BYKdb

Dataset for cluster orphancd of phylum armatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7C7KXP9      ------------------------------------------------------------
A0A3C0CSI4      ------------------------------------------------------------
A0A402CP56      MQSEPLLIESEESQPVMSPQDYVSILRRRRNTIVTTWILISAFGIIVTMATRNVYQATAK
A0A7C2GZA4      MTQQKPTPKAGVPQHESDWLLYLWMISRRWPLLLLTTVIVLGAAIGYSRFVPPVYEANSL
A0A7C2JN73      MTQQKPTPKAGVPQHESDWLLYLWMISRRWPLLLLTTVIALGAAIGYSRFVPPVYEANSL
A0A7C2X570      MTQQKPTPKAGVPQHESDWLLYLWMISRRWPLLLFTTVIALGAAIGYSRFVPPVYEANSL
A0A7C2MZ04      ------------------------------------------------------------
A0A7C6TC25      ------------------------------------------------------------
                                                                            

A0A7C7KXP9      ------------------------------------------------------------
A0A3C0CSI4      ------------------------------------------------------------
A0A402CP56      L-LVDGPSMMVSQVESDNNLASLFNIGSEQ-------TVDTKVEELQAGPLINTVDKLSN
A0A7C2GZA4      VRMRKSPPLQVFGTNQPTPEEENLNLNTAAQLVTTYLTAQEAQELLQKPPLRDKVSQATR
A0A7C2JN73      VRMRKSPPLQVFGTNQPTPEEENLNLNTAAQLVTTYLTAQEAQELLQKPPLRDKVSQATR
A0A7C2X570      VRMRKSPPLQVFGTNQPTPEEENLNLNTAAQLVTTYLTAQEAQELLQKPPLRDKVSQATR
A0A7C2MZ04      -------FEQILCKTADPLDIEGCILTRAAQIERRTPSVPKEEEDFEQDIQGRLIE----
A0A7C6TC25      -------------------------------------------------ALSVTIE----
                                                                            

A0A7C7KXP9      ------------------------------------------------------------
A0A3C0CSI4      ------------------------------------------------------------
A0A402CP56      H----------AKLTVTAVKGTNVIDIVGESTDKVAAAAAPNTLIQLYLQTTAETDLQEV
A0A7C2GZA4      EYLRLLAPQEILEFTRTTPIEPDLVRITVHHPLPEVAAALANGLAEAFVQRLNRETRAEA
A0A7C2JN73      EYLRLLAPQEILEFTRTTPIEPDLVRITVHHPLPEVAAALANGLAEAFVQRLNRETRAEA
A0A7C2X570      EYLRLLAPQEILEFTRTTPIEPDLVRITVHHPLPEVAAALANGLAEAFVQRLNRETRAEA
A0A7C2MZ04      --------------------DTGLIELFAEARSPRRAQDAANAAALLVVWQNERLRKEEA
A0A7C6TC25      --------------------EPDILAISVEHTDPGRAALIANVIQDAYIQQNTALARSET
                                                                            

A0A7C7KXP9      ------------------------------------------------------------
A0A3C0CSI4      ------------------------------------------------------------
A0A402CP56      HKAQKFAQKQMTD---AQARLDKANRALELLKQKHGFVDIAKSRDDQIARVSSLTQQLQQ
A0A7C2GZA4      SNERQFIENQLKA---IEGQLRQLDTTIAQVYRQLKAVDVSAETKSIIDAVRTYTADLLT
A0A7C2JN73      SNERQFIENQLKA---IEGQLRQLDTTIAQVYRQLKAVDVSAETKSIIDAVRTYTADLLT
A0A7C2X570      SNERQFIENQLKA---IEGQLRQLDTTIAQVYRQLKAVDVSAETKSIIDAVRTYTADLLT
A0A7C2MZ04      RNTVRFIRNQLEAPGGVKQQLAEADEKLASFQREKAFLDANEQIRALMQQMVELSNRQWQ
A0A7C6TC25      TSAKQFLESQMEV---LKQDMQRIEGEIRRFKARHNIPDSVAQAAAATAPMSESGVSLVE
                                                                            

A0A7C7KXP9      ------------------------------------------------------------
A0A3C0CSI4      -----------------------------------------QEIDKLNSTRAELL--QEY
A0A402CP56      ARAELAGARAQVSGLSNLVSAEPATLDVQLRQTNTEIAEIKSKITQRELDRRQMTLPGGF
A0A7C2GZA4      VESELRSLNASIAKLRETAARQGPVISVEVLKEDPAVTELQRQLATLEVDRANLV--ARY
A0A7C2JN73      VESELRSLNASIAKLRETAARQGPVISVEVLKEDPAVTELQRQLATLEVDRANLV--ARY
A0A7C2X570      VESELRSLNASIAKLRETAARQGPVISVEVLKEDPAVTELQRQLATLEVDRANLV--ARY
A0A7C2MZ04      GNLRLTDLRTRLAATRQRLGQEPSTLVSPTIYENPTVQEIKKQLVTAEADLLALQ--AQF
A0A7C6TC25      TQMAVLAAEAELAGLRRRLASVSPTRRVQRAVEDPVLDGLRQAVVETEVELARAQ--SRY
                                                                            

