BYKdb

Dataset for cluster orphancd of phylum actinobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

255 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A1Q2CI19      ------------------------------------------------------------
A0A512T3M3      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A543PXP1      ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A1H6WL79      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A0A4Y3NEG0      ------------------------------------------------------------
A0A6I2XCV4      ------------------------------------------------------------
A0A5R8VLL6      --MGPRHCLINREPGRRVACCRYPQFPHSSPRAPTSSRLYQTSTFGRVLAWQHAEAAPDT
A0A538JQF8      ------------------------------------------------------------
A0A1H6YPK1      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A0Q9TBP0      ------------------------------------------------------------
A0A5Q2FA83      ------------------------------------------------------------
A0A346XTB0      ------------------------------------------------------------
A0A0G3V3M7      ------------------------------------------------------------
A0A6I3DD56      ------------------------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A6I1G2U1      ------------------------------------------------------------
A0A351ETF8      ------------------------------------------------------------
A0A542FTE6      ------------------------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A2S5UYV0      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A653YMF0      ------------------------------------------------------------
A0A346Y185      ------------------------------------------MEAVCLFCWQLWQGSQLE
A0A259S8H9      ------------------------------------------------------------
A0A0Q5L115      ------------------------------------------------------------
A0A2W1Z497      ------------------------------------------------------------
A0A4V1VGV9      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
A0A4U0RJZ4      ------------------------------------------------------------
A0A4R1FGL9      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A7D7WDT9      ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A6P1F176      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A4R6Q3C6      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
D8USQ4          ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A6J4MTQ2      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A6L5R0V7      MPASVASETIREASCSAECAETTRCSGSFDSLPLPMLAVSVIVGSARSSTRSIQWPRIRS
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A6L6AM03      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A6G8FYB9      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ----------------------------------------------MPIDEDQRQGEGLR
A0A3L8NYD3      ------------------------------------------MEAAR---------VTVV
A0A1M6K628      ------------------------------------------MAIARRKPRTGRDILDLV
A0A561E8R3      --------------------------------------------------------MTVT
A0A3E2DN22      --------------------------------------------------------MTIV
A0A3Q9ULZ9      --------------------------------------------------------MTVI
A0A3S9JFL2      --------------------------------------------------------MTVI
A0A3L7ADK2      ------------------------------------------MDAETNPDIVNDNDRSLR
A0A1Q2CI19      --------------------------------------------------------MSLK
A0A512T3M3      --------------------------------------------------------MTLR
W6JTW4          --------------------------------------------------------MPLR
A0A0A0JTY0      --------------------------------------------------------MTLQ
A0A0A0JXF2      --------------------------------------------------------MTLQ
