A0A2V1IJY1      DI--QSQITDYNNLV--LQ-------------RNSLLA---------KSSD-KNPLV---
A0A4P7VXK7      DI--QSQITDYNNLV--LQ-------------RNSLLA---------KSSD-KNPLV---
A0A1Y4CHN5      NI--ENQISEYNTAQ--LQ-------------RNNLVA---------NSSD-ENPLV---
A0A1M6I2S6      NI--ESQIGEYNTMV--LD-------------RNRLIA---------NSSE-KNPLA---
A0A1Y3V692      NI--ESQIGEYNTMV--LD-------------RNRLIA---------NSSE-KNPLA---
F3PXM2          HI--ESLIGEYNAQV--LE-------------RNRLAA---------NSSE-KNPLV---
A0A3E4ZNL4      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A174AHH7      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A174JCE8      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A3E4JMC4      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A412SND6      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A414IEQ9      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A415UKN5      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A6I0U0V8      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A6I2PDH7      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A0M1W8D8      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A3R6GKX5      NI--ESQIGEYNKIV--LD-------------RNRLIA---------NSSE-KNPLV---
A7V4S1          NI--ESQIGEYNKIV--LD-------------RNRLIA---------NSSE-KNPLV---
B0NU19          NI--ESQIGEYNKIV--LD-------------RNRLIA---------NSSE-KNPLV---
D4V601          NI--ESQIGEYNKIV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A4Q0U3M9      NI--ESQIGEYNKIV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A4R4H1Q2      NI--ESQIGEYNKIV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A6I0GII7      NI--ESQIGEYNKIV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A6I0KYU7      NI--ESQIGEYNKIV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A397WLT5      NI--ESQIGEYNKIV--LD-------------RNRLIA---------NSSE-KNPLV---
A6KY94          NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A173UQR8      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A3R6HK75      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A412B7D1      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A412VNY9      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A414LTU9      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
I9Q4U4          NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A6A2J529      NI--ESQIGEYNKIV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A3R6GM96      NI--ESQIGEYNKIV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A015XH67      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A078RZN2      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A4R4I3T9      NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A6L0K5          NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A7ACT5          NI--ESQIGEYNKMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A373ISF0      NI--ESQISEYNNMV--LN-------------RNRLID---------NSSE-KNPLV---
U6RF62          NI--ENQISEYNNMV--LN-------------RNRLIA---------NSSE-KNPLV---
A0A662ZZD5      NI--ESQIGEYNTIV--LE-------------RNRLIA---------NSSE-KNPLA---
A0A3A5TI83      NI--ESQIGEYNTIV--LE-------------RNRLIA---------NSSE-KNPLA---
A0A415NEB6      NI--ESQIGEYNTIV--LE-------------RNRLIA---------NSSE-KNPLA---
A0A6I0I238      NI--ESQIGEYNTIV--LE-------------RNRLIA---------NSSE-KNPLA---
A7AJ60          NI--ESQIGEYNTIV--LE-------------RNRLIA---------NSSE-KNPLA---
A0A6A2JF01      NI--ESQIGEYNTIV--LE-------------RNRLIA---------NSSE-KNPLA---
A0A6I0Y2Y2      NI--ESQIGEYNTIV--LE-------------RNRLIA---------NSSE-KNPLA---
A0A6I2Q447      NI--ESQIGEYNTIV--LE-------------RNRLIA---------NSSE-KNPLA---
A0A395YYT3      NI--ESQIGEYNTIV--LE-------------RNRLIA---------NSSE-KNPLA---
A0A015UXN7      NI--ESQIGEYNTIV--LE-------------RNRLIA---------NSSE-KNPLA---
A0A5M5W148      NI--ESQIGEYNTIV--LE-------------RNRLIA---------NSSE-KNPLA---
A0A6I2NTL0      NI--ESQIGEYNTIV--LE-------------RNRLIA---------NSSE-KNPLA---
A0A016E4F9      NI--ESQIGEYNTMV--LD-------------RNRLIA---------NSSE-KNPLA---
A0A4Q5CFJ7      NI--ESQIGEYNTMV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A6H9P0U9      NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A108TH71      NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
I8VXH0          NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A412S0N6      NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A412IIJ0      NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A0P0FM97      NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
R6KTP3          NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A139LU87      NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A1C6B3Y5      NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
E2NMQ4          NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A412YDB9      NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
R7DY01          NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A414LGK8      NI--ETQISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A415IPQ4      NI--ETLISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A3E5BRW7      NI--ETLIGEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
K9DXS6          NI--ETLIGEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A1M6KFV3      NI--ETLISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A1Q6G7L3      NI--ETLISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A413H235      NI--ETLISEYNNLV--LD-------------RNRLIA---------NSSE-KNPLV---
A0A1M5B2J8      NI--ASQINEYNNQL--LE-------------RNNLVS---------KSSV-KNPLV---
A0A255RCT5      NI--GSQITEYNNQL--LE-------------RNNLVS---------KSSD-KNPLV---
A0A1Y4GLF5      NI--ESQISEYNRQL--LQ-------------RNNLVA---------NSST-DNPLV---
A0A1H3XSC0      NI--ESQIAEYNRQL--LQ-------------RNSLVA---------NSST-QNPLV---
A6LE40          NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A4Y1VPX5      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
B3JI46          NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
R6NN15          NI--ENQISEYNNLQ--LQ-------------RNNLVA---------NSSE-QNPLV---
A0A358R8U0      NI--ESQISEYNTKL--LQ-------------RNSLVA---------NSST-QNPLV---
R6WSB6          NI--ESQISEYNTKL--LQ-------------RNSLVA---------NSST-QNPLV---
A0A401LPX7      SL--STQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
A0A6I0J0P8      SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
A0A6I1BFM0      SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
A0A6G0GNY9      SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
A0A3A5Z900      NL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSA-KNPLV---
A0A285TGL6      SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSA-KNPLV---
A0A3A5RFX4      SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSA-KNPLV---
A0A1Q6IUW9      SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
A0A3R6NPG7      SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
A0A413XDP6      SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
K6AP24          SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
A0A6I2NHV3      SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
A0A662ZYI7      SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
A0A078RYI7      SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
C7XEQ8          SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
D7INX6          SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
K5ZG55          SL--ATQLNEYNTKL--LE-------------RNSLVS---------HSSV-KNPLV---
A0A3N2N9B8      DI--ASQVGEYNDLL--LQ-------------RNSLVE---------KSSE-SNPLV---
A0A3N2NMI0      DI--AKQVSEYNEML--LQ-------------RNALVE---------KSSD-TNPLV---
A0A359I8H7      TL--EAQISNYNNLL--LT-------------RNTLAA---------SSSD-TNPLV---
A0A3N2KA63      TL--EAQISNYNNLL--LT-------------RNTLAA---------SSSD-TNPLV---
A0A4Q0IMT7      TL--EAQISNYNNLL--LT-------------RNTLAA---------SSSD-TNPLV---
A0A3B9FAU3      GI--EQQIAEYNTLL--LQ-------------RNSLIA---------NSSE-RNPIV---
A0A3C1E5L7      GI--EQQIAEYNTLL--LQ-------------RNSLIA---------NSSE-RNPIV---
A0A4Q0UAV1      TV--ESQIAEYNTIV--RE-------------RNRMLA---------TSSD-NNPLV---
A0A354SN68      GI--EGLINDYNAQI--LQ-------------RNNIVS---------NSSE-SNPLI---
A0A3N2N595      DV--KSQLTNYNDLI--LQ-------------RNSLVD---------KSSD-KNPLV---
A0A0A2DUD9      SL--EQQIGEFNDLL--LK-------------RNNLVK---------NSSE-SNPLV---
A0A3P1ZBJ5      SV--EALIGDYNGNI--LQ-------------RNRLIM---------NSSE-KSPTV---
R5FHS9          NI--EQQIESYNKDL--IE-------------RNQLLA---------NSSE-ANPLV---
A0A413TW79      GI--EQQITEYNKQQ--LE-------------RNNLVA---------NSSE-QNPLV---
A0A3E5E9M7      GI--EQQITEYNKQQ--LE-------------RNNLVA---------NSSE-QNPLV---
A0A3E4SK73      GI--EQQITEYNKQQ--LE-------------RNNLVA---------NSSE-QNPLV---
A0A415GGC6      GI--EQQITEYNKQQ--LE-------------RNNLVA---------NSSE-QNPLV---
A0A413DBH9      GI--EQQITEYNKQQ--LE-------------RNNLVA---------NSSE-QNPLV---
A0A1Y4PQK7      GI--EKQISEYNTLQ--LQ-------------RNNLVA---------NSSE-QNPLV---
A0A1Y4IH41      GI--EKQISEYNTLQ--LQ-------------RNNLVA---------NSSE-QNPLV---
A0A3A6AAP4      GI--EKQISEYNTLQ--LQ-------------RNNLVA---------NSSE-QNPLV---
A0A6I0ZRD2      GI--EKQISEYNTLQ--LQ-------------RNNLVA---------NSSE-QNPLV---
A0A1Y4DYA7      GI--ENQILDYNTLQ--LQ-------------RNNLVA---------NSSV-NNPLV---
A0A1Y3X4I9      GI--EKQIADYNALQ--LQ-------------RNNLVA---------NSSE-SNPLV---
A0A1Y4FNK8      GI--EQQIANYNTAQ--LR-------------RNDLVA---------NSSE-KNPLV---
A0A355FD59      GI--ESQISEYNTLQ--LQ-------------RNNLLA---------NSSE-QNPLI---
A0A359CEZ9      GI--ESQISEYNTLQ--LQ-------------RNNLLA---------NSSE-QNPLI---
A0A353Q7B4      GI--ESQISEYNTLQ--LQ-------------RNNLLA---------NSSE-QNPLI---
F8X3A5          SV--ENQITEYNTIQ--LQ-------------RNNLVS---------NSSE-QNPLV---
A0A1M3KVR9      SV--ENQITEYNTIQ--LQ-------------RNNLVS---------NSSE-QNPLV---
A0A4Y9IJS3      SV--ENQITEYNTIQ--LQ-------------RNNLVS---------NSSE-QNPLV---
A0A495WI87      NL--GDQITEYNNKL--LQ-------------RNSLVA---------NSSD-QNPLV---
A0A354M4S6      NL--GDQITEYNNKL--LQ-------------RNSLVA---------NSSD-QNPLV---
R7DH52          NL--GDQITEYNNKL--LQ-------------RNSLVA---------NSSD-QNPLV---