A0A7C7KXP9      ----------MDRITKALELAREKRAAVGGGHAAALQP---------AVLAGDMTHGLVR
A0A3C0CSI4      IPSSREVKKVDGQIEDAEQRLKKVAQTVLSTTTNSRNPLWENLLKDFSGSIAESSALDTK
A0A402CP56      TAKAPQVRALDSEIAGLKSQLAA-LPAVSTTMTSNPNTVRENLRAKVASSEGDVASLEAR
A0A7C2GZA4      TPEHPLVKEVDARIAALRQTISQRLGRVVKGSETVPNPNYTTLQQHLMDLETRRLSAEAR
A0A7C2JN73      TPEHPLVKEVDARIAALRQTISQRLGRVVKGSETVPNPNYTTLQQHLMDLETRRLSAEAR
A0A7C2X570      TPEHPLVKEVDARIAALRQTISQRLGRVVKGSETVPNPNYTTLQQHLMDLETRRLSAEAR
A0A7C2MZ04      TDEHPRVQSALARVESLRERLRQEAARIESVQ-RLPNPVHQELYKNVALLSADIVGQEAQ
A0A7C6TC25      ADTHQRVLAIKDELERLRGLVQERAAQATVTEVEEPNPLYIALEERIREGEIQVEVQRAR
                             :                      :.                    ..

A0A7C7KXP9      EVEISPEFLREQKVIAGF------------------------------------------
A0A3C0CSI4      VQVLNRCLVQREMDFKVL-PELERELTTRIQNIAILERTYDMLSQKYYTLLLSEQSMLPN
A0A402CP56      VLETQTLLEQAKSELATY-PSLEAPAEQYQNEHDTALASYQMYATTLQNLNLREQARHVS
A0A7C2GZA4      RQALLSLLQQTQKQIEQL-PEDRRKIGELNRRLQVLEQAYTNLLGRLQDAQIREASRLGN
A0A7C2JN73      RQALLSLLQQTQKQIEQL-PEDRRKIGELNRRLQVLEQAYTNLLGRLQDAQIREASRLGN
A0A7C2X570      RQALLSLLQQTQKQIEQL-PEDRRKIGELNRRLQVLEQAYTNLLGRLQDAQIREASRLGN
A0A7C2MZ04      MRALEETLRSIRQQMLAV-PELEKQLTRLLRQRQALEKRYLFLMERLQEAELTQAVKLGN
A0A7C6TC25      AEALASAAAKQDPATPGKDPKAFMELVALGRAKEIAERTYGQLLEQLQQVRLNEAQQQGT
                                                                            

A0A7C7KXP9      ------------------------------------------------------------
A0A3C0CSI4      GILISKPRVPEAPSYPRTDRNIALFAMLGIMLSVVVAIVVDRMDIRVHDPSVMAGIADLP
A0A402CP56      AHVIEPAVVPTEPIRPKRLLNFLFAIIMGGVIGILMALLQEYLDDRLNSTEDAERLLGLP
A0A7C2GZA4      AMIADVATVPQRPVAPNLPRLLLLALLVGLAAGVVLALSLELSKATVETTEEVRHLLGAP
A0A7C2JN73      AMIADVATVPQRPVAPNLPRLLLLALLVGLAAGVVLALSLELSKATVETTEEVRHLLGAP
A0A7C2X570      AMIADVATVPQRPVAPNLPRLLLLALLVGLAAGVVLALSLELSKATVETTEEVRHLLGAP
A0A7C2MZ04      ARVVELAQLPGKRVKPRRILNMLMGTVLGALLAIGFALLLEQIDRRVPSAQQASEWLNAP
A0A7C6TC25      ARKVDIAEVPERPVHPTPQRTLAIAALLGLVAGLSLALLQELADTGVRDPDELLMRTGIS
                                                                            

A0A7C7KXP9      ----------------------KDQPLADSYRLLRTRLLQRMRQNGWTTLGITSTAPNAG
A0A3C0CSI4      SLASIPFMDNEDAAYKQIGKLKHNSIFLESFRILRNNIMFSAIDNPLKVLAVSSPGPGEG
A0A402CP56      SLGRVPQLSRD--DALLLSNMSGPHPELEAYKTLRTNIHFAAIDTPFRSLQVTSSSPGEG
A0A7C2GZA4      VLGLIPQTRQGLTQTQIVELMRSQRRTAETIRTIRSNLKFLSRKRPFRTLLISSAISGEG
A0A7C2JN73      VLGLIPQTRQGLTQTQIVELMRSQRRTAETIRTIRSNLKFLSRKRPFRTLLISSAISGEG
A0A7C2X570      VLGLIPQTRQGLTQTQIVELMRSQRRTAETIRTIRSNLKFLSRKRPFRTLLISSAISGEG
A0A7C2MZ04      LLGSIPAVRDG-AESPVLN----QPAAVEAFRNLRTTLRLSSQSAPIHALMVTSPSPGDG
A0A7C6TC25      SLGFIPATRDT-GRTIKIAARSPRSPITESFRTIRSNLKFAHLDSPLHTMMVTSAGAGEG
                                            :: . :*. :     .     : ::*. .. *