E6S8H2          --------------------------------------------------------MTLS
A0A0A0JGH0      --------------------------------------------------------MTLQ
N0E4U7          --------------------------------------------------------MTLR
A0A0A0IYK2      --------------------------------------------------------MTLQ
A0A0Q9L0H3      --------------------------------------------------------MTLQ
A3TMK0          --------------------------------------------------------MTLQ
A0A543PXP1      --------------------------------------------------------MTLK
A3TMH6          --------------------------------------------------------MTLN
A0A1H6WL79      -----------------------------------------MERTTQLLQDDKPQGMSGN
A0A101LAM5      --------------------------------------------------------MSGN
A0A4Y3NEG0      -----------------------------------------------MLQDDKPQGMSGN
A0A6I2XCV4      ------------------------------MSTPETPQDFSRANSSPNQPDLFGSSTALR
A0A5R8VLL6      GNHEKGEVMAEEEFFRTGPVAPGPFAMPAHSARQPAGGIGSLSNPEIGGSEASAAGMGVS
A0A538JQF8      -----------------------------------------------------------M
A0A1H6YPK1      --------------------------------------------------------MEFR
A0A2R7MGI0      ----------------------------------------------------------MQ
A0A2T7WQY4      --------------------------------------------------------MDMQ
A0A1G6GTN3      ----------------------------------------------------------MQ
A0A1N7DLV3      ----------------------------------------------------------MQ
A0A1V2NSB5      ----------------------------------------------------------MQ
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ----------------------------------------------------------MQ
A0A0Q5JKD6      ------------------------------------------------------------
A0A0Q9TBP0      ------------------------------------------------------------
A0A5Q2FA83      --------------------------------------------------------MQFR
A0A346XTB0      ---------------------------------------------------MEEQLRRGP
A0A0G3V3M7      --------------------------------------------------------MRPA
A0A6I3DD56      --------------------------------------------------------MRPA
A0A2W6DK08      --------------------------------------------------------MGIK
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A6I1G2U1      ------------MGFVRDKPVHRVGIDSRVGGRSVDAAHERFEHELMGDARGADTTMNAR
A0A351ETF8      -----------------MSAAVVGVRPVNVAELQHVRGSFCMAEQPSNQDSSSLAVLDLR
A0A542FTE6      --------------------------------------------MASTVDEQITPTLDLR
A0A349B7N2      ------------------------------------------------------------
A0A2S5UYV0      --------------------------------------------------------MTVL
A0A2S5X9U6      --------------------------------------------------------MTVL
A0A2S5ULV5      --------------------------------------------------------MTVL
A0A653YMF0      --------------------------------------------------------MTVL
A0A346Y185      RTSRWRGGSSWGQRRKACGSSLRVVRVSAEVRGGVHLLEAHRSGRLNPMDSLQAPATSVE
A0A259S8H9      ----------------------------------------------------------ML
A0A0Q5L115      -------------------------------------------MDRPDTEPRPRTL-DLQ
A0A2W1Z497      --------------------------------------------MAPDARPDERTSRTLA
A0A4V1VGV9      --------------------------------------------------------MTAL
A0A3Q9IY80      --------------------------------------------------------MELR
A0A0F0LP73      --------------------------------------------------------MTVL
A0A1F1X071      --------------------------------------------------------MTIE
A0A3R8RWC7      --------------------------------------------------------MTIE
A0A4U0RJZ4      --------------------------------------------------------MTIL