A0A4Q5E7L5      NI--ESQITEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A4P8LP09      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A4R4GZU7      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A016CWA4      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A1C6H117      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A0M1W0V2      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A139KA16      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A174VQ92      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A1Q6HCG0      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A1Y4JYM9      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3A5QW67      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3A5RQE6      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3A6BP07      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3E5E153      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3Q9IP20      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A412WV15      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A413ICP6      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A414KYB9      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A5B3FWR2      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A6I0WNS4      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
E5WX00          NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
K0X3P3          NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A415TAH7      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A078T2W6      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A6I1AQV4      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A5C6L2P1      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A412MJT7      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3E4WKT5      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3A5YY33      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A078TAH2      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A1E9CFZ7      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A373FYU5      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3A5TZ72      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3A5XBP2      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3A6MEG9      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3E4JP35      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3E4KP40      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3E4NX82      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A3E4XFU8      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A412RG70      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A412TD37      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A413GAA4      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A414M7I4      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A496BTA0      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A496D2V6      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A4Q5G1P5      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A5C6KCA6      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A5M5AHM5      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A6I0KZV6      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A6I0Y5K7      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A6I1BFB8      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A6I2P5W5      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
E5UZA2          NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A069SMG6      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
C3RFN5          NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A3A5Z014      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A6I0ING7      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A6I2P894      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A078S3Q8      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A069SJV7      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A3E5DXI5      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A3E5EM98      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A3E5F453      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
I9T3G6          NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A3E4SYU0      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A6LGY1          NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
K5ZSH4          NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A6A2RTB3      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A6I0VY00      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSST-ENPLV---
A0A1M4YZ07      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A4Q5E5M7      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A0P0FQW1      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A5M5C0W6      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A6I0H151      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A6I0HI59      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A642LZ22      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A6I0IP89      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A642NJ89      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A6I0HI52      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A6I0YVB5      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A6G0G4T5      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A6I0HFG9      NI--ESQIAEYNKQL--LQ-------------RNSLVA---------NSSA-ENPLV---
A0A416GA42      NL--VNQIAEYNKMR--LQ-------------CDKMES---------TTAV-ENPVV---
A0A1T3IYP5      SV--ENQIAEYNTTL--LK-------------RNRLAE---------GGNN-LNPVV---
A0A3P1Z8V4      AL--AQQITEYNRLV--LT-------------RNRYAV---------NSND-DTPAV---
A0A060RD97      GV--DSQIDSYNELR--LK-------------LDKMLE---------SSGE-NNPLV---
A0A3C1ITV0      AI--EEQIAEYNKRL--LE-------------RQRLVA---------NSSD-SNPLV---
R7HN19          AI--EEQIAEYNKKL--LE-------------RQRLVA---------NSSD-SNPLV---
A0A350IHV0      TV--DSQITEYNQMV--LT-------------RDRYMS---------DSSS-DNPLV---
R5RVP0          TV--EAQIKEYNSLV--LN-------------RDRFAN---------ESSD-NNPLV---
R6A0L2          SF--NTQIAAYNDQM--NK-------------RNTMVA---------NSSE-NQAVV---
R7LG80          SF--NTTIDKYNQLQ--MQ-------------RNQMAN---------NSSD-DHAVV---
A0A2L2WX98      SF--TPLIGEYNNQM--LE-------------RNRIAG---------NTSE-TSPTI---
A0A285T4L1      SV--EGQINQYNALK--LK-------------RDKLIA---------DSSE-SNPVV---
G5GD56          TF--NGQIDTYNQLM--NE-------------RNKNAA---------NSSG-QSPLV---
R5KD55          KT--DGLIDKYNALQ--LE-------------RNSLMA---------NGGK-NNPLV---
A0A174QNT3      GV--QTQIEDYNEMM--LQ-------------RNRLVS---------NSGE-SNPVV---
A0A4S2FGS1      GV--QSQIESYNEMM--LQ-------------RNRLVT---------NSGE-NNPVV---
R9I0H0          GV--QSQIESYNEMM--LQ-------------RNRLVT---------NSGE-NNPVV---
K5BUT9          SM--QSQITAYNELM--LQ-------------RNRLKE---------SSGE-KNPVV---
A0A174FPA3      SM--QSQITAYNELM--LQ-------------RNRLKE---------SSGE-KNPVV---
R6S9Y6          SM--QSQITAYNELM--LQ-------------RNRLKE---------SSGE-KNPVV---
A0A642LIH6      SM--QSQITAYNELM--LQ-------------RNRLKE---------SSGE-KNPVV---
C9KX15          SM--QSQITAYNELM--LQ-------------RNRLKE---------SSGE-KNPVV---
A0A6H0KRK1      SV--QSQITAYNELM--LQ-------------RNHLLA---------ESGA-KNPVV---
R6DAG6          SV--QSQITAYNELM--LQ-------------RNHLLA---------ESGA-KNPVV---
A0A3L8AAP1      SV--QSQITAYNELM--LQ-------------RNHLLA---------ESGA-KNPVV---
A0A4S2AYX2      SV--QSQITAYNELM--LQ-------------RNHLLA---------ESGA-KNPVV---
A0A4Y9H477      SV--QSQITAYNELM--LQ-------------RNHLLA---------ESGA-KNPVV---
A0A0E2M2Y7      GI--DNSITLYNDLK--LK-------------YDRLKQ---------SSSE-SNPLV---
A0A0K2J6Z0      GI--DNSITLYNDLK--LK-------------YDRLKQ---------SSSE-SNPLV---
B2RKZ8          GI--DNSITLYNDLK--LK-------------YDRLKQ---------SSSE-SNPLV---
A0A212GC82      GI--DNSITLYNDLK--LK-------------YDRLKQ---------SSSE-SNPLV---
A0A254MU12      GI--DNSITLYNDLK--LK-------------YDRLKQ---------SSSE-SNPLV---
R6CQ93          SV--EGQINQYNSLK--LK-------------RDKLIA---------DSSE-NNPVV---
A0A3D1NQW3      AI--NSQIEGYNTEL--QR-------------YMKLNS---------ESSE-NNPII---
B0MT10          AI--NSQIEGYNTEL--QR-------------YMKLNS---------ESSE-NNPII---
R7JGW9          AI--NSQIEGYNTEL--QR-------------YMKLNS---------ESSE-NNPII---
A0A3D2BF46      SI--SDQIKNYNELM--LR-------------RDKLAG---------NASS-NSPVI---
A0A358R538      TV--AAQIDRYNEAI--LT-------------RSRLLA---------NGSE-QNPVI---
A0A1Y4AAB8      GI--TEQISAYNEGI--LR-------------REKLSE---------NSSA-NNPVM---
A0A1Y3WWY9      AV--SAQIDEYNTSI--LQ-------------REKLLE---------NSSE-NSPVI---
A0A1Y4U5L4      AV--SAQIDEYNTAI--LQ-------------REKLLE---------NSSE-NSPVI---
A0A1Y3VCJ1      AV--TAQIDEYNATI--LQ-------------REKLLD---------NSSP-NNPVI---
A0A1Y3QTW7      GI--VAQITEYNDAI--LR-------------RQKLLE---------NSSE-RSPVI---
R6XWY7          GI--VAQITEYNDAI--LR-------------RQKLLE---------NSSE-RSPVI---
A0A4Y1X9Y9      GI--VAQITEYNDAI--LR-------------RQKLLE---------NSSE-RNPVI---
A0A4Y1WM66      GI--VAQITEYNDAI--LR-------------RQKLLE---------NSSE-RSPVI---
A0A174AVF1      GI--VAQITEYNDAI--LR-------------RQKLLE---------NSSE-RSPVI---
A0A656Q4F4      GI--VAQITEYNDAI--LR-------------RQKLLE---------NSSE-RSPVI---
A0A1Q6EIY0      GI--VAQISEYNEAI--LR-------------REKLLE---------NSSE-RSPVI---
A0A5B5VN71      GI--VAQISEYNEAI--LR-------------REKLLE---------NSSE-RSPVI---
E4M8L3          GI--VAQISEYNEAI--LR-------------REKLLE---------NSSE-RSPVI---
I3YQ50          GI--VAQISEYNEAI--LR-------------REKLLE---------NSSE-RSPVI---
R5UEY8          GI--VAQISEYNEAI--LR-------------REKLLE---------NSSE-RSPVI---
A0A1H4D866      GI--SSQIADYNNAI--LR-------------REKLME---------NSSD-RSPVI---
A0A5B3G4Y7      AI--AKQIEDYNSAI--LR-------------REKLLE---------NSSE-RSPVI---
A0A374A9J5      AI--AKQIEDYNSAI--LR-------------REKLLE---------NSSE-RSPVI---
A0A5B3GQN5      AI--AKQIEDYNSAI--LR-------------REKLLE---------NSSE-RSPVI---
A0A1Q6E9S3      AI--AKQIEDYNSAI--LR-------------REKLLE---------NSSE-RSPVI---
D4IJ36          AI--AKQIEDYNSAI--LR-------------REKLLE---------NSSE-RSPVI---
A0A414Q925      GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
A0A415PUS9      GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
A0A108TCU0      GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
A0A413BA42      GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
S3Y344          GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
A0A4Q5G8Y8      GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
A0A412TGL3      GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
A0A413VJ33      GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
A0A414L0W6      GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
A0A412DP39      GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
A0A413ZSE8      GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
B0NP84          GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
R6AK43          GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSA-NNPLV---
A0A412N2D9      GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSE-GNPLV---
A0A1Y4JYS9      GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSE-GNPLV---
R6LHA4          GV--QNLIMEYNTVL--TR-------------RNKLIA---------NSSE-GNPLV---
A0A3E5HPT8      SI--ESQISRYNETL--LR-------------RNRLVS---------GSSS-NNPVV---