A0A7C7KXP9      KTLTAINLGVAIAMDSNHSVLLVDVDLRKPDVHKVLGVTPEYGLVEYLTSNISLADVLIS
A0A3C0CSI4      KSTLAVNLAIAMA-MDGKKVLLVDCDLRRPSIHNWMSLSREIGLTNVVKGLSNIKDAVCS
A0A402CP56      KTTTATNLAYAMA-ADGKRVILIDTDLRRPSVHKHLDLAQTPGITELLVGDATLHEALQV
A0A7C2GZA4      KTFLAAALGIAYA-NAGYRVILVDADMRHPDMHRHFHLTDGIGLREVLDGTVTLDEALRA
A0A7C2JN73      KTFLAAALGIAYA-NAGYRVILVDADMRHPDMHRRFHLTDGIGLREVLDGTVTLDEALRA
A0A7C2X570      KTFLAAALGIAYA-NAGYRVILVDADMRHPNMHRRFHLTDGIGLREVLDGTVTLDEALRA
A0A7C2MZ04      KTFVSRHLAVSIA-QSGQRVVLIDADLRLSMQHRFEGIPLSPGLSNILLGESKLEECLRQ
A0A7C6TC25      KSFTATNLAIVLA-QAGVDTLLVDADLRRPTLHRIFGIQRTPGLTTVLTGETPLHEAIQA
                *:  :  *.   *   .  .:*:* *:* .  *.   :    *:   : .   : : :  

A0A7C7KXP9      PG-IERFVFLPCVEKTQGTSELLATKKMAHLVAQMKVQSPSRIVIFDLPPILVGDDVVAF
A0A3C0CSI4      TD-IENVFCLPSGPLPPNPTEFLNSKHSRNIIKELSGMYD--MLILDCPPCTGLSDVQVI
A0A402CP56      SPNFPNLSVLAAGTIPPNPSELLNSQKFRTLVDQLSARFD--IIIFDSAPVLAVADAQIV
A0A7C2GZA4      GP-LPNLWLLPAGTPPPSPSELLDNPTMQRLLGALKERAD--IVLLDSPPILPVTDATVL
A0A7C2JN73      GP-LPNLWLLPAGTPPPSPSELLDNPTMQRLLGALKERAD--IVLLDSPPILPVTDATVL
A0A7C2X570      GP-LPNLWLLPAGTPPPSPSELLDNPTMQRLLGALKERAD--IVLLDSPPILPVTDATVL
A0A7C2MZ04      AG-VDNLWLLPAGDVPPNPTELLESARMEEILAQLREQYD--MLIMDVPPVEMFADARVL
A0A7C6TC25      TD-VANLRIIPSGSVPPNPAELLDSRRMRQLIEEMKEIAE--IVIFDTPPALVVTDAVVL
                   . ..  :..   . ..:*:* .     ::  :       ::::* .*     *.  .

A0A7C7KXP9      SSNLDAVLIVVEDG-KTDSRHLARAAELLD--GTHLIGAVLNKSREPVA-----EHYGHY
A0A3C0CSI4      STMADGVLLVVTIN-RTLKTYLHMALSTLSQVKAPIIGYVLNMVDSRR------QGYGYY
A0A402CP56      ASQADGVVLVVANG-ETRKAAAKQGLNLLRRARANVIGVAFNKMNVK-------DNMYYY
A0A7C2GZA4      APIVDGMVLVISAG--TPRAALLKAREQLELAEAPLLGVVMNKVTPK-------NTRGYY
A0A7C2JN73      APIVDGMVLVISAG--TPRAALLKAREQLELAEAPLLGVVMNKVTPK-------NTRGYY
A0A7C2X570      APIVDGMVLVISAG--TPRAALLKAREQLELAEAPLLGVVMNKVTPK-------NTRGYY
A0A7C2MZ04      ALHSDAILMVLQPGATLRDAALHAVETIHTVPEARFLGIVANRVPVST------NSYGPY
A0A7C6TC25      SPRVDAMVLVVEQG-RVTSRALAEIRRMVEQARGKIAGAVFNKVKSGASGYYHYNYYRYY
                :   *.:::*:  .                     . * . *            :    *

A0A7C7KXP9      GY------------------------------------
A0A3C0CSI4      YNYDYDEQGGRNKSKRRCCMPKSKN-------------
A0A402CP56      RYTAETSTEALPGRNGHSTRQIETEGTKK---------
A0A7C2GZA4      YYGYYDSVD-----------------------------
A0A7C2JN73      YYGYYDSVD-----------------------------
A0A7C2X570      Y--YYDSVD-----------------------------
A0A7C2MZ04      YPSVRRRGS-----------------------------
A0A7C6TC25      YYGDRSPGDGQQHPPAAPLTAVDNGRDLSRSKGPDEEA
                                                      

© 1998-2021Legal notice