A0A4R1FGL9      --------------------------------------------------------MTIL
E3B8H1          --------------------------------------------------------MTIL
A0A7D7WDT9      ----------------MRQHRVATSGLRYDGVVYERLRAQGQGAPLSVSSVRGFARVTVL
A0A0Q5AWK6      --------------------------------------------------------MTVV
A0A6P1F176      --------------------------------------------------------MTVV
A0A3N1NLD3      --------------------------------------------------------MTVV
A0A3N2FVI8      --------------------------------------------------------MTVV
A0A2S5XDQ6      --------------------------------------------------------MTVV
A0A2S5XNN6      --------------------------------------------------------MTVV
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      --------------------------------------------------------MTIR
A0A2Y8ZRF8      --------------------------------------------------------MTIR
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ---------------------------------MNDRRYGLDLSPVRDEEQGLDMAELAS
A0A3S0V9U6      --------------------------------------------------------MTLL
A0A1S2N0P2      --------------------------------------------------------MTLL
A0A0Q3BEY5      --------------------------------------------------------MTLL
A0A4R6Q3C6      --------------------------------------------------------MTLL
A0A2X3GKL3      --------------------------------------------------------MTLL
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      --------------------------------------------------------MSLS
A0A542HCT5      -----------------------MPQTNPKGAERPLASVLLHFALLGGALRGEFIGVELT
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      --------------------------------------------------------MDLR
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ---------------------------------------------------MVLDGVTVR
A0A0Q5M6Z7      ----------------------------------------------------------MR
A0A3N3ZPU0      -------------------------------------MPQQDTSDEQYLDAPVHIAHRLR
A0A359IQX7      --------------------------------------------MLRVGTLETGRPMTLL
A0A433EDP2      --------------------------------------------------------MTIL
A0A231VTW0      --------------------------------------------------------MTIL
A0A433ECD0      --------------------------------------------------------MTIL
U7V3Z1          --------------------------------------------------------MTIL
A0A1F1J417      --------------------------------------------------------MTIL
A0A2A8D6P2      --------------------------------------------------------MTIL
A0A1F0THV9      --------------------------------------------------------MTIL
A0A5F0M6Y0      --------------------------------------------------------MTIL
D8USQ4          --------------------------------------------------------MTIL
E3H5W1          --------------------------------------------------------MTIL
A0A1F1QKB0      --------------------------------------------------------MTIL
A0A509JY23      --------------------------------------------------------MTIL
A0A448USF4      --------------------------------------------------------MTIL
A0A0Q9LZR0      --------------------------------------------------------MELT
A0A1N7E3F1      --------------------------------------------------------MELL
A0A544ZKQ1      --------------------------------------------------------MELL
A0A372P1T1      --------------------------------------------------------MELL
A0A5D0Q2X0      --------------------------------------------------------MELL
A0A5R8Z2E7      --------------------------------------------------------MELL
A0A1L2ZMV4      -------------------------------------------MEYTAENQPQALNHQVR
A0A6I3F378      ------------------------------------------------MEPQLTPARTLG