C6IJ48          SI--ESQISRYNETL--LR-------------RNRLVS---------GSSS-NNPVV---
Q8A3U2          SI--ESQISRYNETL--LR-------------RNRLVS---------GSSS-NNPVV---
A0A3R6S1H6      NI--EQSIGKYNEML--LK-------------RNKLQE---------NSSE-KNPII---
A0A3R6SD81      NI--EQSIGKYNEML--LK-------------RNKLQE---------NSSE-KNPII---
A0A354WXN6      NV--ESDISEYNTML--LK-------------RDKLIS---------NSSS-KNPVI---
R5IP14          EI--SGAISEYNQLL--LK-------------RDRLMS---------NSSD-RNPMV---
A0A316SZX7      GI--NEQIKEYNTLL--LN-------------RDRLIA---------NSGN-NSPVV---
A0A1Y4AIY1      TV--EQQIAAYNEML--LK-------------RDNLIR---------NSSN-KNPVV---
A0A0J6CIR2      NI--EGQISEYNNLL--LK-------------RDKLIG---------NSSN-KNPVV---
A0A3D8HG59      NV--ESQIGEYNALL--LK-------------RDRLVS---------SSSN-RNPVV---
A0A3R6S408      NV--ESQIGEYNALL--LK-------------RDRLVS---------SSSN-RNPVV---
F3ZRU7          TT--EGQIKEYNTML--LQ-------------RDRLLS---------NSSD-KNPVV---
A0A1C5Q1F3      TI--ERQIMEYNELM--LQ-------------RDKLIG---------NSSN-KNPVV---
R7A239          TI--ERQIMEYNELM--LQ-------------RDKLIG---------NSSN-KNPVV---
A0A3R6HIK7      KV--EQQISTYNEML--LK-------------RDNFIA---------NSSD-KNPVV---
K5ZVW7          KV--EQQISTYNEML--LK-------------RDNFIA---------NSSD-KNPVV---
A0A1Y4D5Z0      NI--EQQIAEYNTQL--LK-------------RDRLIS---------NSSN-KNPVV---
A0A413VXJ7      SV--ESQISEYNEML--LK-------------RDKLVS---------GSSS-KNPIV---
I9RSN9          SV--ESQISEYNEML--LK-------------RDKLVS---------GSSS-KNPIV---
U6RJK5          SV--ESQISEYNEML--LK-------------RDKLVS---------GSSS-KNPIV---
A0A1Q6GA32      SV--ESQISEYNEML--LK-------------RDKLVS---------GSSS-KNPIV---
I9RPU6          SV--EAQIKEYNDIL--LK-------------RDKLVV---------GSSS-KNPIV---
I8YFS5          SV--EAQIKEYNDML--LK-------------RDKLVS---------GSSN-KNPIV---
A0A6H9LTF8      SV--ESQIKEYNDML--LK-------------RDKLVA---------GSSN-KNPIV---
I8Y597          SV--ESQIKEYNDML--LK-------------RDKLVA---------GSSN-KNPIV---
A0A1Q6GBF5      SV--ESQIKEYNDIL--LK-------------RDKLVA---------GSSS-KNPIV---
I8YFZ3          SV--ESQIKEYNDIL--LK-------------RDKLVV---------GSSS-KNPIV---
A0A6H9M1J1      SV--ESQIKEYNDVL--LK-------------RDKLVV---------GSSS-KNPIV---
A0A1Q6GDH2      SV--ESQIKEYNDIL--LK-------------RDKLVV---------GSSS-KNPIV---
U6RSB0          SV--ESQIKEYNDIL--LK-------------RDKLVV---------GSSS-KNPIV---
I9GXM2          SV--EFQIKEYNDIL--LK-------------RDKLVV---------GSSS-KNPIV---
I9SIK1          SV--ESQIKEYNDVL--LK-------------RDKLVV---------GSSS-KNPIV---
A0A6H9LZ74      SV--ESQIKEYNDVL--LK-------------RDKLVV---------GSSS-KNPIV---
I9TP59          SV--ESQIKEYNDIL--LK-------------RDKLVV---------GSSS-KNPIV---
R5S343          NM--EGRIGEYNELL--LK-------------RDRLIE---------NSSD-NNPVV---
A0A1M6K7I9      GV--EKQIAEYNEIL--LK-------------RDKFVT---------GSSD-RNPVV---
A0A5M6A8C8      GV--EKQIAEYNEIL--LK-------------RDKFVT---------GSSD-RNPVV---
A0A6H9LT84      SV--ESQIKEYNDML--LK-------------RDKLIT---------GSSN-KNPIV---
A0A6H9LUV5      SV--EAQIKEYNDML--LK-------------RDKLVA---------GSSN-KNPIV---
A0A3R5ZMK1      NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A0A3E4ZTK7      NI--ESQIGEYNEML--LK-------------RDKLIS---------NSSN-KNPVV---
A0A1Y3ZIA4      NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
K5Y1A4          NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A0A4Q5CIT0      NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A0A3R6K8X4      NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A0A414GI87      NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A0A415BDM7      NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A0A412DM15      NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A7AEU7          NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A0A1Q6I3T6      NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A0A414XX40      NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A0A3R6BKI7      NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A0A414LPI6      NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A0A412M2W1      NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
K5ZX55          NI--ESQIGEFNEML--LK-------------RDKLIS---------NSSS-KNPVV---
A0A5F0U645      SL--ESQISEYNTLL--LK-------------RDKLIG---------NSSN-RNPVV---
K5ZBN2          SL--ESQISEYNTLL--LK-------------RDKLIG---------NSSN-RNPVV---
A0A0J6CKW3      SL--ESQISEYNTLL--LK-------------RDKLIG---------NSSN-RNPVV---
A0A0F5IQM7      SL--ESQISEYNTLL--LK-------------RDKLIG---------NSSN-RNPVV---
A0A496CDT3      SL--ESQISEYNTLL--LK-------------RDKLIG---------NSSN-RNPVV---
A0A6G1ZKM3      SL--ESQISEYNTLL--LK-------------RDKLIG---------NSSN-RNPVV---
S0GLB0          SL--ESQISEYNTLL--LK-------------RDKLIG---------NSSN-RNPVV---
A0A3R6NLC1      NV--ESQISEYNALL--LK-------------RDKLIG---------NSSN-KNPVV---
A0A416WYC9      NV--ESQISEYNALL--LK-------------RDKLIG---------NSSN-KNPVV---
A0A0F5IT40      NI--EGQISEYNNLL--LK-------------RDKLIG---------NSSN-KNPVV---
A0A496CX20      NI--EGQISEYNNLL--LK-------------RDKLIG---------NSSN-KNPVV---
A0A5F0UBI0      NI--EGQISEYNNLL--LK-------------RDKLIG---------NSSN-KNPVV---
A0A6G1ZHG0      NI--EGQISEYNNLL--LK-------------RDKLIG---------NSSN-KNPVV---
S0GSI7          NI--EGQISEYNNLL--LK-------------RDKLIG---------NSSN-KNPVV---
K5YB65          NI--EGQISEYNNLL--LK-------------RDKLIG---------NSSN-KNPVV---
A0A0F5IWP9      NI--EGQISEYNNLL--LK-------------RDKLIS---------NSSN-KNPVV---
A0A0F5IZT8      NI--EGQISEYNNLL--LK-------------RDKLIS---------NSSN-KNPVV---
A0A417LKQ2      NI--EGQISEYNNLL--LK-------------RDKLIS---------NSSN-KNPVV---
A0A416TME1      NI--EGQISEYNNLL--LK-------------RDKLIS---------NSSN-KNPVV---
A0A416XPE8      NI--EGQISEYNNLL--LK-------------RDKLIS---------NSSN-KNPVV---
A0A3B0C2S4      GI--NSLVAEYNEMA--IE-------------REKLIS---------TVGD-NHPTL---
L8JI02          LL--SSLLIELSKLN--QE-------------RAGLNY---------NAKE-QNPVT---
A0A4Q5WS95      LL--SGLLEKLYQAD--LE-------------RDRLSR---------TTAE-NHPVM---
A0A501VZX6      VL--SQLLQKLYNAE--IE-------------YQKLRN---------TTAE-NNPML---
A0A399SH26      VL--TQLLQKLYDNE--IQ-------------YQRLRK---------TTAV-NNPIL---
A0A501W1A9      VL--SQLLQKLYDAE--IQ-------------YQQLRK---------TTAE-NNPLL---
A0A0E3ZGV6      VL--SQLLQKLYNSE--IQ-------------YQQLSK---------TTAE-NNPLL---
A0A1I2N4S1      VL--SQLLQKLYEAE--IQ-------------YQQLKK---------TTAE-NNPLL---
A0A2T5YE44      VL--SQLLQKLYNAE--IQ-------------YQQLKK---------TTAE-NNPLL---
A0A1V9FHD0      VL--TDLMQKMYTAK--VE-------------YGKLMK---------TTGE-NNPAA---
A0A4V4H170      VL--SELMQKMYNAK--VE-------------YEKLMK---------STGE-NNPFA---
A0A1V9F098      VL--TELMQKLYNGK--LE-------------YEKLMK---------STGE-NNPFA---
A0A4R2VU64      LL--TDMMGKLNNAK--VE-------------YEKMMK---------STGE-NNPFA---
A0A4S8HY23      VL--GELMQRMYNAK--VE-------------YEKMMK---------STAE-NNPFA---
A0A1V9F383      VL--SDLMQKLYNKK--VE-------------YETLLK---------TTAE-NNPYA---
G8TRZ6          IL--SDLMSKLYSKR--VE-------------YESLLK---------TTTV-NNPAA---
A0A543WA52      VL--SQLLEKLYNSE--IE-------------YTKLKK---------TTAE-NNPIL---
A0A1M5BA90      LL--SSLLQKLYDSQ--MQ-------------YERLKK---------TIPG-GNPAM---
A0A512B879      LL--AQLLQRYYDAQ--MQ-------------YERLRK---------TIPG-GNPIM---
A0A559PPI3      VL--TQLLQKLYNSE--IE-------------YERLKK---------TTAV-NNPML---
A0A1T5CS78      IL--SQLIEKLYNLE--VD-------------YERLKK---------TTGE-NNPIL---
A0A0Q9Z8F1      IL--SQLIEKLYNLE--VE-------------YERLKR---------TTAE-NNPVL---
A0A2N0U0M7      IL--SQLIEKLYNLE--VE-------------YERLKK---------TTAE-NNPVL---
A0A2N3U785      TL--QDLISRFNELQ--LE-------------RQGLLR---------TMQP-NNPLV---
A0A0D3L8Q3      TL--NRLIERYNELQ--LE-------------RQRLLL---------TNKP-NNPLV---
A0A0E3ZG78      TL--MGLIARFNELQ--LD-------------RERMLR---------TAQP-KSPII---
A0A1I6BRK6      TL--AKLIGRFNEVE--LE-------------RQRMLR---------TMQP-TSVLI---
A0A243WAB1      TL--LGLIGKFNELQ--LE-------------RERTLR---------TTQP-SSLLV---
A0A6G8C8X6      TL--MSLITKFNELQ--LE-------------RERILR---------TTQP-NNPLV---
A0A5B6TJH8      TL--MSLIGKFNELQ--LE-------------RERMLR---------TTNP-NNPLI---
A0A519U664      TL--LGLIGKF-------------------------------------------------
A0A519UDD1      TL--TSLIGKYNELQ--IE-------------RQRLLP---------NLEP-SSILI---
A0A519MA34      TL--LGLIGKFNELQ--VT-------------RERMLR---------TNES-TSFLI---
A0A519UCX0      TL--LVLIAKFNELQ--AT-------------RESILR---------TSQA-NSFLI---
A0A4R5DL69      DF--TLLTDKYNTVQ--LS-------------RDKAGY---------NFTG-QHPAM---
A0A1M4YED3      GL--TSLVERLAEAE--AN-------------QIKLRQ---------TMGE-NSPQV---
A0A2H3NSN0      RI--AALDQQIADLE--AQ-------------AEPYYI---------NNPD-LRGNE---
A0A2P6C324      QI--QALEDQIAELK--AR-------------AEQYYI---------NDPT-LRGDE---
A0A1M6XHU0      QI--DALSKKIAELK--VQ-------------AEQYYV---------FNPK-LRGNE---
A0A5S9C8G0      QI--DALSKKIAELK--VQ-------------AEQYYV---------FNPK-LRGNE---
G2SF81          QI--DALSKKIAELK--VQ-------------AEQYYV---------FNPK-LRGNE---
A0A5S9EYW1      QI--DALSKKIAELK--VQ-------------AEQYYV---------FNPK-LRGNE---
D0MHQ9          QI--DALSKKIAELK--VQ-------------AEQYYV---------FNPK-LRGNE---
A0A126PFG0      TL--SSLVEKLTELH--AQ-------------RERLLT---------TTPE-NNPLF---
A0A3M1N7Z3      VQ--VPLTE-LNQLL--EQ-------------RLRLLK---------VYQP-TSPIV---
                                                                            

A0A1T5MMH4      -------------REKQQEIENRTDKTSQQLAEL--------------------------
A0A2W4R1L8      -------------REREQQIQNLQEQVTKQLTEL--------------------------
A0A2E5CV79      -------------IEIQKRVSIMKEKLDEKVQQL-----------IAQGITSQDPLAERQ
A0A2D4ZVH1      -------------ARIENEILKVKRQIKDRTNNL--LSSGSDLYLSFIGSGDGTLTQRIA
A0A0K8QSK7      -------------NQINAQIEKLKEALMANINSS--------------------------
A0A1V6CN82      -------------TQLNDQLGNVKEAMLENINNI--------------------------
A0A1M4XZ45      -------------LRLNAQIESVKNSLRENVNNI--------------------------
A0A399D319      -------------LQLNAQIESVKNSLRENVNNI--------------------------
A0A1M6GR99      -------------NRLDIQIKNLKNTVSENIAAA--------------------------
A6EBM4          -------------MRLNRQIQEVRKAAMENINAS--------------------------
A0A1M6TTV4      -------------QRLNQRLEISQNSAKFRLTSY--------------------------
A0A4Q8RX32      -------------RELNFQTNNLKKTILVNLQYA--------------------------
K0X1U5          -------------RTLTAQIDVMRENILNTVSKA--------------------------
R5EXK3          -------------RTLTAQIDVMRENILNTVSKA--------------------------
A0A401UAP7      -------------QELQRDIEFAEKALVIQLTEL--------------------------
A0A1W2GF52      -------------KRLDQQIEIAKNSANSRLLAY--------------------------
A0A2G5L7B8      -------------KQLNSRIDLSQKAVHDRLVSY--------------------------
A0A523GAC0      -------------IKVDQEITLIQEQLESYLQAH--------------------------
L8JW09          -------------TRKEEEIKNSKTALKAQLEKL--------------------------
A0A364XUP5      -------------RELEKEIETHSTRAIEHINAL--------------------------
A0A1M5RLA9      -------------RQRQKDIETLRAKASRQLEEQ--------------------------
A0A385SFR9      -------------RQRQKDIETLRDKSGRQLEEQ--------------------------
A0A5M4A9J4      -------------QQLRSQIEVTKKALIENSRTM--------------------------
A0A5M4B1C7      -------------IQLRTQIRVTQKAVVENSLNI--------------------------
A0A0D3LFR6      -------------QMKIKQVSMIKEDLLAALQLY--------------------------
M7N6D4          -------------QLRNKKISAVKEELANAIQGY--------------------------
A0A4D7K1D4      -------------RKLNNELKIHKQELNDQLAYL--------------------------
A0A5C7MX19      -------------RLLDKQIQDFKEELNNNLDNG--------------------------
A0A1Q3ZMZ7      -------------TIKEKQIDQKIREIKKSIEVL--------------------------
A0A2D8JJW3      -------------NDIPKSYELAIKDTLRFLDIR--------------------------
A0A2W2AFF7      -------------RNMDQQSDNLRGDINNSLASL--------------------------
R7PCR1          -------------RDMNEALKAKRASILAGVRSY--------------------------
A0A2N5YXE2      -------------VTIDEQIATKKATIVDFIGST--------------------------
A0A1G9E2A9      -------------QFGVTEINKLEKSVKELIDFN--------------------------
A0A098LL25      -------------KTKNKSIERIKENVLELIDIN--------------------------
A0A6C0GJI1      -------------QSKNQAIEIAKNSISELIDQD--------------------------
A0A2T2YJE8      -------------QLLEEEIKFVEQSVRKLLAQN--------------------------
A0A127B287      -------------ELLDQQIKFAQDKVSSLLKEG--------------------------
A0A3M9N829      -------------NLREEQLKFTQGRLNAIINSN--------------------------
A0A0P0CSF9      -------------NSLEERLEIAQNRLRDVINGS--------------------------
A0A5M8QQB8      -------------KLAEEQLRFAQNRIAGIISSS--------------------------
A0A3M9MNC3      -------------NALEERLQFAQGRLRDAINGS--------------------------
A0A5B6TAX2      -------------NALEEKLAFSQNRIAGILNSS--------------------------
A0A5N1IQ33      -------------QLKQEALEYTRRNIRGLLQGT--------------------------
A0A512AYT3      -------------RRYQKEMAFTKDAVNKLLEQN--------------------------
A0A5M6CYN7      -------------KRAQKEISLTKEAASKLLDQN--------------------------
A0A369QP10      -------------QLLEEEIDFSEKAVRKLLAQN--------------------------
A0A126PDF2      -------------QQKNAQMDYTLSSILRQITQA--------------------------
A0A2Z3GKA1      -------------QQKNAQMDYTLSSILRQITQA--------------------------
A0A502GZP7      -------------QQKNALMAYTLSSILRQITQA--------------------------
A0A519SBU8      -------------QRNQAIIRETRVSLQRQLQQN--------------------------
A0A4Q3JNZ3      -------------QRDEAVVRETRKSLQRQIQQN--------------------------
A0A519Q9V3      -------------QRDQAIIRDTRDLLQHQLQQD--------------------------
A0A0M3RW20      -------------QQRKAAVEYAKRNVQDALQQS--------------------------
A0A495VFX4      -------------QQRKAAVEYAKQNVKDALQQS--------------------------
A0A1S9B3W0      -------------RIKEDQLQKTKSNIQKLLQQD--------------------------
A0A1W1VRL3      -------------KQRRVQLDFTRSTIRRLLEQN--------------------------
A0A1M6R305      -------------QQQREALSYVRGNLRRTLKQS--------------------------
A0A4Z0PHK3      -------------KQQQAALAYVKNNIRRLLQQN--------------------------
A0A2M9B9H9      -------------KQQQAQLAYVKNNIRRLIQQN--------------------------
A0A4Z0QCY9      -------------KQQQAALAYVKNNIRRLLQQN--------------------------
A0A418R9X5      -------------KLRRAEIANIKAIIRELLSKD--------------------------
A0A428JSJ3      -------------KLRRSEIANIKGIIRELLRKN--------------------------
A0A428KI59      -------------KLRRSEIANVKSIIRELLRKN--------------------------
W8F1I6          -------------KLRRSEIANVKSIIRELLRKN--------------------------
A0A246FQC0      -------------QTKEQNIADLKKIVRQLLRKN--------------------------
A0A372E5P8      -------------QIKEQSITNIKKIVRQLLRKN--------------------------
A0A1H3EMW1      -------------QIKEQSIADLKKIVRQLLRKN--------------------------
A0A1H9ZSN3      -------------QTKEQSIADLKKIVRQLLRKN--------------------------
A0A5N1J2M4      -------------TSIETQINKLKKDIRELLQRS--------------------------
A0A519S476      -------------QLQQAEIRETRAALRRQLAQD--------------------------
A0A4Q3JRW8      -------------QRNQALIRDTRELLQRQLQQD--------------------------
A0A519M923      -------------QRNEAIIRDTRTSLQRQLEQD--------------------------
A0A4Z0ENW1      -------------QGPLTQLKFAQATLQHQLVQA--------------------------
A0A519UDB4      -------------SQLRAQVQFARAALQKQLSQS--------------------------
A0A3S0QKV1      -------------RIREDQLRRTRDGVQKLLQQN--------------------------
A0A328BL48      -------------QIRQSQLAFTKRSIRRLLQQT--------------------------
A0A5R8WLY4      -------------QIRQSQLAFTKRSIRRLMQQT--------------------------
A0A1I5WSL8      -------------QRTKADIEYARTAVSRLLRQS--------------------------
A0A0U3JVM7      -------------QSKQANIEYTRASIKRLLQQN--------------------------
A0A1G1SSV2      -------------QGIRDDIAYTRASLKRLLRQN--------------------------
A0A1G1SXV7      -------------QGIRDDIAFTRASLKRLLRQN--------------------------
A0A6G8CBJ6      -------------KQRRVQLDFTKNTIRRLLEQN--------------------------
A0A0W8EDI5      -------------QIRREQLDFTRRSIRRLLQQA--------------------------
A0A3B7RBP8      -------------QIKQEQLDYTRRSIGRLLQQA--------------------------
A0A3R9P8H7      -------------QTKEQFVADLKKIVRQLLRKD--------------------------
A0A238WIA7      -------------QVIQDQIAFTKRSIRQLLVQN--------------------------
A0A212UCJ7      -------------KNLQGQITFTKQNINQLLRQN--------------------------
A0A4Z0MQE1      -------------KNLQDQIAFVKRNINQLLRQN--------------------------
A0A4Z0PCF4      -------------KNLQQQIAFVKRNIMQLLRQN--------------------------
A0A5D6VDG1      -------------QLRRANVAYAKRNVQESLQQS--------------------------
A0A6H1CVS0      -------------QLRRANVAYAKRNVQESLQQS--------------------------
A0A243WHR7      -------------QQLQADVNLVKKSTQRLLQQN--------------------------
A0A5B8A0P6      -------------KQQESMLVFIKQNIRRSLQQS--------------------------
A0A076HRT9      -------------QQQREQLNFVKGNVRRTMRQN--------------------------
A0A4Z0PVM7      -------------KQQQAALAYVKNNIRRLLQQN--------------------------
A0A1M6DHW8      -------------QQQQSTIAFLKGSIRRQLQQN--------------------------
A0A4Q5LC61      -------------KQQQSAITYLKNSVRRQLQQN--------------------------
A0A2U1FKU2      -------------QEAAMQLVSMRKSINVAVDNY--------------------------
A0A0A2F954      -------------QEVGMQLVAMRKSINAAVDNY--------------------------
A0A0A2FW91      -------------QEMAMQLVAMRKSINAAVDNY--------------------------
A0A2D2N2N1      -------------QEVGMQLVAMRKSINAAVDNY--------------------------
Q7MWZ2          -------------QEVGMQLVAMRKSINAAVDNY--------------------------
T2NDT6          -------------QEVGMQLVAMRKSINAAVDNY--------------------------
W1R7P9          -------------QEVGMQLVAMRKSINAAVDNY--------------------------
A0A1R4AFZ0      -------------QEVGMQLVAMRKSINAAVDNY--------------------------
A0A1R4DVZ7      -------------QEVGMQLVAMRKSINAAVDNY--------------------------
A0A2A8CVM9      -------------NGLEKRKRSLTNQLVAEATQS---SGLPGATAGNDSQMGTSALNRIM
A0A5M4B212      -------------RQLSIQMETTKRTLLENSRNI--------------------------
A0A3D1KEX9      -------------QDYEKSLVAMRSAIKVSLDNY--------------------------
A0A358Y7S2      -------------KRIEIKIQNKISNIRRSMKVI--------------------------
A0A1X7J248      -------------LQRKIEINVLKDRINNYLSSK--------------------------
E4TQD2          -------------LQRNLEINALKDRINNYLNNK--------------------------
A0A2J6HHN3      -------------ESIDKQISYQKRMIHQSAASL--------------------------
A0A1Y3WMT8      -------------RTLTAQIDAMRDNILNTVSKA--------------------------
A0A1Y4GQU1      -------------LTLTAQIDAMRENILNTVSKA--------------------------
A0A6A0R272      -------------RELDSQIIETINSIRESIKLS--------------------------
A0A1V5W8T5      -------------KVIDQQILEQKKLLLDFIKIS--------------------------
A0A2T8HKA9      -------------QELDQYLSSNRQNIERAVDNA--------------------------
A0A2I0QZ80      -------------QKLEKRITIRKESITRIIDAL--------------------------
A0A3E1F1A3      -------------SKLEGRIQVRKENIDEVVVLL--------------------------
A0A2U2XBJ3      -------------KKLEMRIQIRKENIDEVIDLL--------------------------
A0A4Q4KU94      -------------KKLIMRIQVRKENIDEIIALL--------------------------
A0A3B8INU3      -------------RRTQQSLQILRDELLDAIDQE--------------------------
A0A2W1NDY9      -------------KNLESNIINQTETINRTLKAI--------------------------
A0A5C8AQR5      -------------VNLNQRIEGKIQAIKRSMSVI--------------------------
A0A1G0CI31      -------------KNINIQIQSKIQSIRRSVDAI--------------------------
A0A556N0M0      -------------KNLNSRIQSKVQSIRRSVEVI--------------------------
F2IKD6          -------------KNLNTRIQSKIQYIRRSIEVI--------------------------
A0A1I7BM74      -------------TQLDKKISADIEITNKIINAL--------------------------
A0A2G2FJ17      -------------KKIETRVDNRIQNINKIIIVL--------------------------
A0A2E3R1D0      -------------ARVEADQERIARQLSAQSLASGSSPD-----------DQRSGFVRAA
A0A2T2USC0      -------------RQLSREADSLAQQYVQQTIAAGGVGSIPAKGEETTRRGQGRGLSYVV
A0A2T2V0F3      -------------RQLDREADSLAQKYVSEAIAAGGIGSIPAEDRQGGGRQQGRGVGYVV
A0A2T2S682      -------------DRLERQADSLADAYVEKTLAAGGIGA----GEGGEEGGGERGISYVV
D5H561          -------------QKLRARIQRLSDRYVEE-LMGGGLSP----KQGAQR---------IN
A0A2H3NWA9      -------------DRLDTQAQDIAARYVDQALAAGGAGP----GEDSE-----RGVGYVA
A0A2A8CVB6      -------------SRLQERADSLASKYVNESLAAGGVGS----QSGEN----SRSLTYVV
A0A2P6C1S6      -------------QTLARRTDSLANRYVEESLSAGGVAS----SSGEDG--GPSGVSYVA
A0A2T2UTM4      -------------ATLDRKTDSLASRYVRESLSAGGVAA----GGGGEG--GGSGVSYVA
A0A414ZBF2      -------------REMNASLVSMRASISKAVDNL--------------------------
A0A1Q3Q573      -------------RLLDKQIFSSKNQLLKRTEYV--------------------------
A0A662BAY3      -------------KRLNAQIENAKSNLLENVNNI--------------------------
A0A4U3L369      -------------QNIDMQLSNLRRDMINNLSSS--------------------------
A0A357YNR3      -------------IDLNYQLTSMLNSVKSSLQNE--------------------------
A0A5E8AX52      -------------SRMTQRLETLKKNVRGITEEY--------------------------
F4KK08          -------------QELNTQLAAQRLSIITSIDNL--------------------------
A0A6B5PK86      -------------KRIDKKIQEKIKQILRSSDAI--------------------------
A0A2G2F510      -------------KLLDRKVKAKTNLIQRSVSAI--------------------------
A0A316JZ08      -------------ALVQKRIDTKINTILRSIATI--------------------------
A0A496LCF9      -------------EVVSGQIAQIKNQLNELMASV--------------------------
A0A5P2G2A9      -------------IALDSQIGKARKELIGNLVNM--------------------------
A0A3C0ZQC7      -------------KEIDVQINALREKLRKRTEEFLLSLL----PGQRSTGSSNDPASFLS
A0A419VXB7      -------------QVIDKELEYVKKSLVENLDNL--------------------------
A0A0B0BTJ4      -------------REMNAQIISMQHSLKKSIENV--------------------------
A0A3B9CNN6      -------------REMNAQIISMQHSLKKSIENV--------------------------
R5X290          -------------REMNAQIISMQHSLKKSIENV--------------------------
A0A1Q6E6I7      -------------REMNAQIISMQHSLKKSIENV--------------------------