A0A1E9T6I0      --------------------------------------------------------MTIL
A0A1S1CQC5      --------------------------------------------------------MTIL
A0A1S1CAD0      --------------------------------------------------------MTIL
G5ET14          --------------------------------------------------------MTIL
A0A1E9DXX2      --------------------------------------------------------MTIL
A0A1E8S156      --------------------------------------------------------MTIL
A0A1E8S5S2      --------------------------------------------------------MTIL
A0A1S1DFA8      --------------------------------------------------------MTIL
A0A2I1Z490      --------------------------------------------------------MTIL
A0A1F0DAA9      --------------------------------------------------------MTIL
A0A1F0PHK9      --------------------------------------------------------MTIL
A0A1F0VZG6      --------------------------------------------------------MTIL
A0A1E9G8X4      --------------------------------------------------------MTIL
A0A1E9IAW2      --------------------------------------------------------MTIL
A0A1E9ZBC9      --------------------------------------------------------MTIL
A0A1E9ZDP4      --------------------------------------------------------MTIL
A0A1F0R6B5      --------------------------------------------------------MTIL
A0A1F0Z7N5      --------------------------------------------------------MTIL
A0A1F1D897      --------------------------------------------------------MTIL
D2NP38          --------------------------------------------------------MTIL
A0A1F1FV74      --------------------------------------------------------MTIL
A0A1E9M791      --------------------------------------------------------MTIL
A0A291DEI8      --------------------------------------------------------MTIL
A0A1S1D5T1      --------------------------------------------------------MTIL
A0A1E8TRD6      --------------------------------------------------------MTIL
A0A1F0XT88      --------------------------------------------------------MTIL
A0A1F1EVP5      --------------------------------------------------------MTIL
C6R548          --------------------------------------------------------MTIL
A0A0K2RXS2      --------------------------------------------------------MTIL
A0A1F0KX60      --------------------------------------------------------MTIL
A0A542I3V2      -----------------------------------------MTGKHEVNSDESAAGMGVR
A0A2T0UZ65      --------------------------------------------------------MTFL
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      --------------------------------------------------------MELQ
A0A542XE74      --------------------------------------------------------MTIL
A0A0G3V3F3      --------------------------------------------------------MDLA
A0A0Q7QDF6      --------------------------------------------------------MTSR
A0A5R8L819      ----------------------------------------------------MRSVVELG
A0A261FQA1      --------------------------------------------------------MSIA
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      --------------------------------------------------------MDVR
A0A4Y8WZJ3      -------------------------------------------------MAPAPPVMSLS
A0A285VUW0      --------------------------------------------------------MSVR
A0A2R7Z032      --------------------------------------------------------MTFA
A0A6J4MTQ2      --------------------------------------------------------MTFG
A0A1I0W453      --------------------------------------------MVGGGAPPRLAGMTFG
A0A1H4LCS9      --------------------------------------------------------MTFG
A0A4Q2RZP8      --------------------------------------------------------MTFG
A0A0Q6VV12      --------------------------------------------------------MTFG