C3J7R8          -------------ETLEKQLASMHVAVVKSVDNL--------------------------
A0A1G8BVM8      -------------NDLQTSLVSMRSSILSSVDNL--------------------------
A0A1I1FXP9      -------------RLRDKKIGSMGEDLLKIINET--------------------------
A0A3N4H5N3      -------------LSLNEQISSLRSNIIQNISST--------------------------
A0A2P8EAX2      -------------ISLNEQLSSLKSNILQNIRSN--------------------------
A0A4V2F6N9      -------------IALNEQLSSLKSNILQNIRSN--------------------------
A0A3B9FXJ0      -------------KLVTGQIDEVKKNFKEALVNA--------------------------
R5GSU5          -------------NDLNQKLIATNEAIRASVHSL--------------------------
A0A2A3UE91      -------------KQVNYQLENQRKLLLESLDGV--------------------------
A0A0A2G557      -------------ETQQKQLESLRKAIIKSIDNY--------------------------
A0A2N2WFW8      -------------ESVNSQIDFQKRIIRESASGI--------------------------
A0A1F3IU95      -------------ESINAQIEFQNKIIRESTIGL--------------------------
A0A3D0VUF6      -------------ESINAQIEFQNKIIRESTIGL--------------------------
A0A1T4PT95      -------------ETQQKQLESLQKAIIKSIDNY--------------------------
A0A6I6JYY3      -------------VRLNAQIESVKNSLLENTSNI--------------------------
A0A2A4PYG9      -------------KGVNYQISVQKKLLIGSIKSL--------------------------
A0A1F3K695      -------------KVVDKQIENQKMILTEFITSA--------------------------
A0A353KZR1      -------------KVVDKQIENQKMILTEFITSA--------------------------
A0A2N2WYB5      -------------KQLDKQISNQKNLLIDFINST--------------------------
A0A1F3K4G0      -------------KLLEKQIDNQKDLLLEFVNST--------------------------
A0A356H8Y3      -------------KLLEKQIDNQKDLLLEFVNST--------------------------
A0A351HSA6      -------------KLLEKQIDNQKDLLLEFVNST--------------------------
A0A1F3Q014      -------------RLIDYQIEIQKKLLKESINSV--------------------------
A0A2A4YXP3      -------------KSLDHKIKVQKKILFESINSS--------------------------
A0A2D5KD44      -------------QEIDYQIDIQKKLISESINSL--------------------------
A0A1F3R158      -------------KFHDQQIEVQKEVLFKTILSL--------------------------
A0A2M8ADX2      -------------KIQDQQIELQKEVLFKTIISL--------------------------
A0A1J5B2H0      -------------ESINYQINIQKKLLIESIKSL--------------------------
A0A1V5N756      -------------KQINYKLDIQKKLFAESIKIA--------------------------
A0A651GU15      -------------KNIEYQVEIQKRLILEAIQSM--------------------------
A0A3Q9FR88      -------------NAKLELYKKLRYEVAESIKFA--------------------------
A0A553GEX3      -------------NAKLELYKKLRYEVAESIKFA--------------------------
A0A150ADJ9      -------------NAKLELYKKLRYEVAESIKFA--------------------------
A0A1B1FWQ4      -------------NSTLELYKKLRYEVAESIRFA--------------------------
A0A1S1Z228      -------------NSTLELYKKLRFEVAESIKFA--------------------------
A1ZKR2          -------------KDINQKLELQRTQVQKLLARV--------------------------
A0A1Q3GX01      -------------KDVNKKLDIQKEKATRIITKA--------------------------
A0A349DQI4      -------------QNINQQLNTQKAKANRLIAKA--------------------------
A0A4P5TMD1      -------------INIDKQIDEVKTNIIQNINNS--------------------------
A0A2N3IIZ0      -------------QVLDIKINNLQKNITESIDRY--------------------------
A0A1F3SJM1      -------------VALTKKIKAKILLIQHSVSTI--------------------------
A0A2G2EB96      -------------AIINQKIASKLRIIQRSIGAI--------------------------
A0A2G6PRA9      -------------EIINQRITSKLNIIQRSIAAI--------------------------
A0A497D5Z2      -------------KRLNAQIESVKSSLLENTNNI--------------------------
A0A662B170      -------------KRLNAQIESVKSSLLENTNNI--------------------------
A0A2A5FYT6      -------------KSIDYQISIQKNLLLESLKAM--------------------------
A0A2E6SYP1      -------------KEIDFQIKLQLNDLKEVVSNL--------------------------
A0A2E5RLE8      -------------KEIDFQINLEIQDLLEVTKNI--------------------------
A0A2E7TQF6      -------------KEIDFQINLEIQDLLEVTKNI--------------------------
A0A2E6GVY9      -------------KEIDFQINLEIEDLLEVTKNI--------------------------
A0A350JJ90      -------------RVYDQQISVQKNLVIKSLEVL--------------------------
A0A3M1CDV2      -------------KIINYQIENQKKILIETLYTL--------------------------
A0A6C1QGZ7      -------------EALNYQIEIQKRILAESISTL--------------------------
A0A4P5U6G4      -------------INIEKQIDDLKLNIKENIGNT--------------------------
A0A2E2TFD1      -------------QNLDYQVRIQKKLLFESIISM--------------------------
A0A2E4ELE6      -------------KNLEYQISIQKKLLVESINSS--------------------------
A0A522EYA6      -------------KSIEFQIEVQKKLLLESVKSI--------------------------
A0A2E3XZI5      -------------IQLNRQIEEEILYIKKAVKLL--------------------------
A0A6I7QXV0      -------------LLIEENIEMLKRELFENFFTG--------------------------
A0A2M7NLQ9      -------------QQKEKKIELLKKEVDKFITLN--------------------------
I4AFR0          -------------QQKAKRIDLLKKEVDKFITLH--------------------------
A0A2N2Y3E5      -------------KSIDKQIDNQREILKEFLQTS--------------------------
A0A2D9D7T6      -------------EILDQKIDARIVSIRKSLIII--------------------------
A0A1F3PPL5      -------------KIVDKQIENLRKTMIDFIKNT--------------------------
A0A357QK06      -------------KIVDKQIENLRKTMIDFIKNT--------------------------
A0A662AEA4      -------------TTIDKQINNQRQLIIELLSTT--------------------------
A0A0S2HYK8      -------------KIIDKQIANQKKLIIDFVKNN--------------------------
A0A2N5ZWN6      -------------KLIDNQIENQRRLIIDFVNNN--------------------------
A0A2E0FJ09      -------------KKIRSQIDVQTKLISEGIKSL--------------------------
A0A1F3FZ62      -------------NALEYQLGIQKKIMFETLKSY--------------------------
A0A1F3K211      -------------NALEYQLGIQKKIMFETLKSY--------------------------
A0A1V6I2U9      -------------QTLDEQIKSKKETIIDFTRST--------------------------
A0A2H0B957      -------------KVIEKQIETQKQTLIDLIKSN--------------------------
A0A1F3CFW6      -------------KVIEKQIETQKQTIIDLIKSN--------------------------
A0A2M7E2T8      -------------KVIEKQIETQKQTIIDLIKSN--------------------------
A0A2M7NC69      -------------KVIEKQIETQKQTIIDLIKSN--------------------------
A0A1F3KLL5      -------------KVIDKQIVTKKGILVEFVKTT--------------------------
A0A359D1M1      -------------KVIDKQIVTKKGILVEFVKTT--------------------------
A0A0F2NS19      -------------KSLENQIDVQKQILFTTINSL--------------------------
A0A2A5H8X6      -------------KSLENQIDVQKQILFTTINSL--------------------------
A0A2H0GAU8      -------------KSLDRKIEIQKEVLFATISSL--------------------------
A0A2M8FTK1      -------------KSLDRKIEIQKEVLFATISSL--------------------------
A0A2A5B3B0      -------------KSLKHQINVQKKVLFESINSS--------------------------
A0A5C6RXM7      -------------NSMNYKIDVQKKLLTESINTL--------------------------
A0A1F3C1M2      -------------QVIDKQVQNQKEILIEFISST--------------------------
A0A1F3DS87      -------------QVIDKQVQNQKQILIEFISST--------------------------
A0A6A0R6K9      -------------KELDFQIDIQKKLIVSSINNL--------------------------
A0A2E7CT70      -------------ILLNYQIEEEIIYISKAIELI--------------------------
A0A2D5V560      -------------IILNGEIEESVVYIKKAVKLL--------------------------
A0A2D7K5A8      -------------ILLNGQIEESVLYIKKAVKLL--------------------------
A0A2E1XQ82      -------------ILLNGQIEESILYIKKAVKLL--------------------------
A0A5C8A5B4      -------------IAMERKLNNLKSSLAQTAESL--------------------------
A0A4Y9ITE2      -------------RTISSQLDAMRENINATLDRS--------------------------
A0A5M8NYX7      -------------REYEERIALLRTNLLKGIDIA--------------------------
A0A3D5KRY6      -------------VSLNNEIRFTQKSLLENIESL--------------------------
A0A1V5IPN7      -------------KLLQEELAKTKNTLDTEIQKF--------------------------
A0A0E3V905      -------------ETVDSQIKITKNNMASTILTM--------------------------
A0A553ETH6      -------------TKKEQEIQSLKTAISKNLKEL--------------------------
A0A640Q161      -------------IAANAELSSIRETLNGQIRDL--------------------------
A0A640QU49      -------------IAANAELSSIRDTLSSQIRDL--------------------------
A0A1Q3PII2      -------------ILLEEQISVLRNSLFDAIQYQ--------------------------
A0A351BXT2      TLAEYNRKIAPLRETLEEKIEVMRSSLFASTPEE--------------------------
A0A2K8Z965      -------------ETINSQIRTAENNMAGNILTM--------------------------
A0A418M8U8      -------------QTIDTQINSLKGNMEDNIRTM--------------------------
I2GTA4          -------------QTIDTQINSLKGNMEDNIRTM--------------------------
A0A2K8ZAJ2      -------------ESLDSQLKNTNAAISENIETI--------------------------
A0A368JPA3      -------------RSLDDQIFATRASIGETLATL--------------------------
A0A5N1JI29      -------------RSLDDQIFATRASISETLATL--------------------------
A0A3P1BT12      -------------RSLDDQISATKTSINETIATL--------------------------
A0A3P1CI15      -------------RSLDDQIATTRASLAETIATL--------------------------
A0A4R8CUK1      -------------QSITHQIDATKSSASETVAIL--------------------------
A0A3D0MYJ7      VESDYNKKISTLKSQYDKYYEEFVIGITSLTPDI--------------------------
A0A662AH13      LKAEADRRIGELKTELDNELAKYKASIFAASPEE--------------------------
A0A5C7QA01      -------------REINAQI----------------------------------------
A0A3D3LS70      VKNEYDAKITALKKSLDEKVELLKTGIYAGTPEE--------------------------
A0A1G1TM36      -------------KPLDSEIQTTQLAIRTSVQNI--------------------------
A0A1G7ZF38      -------------QSMEKQIGVLRTSLADAIEHQ--------------------------
C6VS52          -------------TTLDSQIAAARGNLFDAIHQQ--------------------------
A0A2A4G4B1      -------------LTMNERLTELQKGIAISLEGY--------------------------
A0A0P7X1V8      -------------IEINQQIEGLREEIARLTNDL--------------------------
A0A5C8KAD6      -------------ISLAEEIGKVKPGIIENIRTQ--------------------------
A0A5N1J695      -------------LALADEIQKVRPGILENIRNQ--------------------------
A0A1H4ADG3      -------------KNLDNQIKGLRSDMLSGLNSI--------------------------
A0A5B8VUR8      -------------KNLDNQIRSLRSDMLSGLNSI--------------------------
A0A3N2M1H3      -------------EDYDSQLNGLRESITRSMSNR--------------------------
A0A4S2G8T2      -------------EDYDSQLNGLRESITRSMSNR--------------------------
A0A1T5K9D4      -------------MQIEDAMISMKQNILGTIDNL--------------------------
A0A077ENE7      -------------LDLDDALGAMRTNISRAVDNA--------------------------
A0A6I5UW06      -------------LDLDDALGAMRTNISRAVDNA--------------------------
T0NN57          -------------MDLDEALGAMRNNIGRAVDNS--------------------------
X5K347          -------------MDLDEALGAMRNNIGRAVDNS--------------------------
A0A212K7W5      -------------LDIKQSLLFVREAIISSVDNL--------------------------
F5IU11          -------------LDMKQSLLFMREAIISSVDNL--------------------------
A0A6I1IYY4      -------------QTADKNLAEMRTVISGSMDNY--------------------------
K0XJ09          -------------KDLDNNLAAVRVNLTASMDSY--------------------------
R5EUZ0          -------------KDLDNNLAAVRVNLTASMDSY--------------------------
W0EQS0          -------------RDLDSNLASVRENLSSSLNNY--------------------------
A0A1Y3WE15      -------------RDLDNNLASVRVNLASSLSNY--------------------------
A0A1Y4GUK3      -------------RDLDKNLASVRINLASSLSNY--------------------------
A0A352Z1R7      -------------RTIQGQIDEIQKKIRSTYETN--------------------------
A0A3N2N6F7      -------------KDRDNSLASIRAALASSLNTQ--------------------------
A0A4P7VVU7      -------------QDYDKNLRSMRSALVSSLTNQ--------------------------
A0A2V1ILM4      -------------QDYDKNLRSMRSALVSSLTNQ--------------------------
A0A3N2L0E8      -------------QDYDKNLRSMRSALVSSLTNQ--------------------------
A0A3N2LFC5      -------------QDYDKNLRSMRSALVSSLTNQ--------------------------
A0A0A2F501      -------------QDLTTQIGAMRSIILSSLDNQ--------------------------
R5B7P0          -------------KDLDQALASMRGSISRSIDNE--------------------------
R5B0L5          -------------VDMDNRLASMRSTILSSLDNQ--------------------------
A0A6I1TEC0      -------------ADYDQNLNAMRRSITASIDNF--------------------------
A0A3R5XWG1      -------------ADYDQNLNAMRRSITASIDNF--------------------------
A0A646GTR1      -------------ADYDQNLNAMRRSITASIDNF--------------------------
A0A5P0Y910      -------------ADYDQNLNAMRRSITASIDNF--------------------------
A0A414YFM3      -------------ADYDQNLNAMRRSITASIDNF--------------------------
A0A6A7UIA7      -------------ADYDQNLNAMRRSITASIDNF--------------------------
A0A6A7VPS3      -------------ADYDQNLNAMRRSITASIDNF--------------------------
A0A374THP7      -------------ADYDQSLGSMRKSITASLDNF--------------------------
A0A6G1VND1      -------------ADYDQSLGSMRKSITASLDNF--------------------------
A0A0A2EVS5      -------------IDMDRTLTAMRRSILLSIDNE--------------------------
A0A1T4NAJ7      -------------IDMDRTLTAMRRSILLSIDNE--------------------------
A0A255T941      -------------QDLTSSLQSMQKTIVQSIDNL--------------------------
A0A3N2KCL3      -------------VQLNEQMDQMRHAILASVDNS--------------------------
A0A4P7VSV0      -------------VQLNEQMDQMRHAILASVDNS--------------------------
A0A2V1IJY1      -------------VQLNEQMDQMRHAILASVDNS--------------------------
A0A4P7VXK7      -------------VQLNEQMDQMRHAILASVDNS--------------------------
A0A1Y4CHN5      -------------KDMDNALKSMREAIITSIDNL--------------------------
A0A1M6I2S6      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A1Y3V692      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
F3PXM2          -------------VDLTASLRNLHHTVVQSVDNL--------------------------
A0A3E4ZNL4      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A174AHH7      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A174JCE8      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A3E4JMC4      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A412SND6      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A414IEQ9      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A415UKN5      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A6I0U0V8      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A6I2PDH7      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A0M1W8D8      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A3R6GKX5      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A7V4S1          -------------KDLGNSMQSMKRTILQSVDNL--------------------------
B0NU19          -------------KDLGNSMQSMKRTILQSVDNL--------------------------
D4V601          -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A4Q0U3M9      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A4R4H1Q2      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A6I0GII7      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A6I0KYU7      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A397WLT5      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A6KY94          -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A173UQR8      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A3R6HK75      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A412B7D1      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A412VNY9      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A414LTU9      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
I9Q4U4          -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A6A2J529      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A3R6GM96      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A015XH67      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A078RZN2      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A4R4I3T9      -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A6L0K5          -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A7ACT5          -------------KDLGNSMQSMKRTILQSVDNL--------------------------
A0A373ISF0      -------------KDLASSLQSMQRTIIQSVDNL--------------------------
U6RF62          -------------KDLANSLQSMQRTIIQSVDNL--------------------------
A0A662ZZD5      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A3A5TI83      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A415NEB6      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A6I0I238      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A7AJ60          -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A6A2JF01      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A6I0Y2Y2      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A6I2Q447      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A395YYT3      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A015UXN7      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A5M5W148      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A6I2NTL0      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A016E4F9      -------------KDMANSLQSMQRIIIQSVDNL--------------------------
A0A4Q5CFJ7      -------------KDMANSLQSMQRTIIQSVDNL--------------------------
A0A6H9P0U9      -------------KNMASSLQSMQRTIIQSVDNL--------------------------
A0A108TH71      -------------KNMASSLQSMQRTIIQSVDNL--------------------------
I8VXH0          -------------KNMASSLQSMQRTIIQSVDNL--------------------------
A0A412S0N6      -------------KNMASSLQSMQRTIIQSVDNL--------------------------
A0A412IIJ0      -------------KNMASSLQSMQRTIIQSVDNL--------------------------
A0A0P0FM97      -------------KNMASSLQSMQRTIIQSVDNL--------------------------
R6KTP3          -------------KNMASSLQSMQRTIIQSVDNL--------------------------
A0A139LU87      -------------KNMASSLQSMQRTIIQSVDNL--------------------------
A0A1C6B3Y5      -------------KNMASSLQSMQRTIIQSVDNL--------------------------
E2NMQ4          -------------KNMASSLQSMQRTIIQSVDNL--------------------------
A0A412YDB9      -------------KNMASSLQSMQRTIIQSVDNL--------------------------
R7DY01          -------------KNMASSLQSMQRTIIQSVDNL--------------------------
A0A414LGK8      -------------KNMASSLQSMQRTIIQSVDNL--------------------------
A0A415IPQ4      -------------SNMANSLQSMQRTIIQSVDNL--------------------------
A0A3E5BRW7      -------------KNMANSLQSMQRTIIQSVDNL--------------------------
K9DXS6          -------------KNMANSLQSMQRTIIQSVDNL--------------------------
A0A1M6KFV3      -------------KNMASSLQSMQRTIIQSVDNL--------------------------
A0A1Q6G7L3      -------------KNMASSLQSMQRTIIQSVDNL--------------------------
A0A413H235      -------------KNMASSLQSMQRTIIQSVDNL--------------------------
A0A1M5B2J8      -------------VEMDASLAAMRKALVSSIDNQ--------------------------
A0A255RCT5      -------------VEMDASLASMRKALVSSIDNQ--------------------------
A0A1Y4GLF5      -------------VDMDQALKSMRKAIIGSIDNQ--------------------------
A0A1H3XSC0      -------------VDMDQALTAMRHAIVQSIDNQ--------------------------
A6LE40          -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A4Y1VPX5      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
B3JI46          -------------VDMDQALASMRGAIIRSIDNQ--------------------------
R6NN15          -------------VDMDESLRSMRRSIVSSVDNL--------------------------
A0A358R8U0      -------------VDMDQALSEMRRAIITSIDNQ--------------------------
R6WSB6          -------------VDMDQALSEMRRAIITSIDNQ--------------------------
A0A401LPX7      -------------REMDKSLDDMRSALITSIDNQ--------------------------
A0A6I0J0P8      -------------REMDKLLEDMRSALITSIDNQ--------------------------
A0A6I1BFM0      -------------REMDKLLEDMRSALITSIDNQ--------------------------
A0A6G0GNY9      -------------REMDKLLEDMRSALITSIDNQ--------------------------
A0A3A5Z900      -------------REMDKSLDDMRSALITSIDNQ--------------------------
A0A285TGL6      -------------REMDKSLDDMRSALITSIDNQ--------------------------
A0A3A5RFX4      -------------REMDKSLDDMRSALITSIDNQ--------------------------
A0A1Q6IUW9      -------------REMDKSLDDMRSALITSIDNQ--------------------------
A0A3R6NPG7      -------------REMDKSLDDMRSALITSIDNQ--------------------------
A0A413XDP6      -------------REMDKSLDDMRSALITSIDNQ--------------------------
K6AP24          -------------REMDKSLDDMRSALITSIDNQ--------------------------
A0A6I2NHV3      -------------REMDKSLDDMRSALITSIDNQ--------------------------
A0A662ZYI7      -------------REMDKSLDDMRSALITSIDNQ--------------------------
A0A078RYI7      -------------REMDKSLDDMRSALITSIDNQ--------------------------
C7XEQ8          -------------REMDKSLDDMRSALITSIDNQ--------------------------
D7INX6          -------------REMDKSLDDMRSALITSIDNQ--------------------------
K5ZG55          -------------REMDKSLDDMRSALITSIDNQ--------------------------
A0A3N2N9B8      -------------ISMDGQLAAMRNAIITTVDNQ--------------------------
A0A3N2NMI0      -------------VTIDQQLAALRNAIVATVDTQ--------------------------
A0A359I8H7      -------------VDYDGQIKGLREAIVNAINGQ--------------------------
A0A3N2KA63      -------------VDYDGQIKGLREAIVNAINGQ--------------------------
A0A4Q0IMT7      -------------VDYDGQIKGLREAIVNAINGQ--------------------------
A0A3B9FAU3      -------------SDYDEQLAQIRKVILEGIDNL--------------------------
A0A3C1E5L7      -------------SDYDEQLAQIRKVILEGIDNL--------------------------
A0A4Q0UAV1      -------------QDRTNTLNTLRKTMVQSIDNY--------------------------
A0A354SN68      -------------KDIDTGLGTLREAILSSIDSE--------------------------
A0A3N2N595      -------------VSIDAQLSSIRSVILKSIDNS--------------------------
A0A0A2DUD9      -------------VDLDANLNDLKSVIVASLDNQ--------------------------
A0A3P1ZBJ5      -------------IELEARISKQRQAIIASIDNL--------------------------
R5FHS9          -------------KDLDQSLRLQRSSIITSVENS--------------------------
A0A413TW79      -------------ADYDQSLASMRHSIVTSIDNF--------------------------
A0A3E5E9M7      -------------ADYDQSLASMRHSIVTSIDNL--------------------------
A0A3E4SK73      -------------ADYDQSLASMRHSIVTSIDNF--------------------------
A0A415GGC6      -------------ADYDQSLASMRHSIVTSIDNF--------------------------
A0A413DBH9      -------------ADYDQSLASMRHSIVTSIDNF--------------------------
A0A1Y4PQK7      -------------MDIDQSLATIREAIISSINNL--------------------------
A0A1Y4IH41      -------------MDLDQSLATIRGAIISSIDNL--------------------------