A0A495NTA9      --------------------------------------------------------MTFG
A0A0Q9QB08      --------------------------------------------------------MTFG
A0A4Q2SA86      --------------------------------------------------------MTFG
A0A4Z1C3Z0      --------------------------------------------------------MTFG
A0A542J310      --------------------------------------------------------MELR
A0A4Q2JUT1      ----------------------------------MDPTRSWSTAPRMGRWHDPEVSMELR
A0A6L5R0V7      RTSSGTEASKSTRTTESRTRTSKAVDIPWTLLAHGSPHRGWN------RWHDPEVSMELR
A0A444BL03      --------------------------------------------------------MTLL
A0A4Y8X357      --------------------------------------------------------MNLL
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A6L6AM03      --------------------------------------------------------MTFG
A0A4Q2RU39      --------------------------------------------------------MTFA
A0A4Q2SK58      --------------------------------------------------------MTFA
A0A2N3YJR1      --------------------------------------------------------MTLL
A0A6G8FYB9      --------------------------------------------------------MTLL
A0A4Q4D742      ----------------------------------------------------MGVHVELR
A0A1C6T1J1      --------------------------------------------------------MDLY
A0A2W2CFC8      --------------------------------------------------------MDPL
A0A2W2A4B0      ----------------------------------------------------------MT
A0A4Y9MDA5      --------------------------------------------------------MSLS
A0A1H7N9P7      --------------------------------------------------------MSLS
A0A1M7V0F8      --------------------------------------------------------MTLS
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------MAR---
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A222TG79      ----------------------------------------MYVTSGDDSNVQ--------
A0A6I3DFP2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ILMAVVRRFWPVLLIATLVGALCGFGWAALQ-PK------MYQSTSSGLIVT--PKSSTV
A0A3L8NYD3      DFVRLTRVNWRVIFATFSLGLVAALLYTLHQ-PV------VYTATSKGYVAV--DSGDSV
A0A1M6K628      QLWALARRNWLTLLLATILGVAVGAGISYLQ-PT------LYSATSVGYVVV--GNSSTE
A0A561E8R3      DFVRFSRTNALLLLLFTIVGGALMFGYTFTK-PT------LYSATAQGLVSA--GGADNT
A0A3E2DN22      DVVRILRRNLALLVICTLAGGLLGAVYQLTR-SE------TFTAKATGMVVA--GDSTSV
A0A3Q9ULZ9      DFVRLLRRNLLLLVICGVVGMGAAAAYVFTR-PV------QYVAQSTAMVVA--GDSSSV
A0A3S9JFL2      DLVRLLRRNLALLLVCGLVGIAAAAAYVFTR-PV------QYVAESTAMVVA--GDSSSV
A0A3L7ADK2      DFVRMIRTYWMGALLIIALSIASGAVWTLFQ-PQ------VFEAKATGIVQA--PRGNDP
A0A1Q2CI19      DFLSILRHRWLVIVLCVLIAAGVVFAITPAE-RDVSPRIGSYTATSTLLVGS--V-GA--
A0A512T3M3      DYLIVFRHYGALIVATILAAATLTWVLTPAH-AQGPVT--SYTATATLLAAS----SE--
W6JTW4          EYLRILLHRAPLIAGATVVAGLLSWFLVPAG-TQNAPR--SYTATAQMTVDG----GE--
A0A0A0JTY0      DYFKVFRHRWIIIVICALVAGAITWFITPAS-SDTTKKVGSYTATATMLVTA--KASS--
A0A0A0JXF2      DYIKVFRHRWIVIVLCAVIAAGVTWLVTPAS-ADTTKKVGSYTATATILV------GS--
E6S8H2          EYLKVFRQRWLIIAITTLVAGAVMWVTSPAV-ADTSQKASSYTATATLLV------TS--
A0A0A0JGH0      DYIRIIRQRWIVIVICAAVAGLVTWFLTPAN-ASSVKDAPSYTATATVLV------SA--
N0E4U7          DYLTIARRRWPIIVACALVAAAVTWFLTPAQ-TDEAEVAPSYTATATLLV------GS--
A0A0A0IYK2      DYIKVFRHRWMVILVCALVAGAVTWFVTPAS-ADTTKKVGSYAATATILV------GS--
A0A0Q9L0H3      DYIKVFRHRWPVILICALVAGAATWFITPAS-SDTTKKVGSYTATATLLV------GS--
A3TMK0          DYIKVFRHRWPVILICALVAGAATWFITPAS-SDTTKKVGSYTATATILV------GS--
A0A543PXP1      DYLKVFRHRWPVIVACALSAAAIMWLVTPAQ-TATAQKASSYTATATLLV------GT--
A3TMH6          DYLKAFRRRWLVIALCAVVAGAVMWTVTPAH-PEVTRSTGSYTATATLLV------ER--
A0A1H6WL79      DLLSVVRSHWLGILVITVLMTGGSLGWYALQ-PK------VYAAESSGIVVA--AGAENL
A0A101LAM5      DLLSVVRSHWLGILFITVLMVGGSLGWYALQ-PK------VYSAESSGIVVA--AGAENL