A0A3A6AAP4      -------------MDLDQSLATIRGAIISSIDNL--------------------------
A0A6I0ZRD2      -------------MDLDQSLATIRGAIISSIDNL--------------------------
A0A1Y4DYA7      -------------ADMDQSLQNMRNAIISSIDNH--------------------------
A0A1Y3X4I9      -------------VDLDQSLQNMRRAIISSIDNH--------------------------
A0A1Y4FNK8      -------------IDMDQSLENMRHAIVTSIDNH--------------------------
A0A355FD59      -------------KDLDQSLESMRKAIVSSIDNL--------------------------
A0A359CEZ9      -------------KDLDQSLESMRKAIVSSIDNL--------------------------
A0A353Q7B4      -------------KDLDQSLESMRKAIVSSIDNL--------------------------
F8X3A5          -------------VDLDQSLQSMRKAIVSSIDNL--------------------------
A0A1M3KVR9      -------------VDLDQSLQSMRKAIVSSIDNL--------------------------
A0A4Y9IJS3      -------------VDLDQSLQSMRKAIVSSIDNL--------------------------
A0A495WI87      -------------IDLDHALAAMRKAIVASIDNQ--------------------------
A0A354M4S6      -------------IDLDHALAAMREAIIASIDNQ--------------------------
R7DH52          -------------IDLDHALAAMREAIIASIDNQ--------------------------
A0A4Q5E7L5      -------------VDMDQALASMRGAIVRSIDNQ--------------------------
A0A4P8LP09      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A4R4GZU7      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A016CWA4      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A1C6H117      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A0M1W0V2      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A139KA16      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A174VQ92      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A1Q6HCG0      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A1Y4JYM9      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3A5QW67      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3A5RQE6      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3A6BP07      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3E5E153      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3Q9IP20      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A412WV15      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A413ICP6      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A414KYB9      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A5B3FWR2      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I0WNS4      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
E5WX00          -------------VDMDQALASMRGAIIRSIDNQ--------------------------
K0X3P3          -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A415TAH7      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A078T2W6      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I1AQV4      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A5C6L2P1      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A412MJT7      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3E4WKT5      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3A5YY33      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A078TAH2      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A1E9CFZ7      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A373FYU5      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3A5TZ72      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3A5XBP2      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3A6MEG9      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3E4JP35      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3E4KP40      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3E4NX82      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3E4XFU8      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A412RG70      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A412TD37      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A413GAA4      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A414M7I4      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A496BTA0      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A496D2V6      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A4Q5G1P5      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A5C6KCA6      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A5M5AHM5      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I0KZV6      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I0Y5K7      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I1BFB8      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I2P5W5      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
E5UZA2          -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A069SMG6      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
C3RFN5          -------------MDMDQALASMRGAIIRSIDNQ--------------------------
A0A3A5Z014      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I0ING7      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I2P894      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A078S3Q8      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A069SJV7      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3E5DXI5      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3E5EM98      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3E5F453      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
I9T3G6          -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A3E4SYU0      -------------MDMDQALASMRGAIIRSIDNQ--------------------------
A6LGY1          -------------MDMDQALASMRGAIIRSIDNQ--------------------------
K5ZSH4          -------------MDMDQALASMRGAIIRSIDNQ--------------------------
A0A6A2RTB3      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I0VY00      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A1M4YZ07      -------------MDMDQALASMRGAIIRSIDNQ--------------------------
A0A4Q5E5M7      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A0P0FQW1      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A5M5C0W6      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I0H151      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I0HI59      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A642LZ22      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I0IP89      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A642NJ89      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I0HI52      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I0YVB5      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6G0G4T5      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A6I0HFG9      -------------VDMDQALASMRGAIIRSIDNQ--------------------------
A0A416GA42      -------------QDLQQAMLSLRESILRTMDNH--------------------------
A0A1T3IYP5      -------------LDLDDALSAMRNNISRAVDNV--------------------------
A0A3P1Z8V4      -------------RDLDRQLEALRSAINTSLANH--------------------------
A0A060RD97      -------------VDGRTQLSALKMTIIQAINNT--------------------------
A0A3C1ITV0      -------------SDINNQLRMMRSTILRSVDNH--------------------------
R7HN19          -------------SDINNQLRMMRSTILRSVDNH--------------------------
A0A350IHV0      -------------GDLNNSISALKVAISRSMDNL--------------------------
R5RVP0          -------------SDLNTSIAALKIAINRSVENL--------------------------
R6A0L2          -------------REMDRQLAQMRQAIASSLRSY--------------------------
R7LG80          -------------RELDKQLHQMRQSIKASVANY--------------------------
A0A2L2WX98      -------------REIDNRLASMRSSLLASIQSY--------------------------
A0A285T4L1      -------------EELNNAIHALRQSIIRAVDNM--------------------------
G5GD56          -------------RDLDKQLAAQRTSILSSVRSY--------------------------
R5KD55          -------------KDIDKALNQLRRSVISSINNM--------------------------
A0A174QNT3      -------------QNMNKNLVAMRSTIAGSIDNY--------------------------
A0A4S2FGS1      -------------QNMNRNLDAMRKTIAGSIDNY--------------------------
R9I0H0          -------------QNMNRNLDAMRKTIAGSIDNY--------------------------
K5BUT9          -------------QAADKNLEGMRATISGSMDNY--------------------------
A0A174FPA3      -------------QAADKNLEGMRATISGSMDNY--------------------------
R6S9Y6          -------------QAADKNLEGMRATISGSMDNY--------------------------
A0A642LIH6      -------------QAADKNLEGMRATISGSMDNY--------------------------
C9KX15          -------------QAADKNLEGMRATISGSMDNY--------------------------
A0A6H0KRK1      -------------QTTDKNLAEMRTVISGSMDNY--------------------------
R6DAG6          -------------QTADKNLAEMRTVISGSMDNY--------------------------
A0A3L8AAP1      -------------QTADKNLAEMRTVISGSMDNY--------------------------
A0A4S2AYX2      -------------QTADKNLAEMRTVISGSMDNY--------------------------
A0A4Y9H477      -------------QTADKKLAEMRTVISGSMDNY--------------------------
A0A0E2M2Y7      -------------QEMAMQLVAMRKSINAAVDNY--------------------------
A0A0K2J6Z0      -------------QEMAMQLVAMRKSINAAVDNY--------------------------
B2RKZ8          -------------QEMAMQLVAMRKSINAAVDNY--------------------------
A0A212GC82      -------------QEMAMQLVAMRKSINAAVDNY--------------------------
A0A254MU12      -------------QEMAMQLVAMRKSINAAVDNY--------------------------
R6CQ93          -------------KELDNSIHALKQSIIRAVDNM--------------------------
A0A3D1NQW3      -------------QNLGNGLASTRRSIIATLDSY--------------------------
B0MT10          -------------QNLGNGLASTRRSIIATLDSY--------------------------
R7JGW9          -------------QNLGNGLASTRRSIIATLDSY--------------------------
A0A3D2BF46      -------------QDFDSELAALRRAIIASLQSH--------------------------
A0A358R538      -------------GEMDRELAAVRRSILASLDSH--------------------------
A0A1Y4AAB8      -------------QELDNNLAAVRRSIIASLDSH--------------------------
A0A1Y3WWY9      -------------RDLDNLLAAIRRTIIASLDSH--------------------------
A0A1Y4U5L4      -------------RDLDNLLAAIRRTIIASLDSH--------------------------
A0A1Y3VCJ1      -------------RNLDNLLASIRRAIIASLDSH--------------------------
A0A1Y3QTW7      -------------QDMDNVLAAVRRSIIASLNSH--------------------------
R6XWY7          -------------QDMDNVLAAVRRSIIASLNSH--------------------------
A0A4Y1X9Y9      -------------QDMDNVLAAVRRSIIASLNSH--------------------------
A0A4Y1WM66      -------------QDMDNVLAAVRRSIIASLNSH--------------------------
A0A174AVF1      -------------QDMDNVLAAVRRSIIASLNSH--------------------------
A0A656Q4F4      -------------QDMDNVLAAVRRSIIASLNSH--------------------------
A0A1Q6EIY0      -------------QDLDNGLAAVRRSIIASLNSH--------------------------
A0A5B5VN71      -------------QDLDNGLAAVRRSIIASLNSH--------------------------
E4M8L3          -------------QDLDNGLAAVRRSIIASLNSH--------------------------
I3YQ50          -------------QDLDNGLAAVRRSIIASLNSH--------------------------
R5UEY8          -------------QDLDNGLAAVRRSIIASLNSH--------------------------