A0A4Y3NEG0      DLLSVVRSHWLGILLITVFMVGGSLGWYTLQ-PK------IYSAESSGIVVT--AGAENL
A0A6I2XCV4      HYAAVVRRRWRWIAAGLVLGMVGGLISTVIA-TSTAPKSSYFKATN--------------
A0A5R8VLL6      DYARVARTYWKHITVITLIVTVLATAWSAFR-PR------VFAAEATAIVLA--VGTDNV
A0A538JQF8      PFPRSVRAAHTLILA---------------------------------------------
A0A1H6YPK1      DYLDVLRSRWLSIAVCTLVVGAVAYLWSDMQ-PR------VYSTSAEALVTP--AGSL--
A0A2R7MGI0      RVVRILRAYWKTIGALLALGALAGLGWSALQ-PR------VYTADASGYVAT--VSSDGS
A0A2T7WQY4      RVVRILRAYWMTIGALFALGALVGLGWSALQ-PR------VYTADASGYVAT--VSSDGS
A0A1G6GTN3      RVVRILRAYWKAIVALIATGALAGLGWSSLQ-PR------VYTADASGYVAA--VASDGS
A0A1N7DLV3      RVARILRAYWKAIVALTLAGGLAGLGWSALQ-PR------VYTADASGYVAS--VSSDGS
A0A1V2NSB5      RVARILRAYWKAIVALTLAGGLAGFGWSALQ-PR------VYTADASGYVAS--VSSDGS
A0A0Q5Q5L3      --MRILRAYWKAIVVMTVLGGLAGLGWSATQ-AR------VYSADASGYVAA--VASDGS
A0A0Q6DVM4      --MRILRAYWKAIVVMTVLGGLAGLGWSATQ-AR------VYSADASGYVAA--VASDGS
A0A1R3WWR6      RVVRILRAYWKAIVALTIAGGLVGLAWSAVQ-PR------VYTADASGYVAA--VASDGS
A0A0Q5JKD6      -MVRVVRAYWKAIVALIVVGGLAGLGWSSLQ-PR------VYTADASGYVAA--VASDGS
A0A0Q9TBP0      -----------MALLVLLAAVAVSCAYSLAA-TP------LYIATADVLIEP--SGADI-
A0A5Q2FA83      EFLAILGSRWKTVLVSLLLVVAATVATTLRI-TP------TYEATTRVFFSA--EATAKT
A0A346XTB0      SLLESLWRYRVVVAGVTLFMGLLGYVVGLQE-DV------RYVAQGTLFLAD--PNLG--
A0A0G3V3M7      DYLRIVRRRWWVLLVTVVIAMTFALLTRPSS-AA------TAKASRPGVSFR--ATTTLI
A0A6I3DD56      DYLRIIRRRWWVLLVTVVIAMTFALLTRPSS-SE------TIRANRPGVSFR--ATTTLI
A0A2W6DK08      DYLTALQRRWPVVVVAGLLGLLIGYLVAPGA-ANQLSGKGSYVATA--------------
A0A2S0LQ32      -----MKVNAVFIICCVVVGGLLGFGYAKTQ-PK------LYQSSAQATIVI--AGT---
A0A2N6V1R5      ----MTRVNLGFLILCVLLGLAGGFGYASAQ-PW------TYTATSQAMVVV--PGT---
G9PHS6          ----MTRVNLGFLILCVLLGLAGGFGYASAQ-PW------TYTATSQAMVVV--PGT---
U1PLM7          ----MTRVNLGFLILCVLLGLAGGFGYASAQ-PW------TYTATSQAMVVV--PGT---
A0A6I1G2U1      EYWKVIRRKWPVIVATSLAAAVVMFLITPAE-PPPVERVTSYTATATLIVET--PARSVD
A0A351ETF8      AHLAIVRKYWWFTVLVVVCAVAVAFLLTQRQ-ER------IYSTSAQVLLRS--SENSFL
A0A542FTE6      EFLRAVRAYWVGALGILLICIAIAALWTLTQ-PR------VWTSVATGVVQT--TGGGDA
A0A349B7N2      ------------MVLGLTLGWVTTPSSAGPD-EP------DYYRATHTLVAE--TGTSAP
A0A2S5UYV0      DFLRLTGRSWRTLLIGVAIGLLAAFGYTQVQ-PH------VFTANSSGFVMA--GPAAEG
A0A2S5X9U6      DFLRLTGKSWKILAVGAIVGLLAAFGYTQIQ-PK------EYEANSAGFVVA--SGNAEL
A0A2S5ULV5      DFLRLTGKSWKILAIGVIVGLLAAFGYTQIQ-PK------VYEADSAGFVIA--GSSGEF
A0A653YMF0      DFLRLTGKSWKILAVGVIIGLLAAFGYTQIQ-PK------VYEADSAGFVIA--GGSAEL
A0A346Y185      ALVGVLRSSIGRILLVGVAAGLLGFGLSALQ-SL------RYTAEADLLLAD--PRNTG-
A0A259S8H9      DLFTILRRGWLYLAAGLLLGALAGFGYAQTL-AP------VYTSQATGFIAA--TGTA--
A0A0Q5L115      DYLRIVRSYWLGAFLIVLLGVTAGAGWTLTQ-TR------VYESSASGVVQV--AAGGDA
A0A2W1Z497      DYVRMFRTYWFGAVLIVLACVAAAGAWTLTQ-PR------VYTSGASGFVRV--AGNGDA
A0A4V1VGV9      DLVRIMRANLKLLALAALIGTLLAAGYTLTR-PT------LYSASSTAQVIA--GNSIDA
A0A3Q9IY80      TYLRILRAHWLGLIVLVVVGVVSAFGWTLLQ-PK------VYSADASG-IVA--PVRTEL
A0A0F0LP73      DFLVLIRRGWFFLALGLLFGALGGFVTAQLT-PP------VYTAQATGFIAG--TGG---
A0A1F1X071      DFLRLLLRNLLLLVAGLVLGAATGYGLSFTQ-ST------TYSASALGYVSA--SAQSDE
A0A3R8RWC7      DFLRLLLRNLLLLVAGLVLGAAAGYGLSFTQ-ST------TYSASALGYVSA--SAQSDE
A0A4U0RJZ4      DLVRIIRTNLKLLLLSMLLGIVVAAGYTLTR-PV------EYQATSTAQIMA--GASNDA
A0A4R1FGL9      DLVRIIRTNLKLLLLSMLLGIVVAAGYTLTR-PV------EYQATSTAQIMA--GASNDA
E3B8H1          DLVRIIRTNLKLLLLSMLLGIVVAAGYTLTR-PV------EYQATSTAQIMA--GASNDA
A0A7D7WDT9      DFLVLTRRGWRILTLMIVLGALGGAAYGFLA-PK------SYQAQSTGFIAT--AGDA--
A0A0Q5AWK6      DFIAFIRRNWKALVVAVLVGVTAMAAFSFVT-PK------VYESSSAGFVIA--ATDGSS
A0A6P1F176      DFIAFIRRNWKILAIAVVVGVAAVAAFSAVT-PR------VYESKSAGFVIA--ATDGSS
A0A3N1NLD3      DFIAFIRRNWKILVVAVLVGVSAMAAFSAVS-PK------VYDSSSAGFVIA--ATDGSS