A0A1H4D866      -------------QDLDNLLASVRRSIVASLDSH--------------------------
A0A5B3G4Y7      -------------QDLDNLLAAVRRSIISSLDSN--------------------------
A0A374A9J5      -------------QDLDNLLAAVRRSIISSLDSN--------------------------
A0A5B3GQN5      -------------QDLDNLLAAVRRSIISSLDSN--------------------------
A0A1Q6E9S3      -------------QDLDNLLAAVRRSIISSLDSN--------------------------
D4IJ36          -------------QDLDNLLAAVRRSIISSLDSN--------------------------
A0A414Q925      -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
A0A415PUS9      -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
A0A108TCU0      -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
A0A413BA42      -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
S3Y344          -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
A0A4Q5G8Y8      -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
A0A412TGL3      -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
A0A413VJ33      -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
A0A414L0W6      -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
A0A412DP39      -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
A0A413ZSE8      -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
B0NP84          -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
R6AK43          -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
A0A412N2D9      -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
A0A1Y4JYS9      -------------RDLNGTLMSMRLSIAKAVDNL--------------------------
R6LHA4          -------------RDLNGTLMSIRLSIAKAVDNL--------------------------
A0A3E5HPT8      -------------QELNRIMQTMKQNIYMAVDNL--------------------------
C6IJ48          -------------QELNRIMQTMKQNIYMAVDNL--------------------------
Q8A3U2          -------------QELNRIMQTMKQNIYMAVDNL--------------------------
A0A3R6S1H6      -------------QELNGSLSAMRQTIVRTVDNL--------------------------
A0A3R6SD81      -------------QELNGSLSAMRQTIVRTVDNL--------------------------
A0A354WXN6      -------------QDLNNSLNAMRQTIIRSIDNL--------------------------
R5IP14          -------------IDLNQTLSTMRNSIIQSIDNL--------------------------
A0A316SZX7      -------------QDLNSSLVSMRKSLLRSVDNL--------------------------
A0A1Y4AIY1      -------------MDLNNSLSAMKQTIIRSVDNL--------------------------
A0A0J6CIR2      -------------MDLNNSLSAMKQTIIRAIDNL--------------------------
A0A3D8HG59      -------------MSLNSSIQAMKQTIVRSVDNL--------------------------
A0A3R6S408      -------------MSLNSSIQAMKQTIVRSVDNL--------------------------
F3ZRU7          -------------SDLNKSLFAMEQTINRSVDNV--------------------------
A0A1C5Q1F3      -------------MDMNNSLASMKQTIVRTVDNL--------------------------
R7A239          -------------MDMNNSLASMKQTIVRTVDNL--------------------------
A0A3R6HIK7      -------------MDLNNSLSAMKQSIIRSVDNL--------------------------
K5ZVW7          -------------MDLNNSLSAMKQSIIRSVDNL--------------------------
A0A1Y4D5Z0      -------------MDLNNSLNALKQTIIRSVDNL--------------------------
A0A413VXJ7      -------------IDLNNSLAAMKQTIIRSVDNL--------------------------
I9RSN9          -------------IDLNNSLAAMKQTIIRSVDNL--------------------------
U6RJK5          -------------IDLNNSLAAMKQTIIRSVDNL--------------------------
A0A1Q6GA32      -------------IDLNNSLAAMKQTIIRSVDNL--------------------------
I9RPU6          -------------IDLNNSLGAMKQTIIRSVDNL--------------------------
I8YFS5          -------------IDLNNSLGAMKQTIIRSVDNL--------------------------
A0A6H9LTF8      -------------IDLNNSLGAMKQTIIRSVDNL--------------------------
I8Y597          -------------IDLNNSLGAMKQTIIRSVDNL--------------------------
A0A1Q6GBF5      -------------MDLNNSLSAMKQTIIRSVDNL--------------------------
I8YFZ3          -------------MDLNNSLSAMKQTIIRSVDNL--------------------------
A0A6H9M1J1      -------------IDLNNSLSAMKQTIIRSVDNL--------------------------
A0A1Q6GDH2      -------------IDLNNSLSAMKQTIIRSVDNL--------------------------
U6RSB0          -------------IDLNNSLSAMKQTIIRSVDNL--------------------------
I9GXM2          -------------MDLNNSLSAMKQTIIRSVDNL--------------------------
I9SIK1          -------------MDLNNSLSAMKQTIIRSVDNL--------------------------
A0A6H9LZ74      -------------MDLNNSLGAMKQTIIRSVDNL--------------------------
I9TP59          -------------MDLNNSLGAMKQTIIRSVDNL--------------------------
R5S343          -------------ADMNRSLLAMKQTIVNTMDNL--------------------------
A0A1M6K7I9      -------------MDLNNSLGAMRQSILRSVDNL--------------------------
A0A5M6A8C8      -------------MDLNNSLGAMRQSILRSVDNL--------------------------
A0A6H9LT84      -------------IDLNNSLSAMKQTIIRSVDNL--------------------------
A0A6H9LUV5      -------------IDLNNSLGAMKQTIIRSVDNL--------------------------
A0A3R5ZMK1      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A3E4ZTK7      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A1Y3ZIA4      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
K5Y1A4          -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A4Q5CIT0      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A3R6K8X4      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A414GI87      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A415BDM7      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A412DM15      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A7AEU7          -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A1Q6I3T6      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A414XX40      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A3R6BKI7      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A414LPI6      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A412M2W1      -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
K5ZX55          -------------QDLNNSLIAMKQTIIRSVDNL--------------------------
A0A5F0U645      -------------MDLNNSLGAMKQTIIRAVDNL--------------------------
K5ZBN2          -------------MDLNNSLGAMKQTIIRAVDNL--------------------------
A0A0J6CKW3      -------------MDLNNSLGAMKQTIIRAVDNL--------------------------
A0A0F5IQM7      -------------MDLNNSLGAMKQTIIRAVDNL--------------------------
A0A496CDT3      -------------MDLNNSLGAMKQTIIRAVDNL--------------------------
A0A6G1ZKM3      -------------MDLNNSLGAMKQTIIRAVDNL--------------------------
S0GLB0          -------------MDLNNSLGAMKQTIIRAVDNL--------------------------
A0A3R6NLC1      -------------MDLNNSLGAMKQTIIRAVDNL--------------------------
A0A416WYC9      -------------MDLNNSLGAMKQTIIRAVDNL--------------------------
A0A0F5IT40      -------------MDLNNSLSAMKQTIIRAIDNL--------------------------
A0A496CX20      -------------MDLNNSLSAMKQTIIRAIDNL--------------------------
A0A5F0UBI0      -------------MDLNNSLSAMKQTIIRAIDNL--------------------------
A0A6G1ZHG0      -------------MDLNNSLSAMKQTIIRAIDNL--------------------------
S0GSI7          -------------MDLNNSLSAMKQTIIRAIDNL--------------------------
K5YB65          -------------MDLNNSLSAMKQTIIRAIDNL--------------------------
A0A0F5IWP9      -------------MDLNNSLGAMKQTIIRAIDNL--------------------------
A0A0F5IZT8      -------------MDLNNSLGAMKQTIIRAIDNL--------------------------
A0A417LKQ2      -------------MDLNNSLNAMKQTIIRAVDNL--------------------------
A0A416TME1      -------------MDLNNSLNAMKQTIIRAVDNL--------------------------
A0A416XPE8      -------------MDLNNSLNAMKQTIIRAVDNL--------------------------
A0A3B0C2S4      -------------VTLSGQLENLKVNILRSLNVY--------------------------
L8JI02          -------------EVVDRRIRNTKNTLQENVQNI--------------------------
A0A4Q5WS95      -------------QALDEQIDKLRPSILDNIRSQ--------------------------
A0A501VZX6      -------------LTLAEEIQNVRPGILENIQNQ--------------------------
A0A399SH26      -------------LSIADEIEKIRPSILENIQNQ--------------------------
A0A501W1A9      -------------LSLREEIESIRPGILENIRNQ--------------------------
A0A0E3ZGV6      -------------VSLREEIESIRPGILENIRNQ--------------------------
A0A1I2N4S1      -------------ISLREEIDNMRPGVLENIRNQ--------------------------
A0A2T5YE44      -------------ASLREEIDNMRPGVLENIRNQ--------------------------
A0A1V9FHD0      -------------IELAKVIEQTRPMILEKLRMH--------------------------
A0A4V4H170      -------------IAVAKEIEQLRPLIAEKLRSH--------------------------
A0A1V9F098      -------------TAIAKEIEQIRPIILEKLRAQ--------------------------
A0A4R2VU64      -------------IALAKEIEQLRPLILDKLKSQ--------------------------
A0A4S8HY23      -------------IEVAKEIEQTRPLILEKLRSH--------------------------
A0A1V9F383      -------------VGVAKEIEQLRPLVLEKLKNY--------------------------
G8TRZ6          -------------TSAAKEIEALRPLVLEKLRNY--------------------------
A0A543WA52      -------------VSIANEIEKIRPSILENIRNQ--------------------------
A0A1M5BA90      -------------FSLEAEIDNMRPAILENIQNQ--------------------------
A0A512B879      -------------FSLRNEIDKMKPTILENIQNQ--------------------------
A0A559PPI3      -------------TSLADEINKIRPNILDNVQSQ--------------------------
A0A1T5CS78      -------------TSISNQISKIRPSILENVKSQ--------------------------
A0A0Q9Z8F1      -------------TSISNQISKIRPSILENVKSQ--------------------------
A0A2N0U0M7      -------------TSISNQISKIRPSILENVKSQ--------------------------
A0A2N3U785      -------------VNLNDQLSNLEVNILENLRNI--------------------------
A0A0D3L8Q3      -------------MNLSEQLTDLRQNILENLSNI--------------------------
A0A0E3ZG78      -------------KNLNEQLANIRSSILENLRNI--------------------------
A0A1I6BRK6      -------------QNTNEQLADLRVNILETLRNI--------------------------
A0A243WAB1      -------------QNLNEQLANLRINILENLRNI--------------------------
A0A6G8C8X6      -------------LNLNEQLDNLRTNILENLRNI--------------------------
A0A5B6TJH8      -------------QNINEQLANLRVNLLENLRNI--------------------------
A0A519U664      ------------------------------------------------------------
A0A519UDD1      -------------QNVNEQLANLRANTLENLRNI--------------------------
A0A519MA34      -------------KNIDEQITNLQNNILENLQNI--------------------------
A0A519UCX0      -------------NNTNEQIANLRANILENLQNI--------------------------
A0A4R5DL69      -------------QNLDLQLKRIREEIIQHIESK--------------------------
A0A1M4YED3      -------------VATQNEIDRLRPAILDNVRNQ--------------------------
A0A2H3NSN0      -------------DQV--RELSQIKRQIEGLEDR--------------------------
A0A2P6C324      -------------SRV--RELAEIKRRIDGFEDR--------------------------
A0A1M6XHU0      -------------EKLGDQQLVEIVRQIDHFEKQ--------------------------
A0A5S9C8G0      -------------EKLGDQQLVEIVRQIDHFEKQ--------------------------
G2SF81          -------------EKLGDQQLVEIVRQIDHFEKQ--------------------------
A0A5S9EYW1      -------------EKLGDQQLVEIVRQIDHFEKQ--------------------------
D0MHQ9          -------------EKLGDQQLVEIVRQIDHFEKQ--------------------------
A0A126PFG0      -------------NPLNSEILATQLAIRSSVKNI--------------------------
A0A3M1N7Z3