A0A3N2FVI8      DFIAFIRRNWKIIVVAVLVGVSAMAAFSAVT-PK------VYDSSSAGFVIA--ATDGSS
A0A2S5XDQ6      DLIAFIRRNWRTLVGAVLVGALAMAAFSFLT-PK------VYESSSAGFVIA--ASDGSS
A0A2S5XNN6      DLIAFIRRNWRTLVVAVLVGALAMAAFSFLT-PK------VYESSSAGFVIA--ASDGSS
A0A4Q4D4T1      -----------MLLGALGLGAAALVLSGQTT---------RYDGSAEVLIQP--------
A0A261FE22      -----------------------------------------MAKNSDGAMTT--------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ----------------------------------------MYTASASGYVSGASLAA---
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      DFLRIMRQRWRWLLGTLLVVLAVAAVSTLMQ-PK------TYEASARFYLAG--SNG---
A0A2Y8ZRF8      DFLRIMRQRWRWLLGTLLIVLIAAAVSTMLQ-PK------TYEASARFYLAG--SNG---
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      --------------------------------MS------AGNDTNPALGSV--------
A0A1Y4CKD6      NYLRIARRMWWLFLACVAIGVGCLYVASYVSYTP------LYRSEATFTITS--------
A0A3S0V9U6      DFIRLTRANIILLVVGILVGALVGYGTTLIQ-PK------TYAATSSGYVTL--GKSEDP
A0A1S2N0P2      DFLRLTRANLKYLIIFTVAGALLGLGVAALQ-PK------VYSATSSGYVTA--GGG---
A0A0Q3BEY5      DFLRLTRANLKYLIIFTVAGALLGLGVAALQ-PK------VYSATSSGYVTA--GGG---
A0A4R6Q3C6      DFLRLTRANLKYLIIFTVAGALLGLGVAALQ-PK------VYSATSSGYVTA--GGG---
A0A2X3GKL3      DFLRLTRANLKYLIIFTVAGALLGLGVAALQ-PK------VYSATSSGYVTA--GGG---
A0A0Q7KBQ4      -----MRSRWVFSVSTFVVGAVATILLVLSM-SP------VYGSSAKLFITS---PV---
A0A1F1IHY9      KAMSMLQRHWMILVAAPLIGVLLAGLWVLTQ-NP------RYASTANALVVV--GNS---
A0A542HCT5      DYLRVARAYWRGIVAFVLLGVAVAAGVSLVT-PK------VYQADASGFVSA--GGA---
A0A2S8WHZ8      --MQVVRAYWRGIIGIFLICILLAFLWTLTQ-PR------IYAATSSGLVIA--GDS---
A0A537WNY9      DLLNLLWRRRILFVATILAVIGTAFGSVQVV-TP------EYEATSTLALTP--------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      EAARQVAQNWWVVLALALATFLGMTGVGKLTYVP------EYTSAATLVIRV--------
A0A0Q5M6Z7      DFVQLLRRYWVGELAIVMLTVGLVAALTAVQ-PR------VYESTASGLTQA--ATG---
A0A3N3ZPU0      AVARAAGWYWKVALALIVLSVAAGAAIALLM-PK------VYSSTNTVMVVT--GNS---
A0A359IQX7      DFVRMTRHNAWLLLASVVLGLVAAAGYSLTQ-PT------LYGSVSTGIVVA--GNS---
A0A433EDP2      DFVRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI---GS---
A0A231VTW0      DFVRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI---GS---
A0A433ECD0      DFVRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI---GS---
U7V3Z1          DFVRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI---GS---
A0A1F1J417      DFVRTTRANLVLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV---GQ---
A0A2A8D6P2      DFVRTTRANLVLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV---GQ---
A0A1F0THV9      DFVRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV---GQ---
A0A5F0M6Y0      DFVRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV---GQ---
D8USQ4          DFVRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV---GQ---
E3H5W1          DFVRTTRANLLLLIAGIVIGAIAGLSYSLLQ-PK------VYAASASGYVTV---GQ---
A0A1F1QKB0      DFVRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV---GQ---
A0A509JY23      DFVRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV---GQ---
A0A448USF4      DFVRTTRANLVLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV---GQ---
A0A0Q9LZR0      DYLRVARTYWRGLVAFMLLGVAVAGGLSLVT-PK------VYQADASGFVSA--GAS---
A0A1N7E3F1      RYARLMRRYWPLLLLSVLAGVGTAHVVTVNT-AP------RYLASITMLVSA-DAGD---
A0A544ZKQ1      YYARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------RYLASITMLVSA-DTRE---
A0A372P1T1      YYARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------KYLASITMLVSA-DARD---
A0A5D0Q2X0      YYARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------KYLASITMLVSA-DARD---
A0A5R8Z2E7      YYARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------KYLASITMLVSA-DARD---
A0A1L2ZMV4      RLAHVVLNNWKGAIAIFLLAVLASVGLFLIS-PK------TYAATNTVMVVA--GGG---
A0A6I3F378      DYLSAVWRRKYLALSTTVLCACLAAGWSVTQ-TS------VYRASTEVVIDV--SRN---
A0A1E9T6I0      EFFRTTRANLWLLIIGIIIGAAVGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1S1CQC5      EFFRTTRANLWLLIIGIIIGAAVGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1S1CAD0      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
G5ET14          EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1E9DXX2      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1E8S156      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1E8S5S2      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1S1DFA8      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A2I1Z490      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1F0DAA9      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1F0PHK9      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1F0VZG6      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1E9G8X4      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV---GE---
A0A1E9IAW2      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV---GE---
A0A1E9ZBC9      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV---GE---
A0A1E9ZDP4      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV---GE---
A0A1F0R6B5      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV---GE---
A0A1F0Z7N5      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV---GE---
A0A1F1D897      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV---GE---
D2NP38          EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV---GE---
A0A1F1FV74      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1E9M791      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV---GE---
A0A291DEI8      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV---GE---
A0A1S1D5T1      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1E8TRD6      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1F0XT88      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1F1EVP5      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
C6R548          EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A0K2RXS2      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A1F0KX60      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV---GE---
A0A542I3V2      DYVRVARLYWRSIAVVTVIVTALVMLWAALQ-PR------TYAAESSALVLT--VGS---
A0A2T0UZ65      DFVRLSRANLLRIVLLVLIGAGLAFAYAQTL-PK------VYAADASGYVVT--GGG---
A0A1R4JTI6      --------------------------------------------------MVTAGVN---
A0A4R7TM52      TYWRIARTGWWMMLIGLVVGVLLAVGWVVLQ-KP------VYTADAGGFVSASAGSG---
A0A542XE74      DLIRLLRRSWLSVAVGLMIGLILAAAYTLTR-PT------TYVAESRGVVVA--GST---
A0A0G3V3F3      AHFRIIARAWKQILIAGVLVAVAMFFWSNRA-ER------VYEATALLAVT---PSD---
A0A0Q7QDF6      SGWTAVARRWPLVVLLGALGLGAAALVLSGQ-TT------RYDGSAEVLIQP--------
A0A5R8L819      VYLRVFRAHWVAIVVATIVGGALAYGWAVLQ-PK------TYTAEASGYVAAT-VGG---
A0A261FQA1      DILQMIKKHWIVGLAVLVVSLAVTVCVVQTT-VP------EYSASV--------TAV---
A0A1Q2CJ92      -MWGLLRRGWLVIVASLAVGLALAFALSLTQ-PV------LYSATSAGYVVA--GNS---
A0A2T0S3C8      DYLRVLRKRWWMLLAGIGVACGLAGILTSQM-TP------QYATSVTFFVT---TPN---
A0A4Y8WZJ3      KAMSMLQRHWMILVAAPLIGVLLAGLWVLTQ-NP------RYASTANALVVV--GNS---
A0A285VUW0      DLFLAIARRWRGAVAILLLVVAATAFATSRQ-PQ------VFESRTTVYFAATDEAG---
A0A2R7Z032      EFVRLTRAYWWFLVLLTALGAGVMIAKTSRE-PE------LYSAGASGIVKV--GFS---
A0A6J4MTQ2      ELWRLTRAYKWVLAGFVVLGVLVMIALTSQK-PV------LYSASSKGVVQV--GNA---
A0A1I0W453      DFVRLSRAYVWVLIGCTILGAALMLAKTTRD-PV------LYSATSSGLVRV--GNA---
A0A1H4LCS9      DFVRLSRAYVWLLIGCTILGALLMVAKTTQD-PV------LYAANASGFVKV--GNA---
A0A4Q2RZP8      DFVRLSRAYVWLLIGCTILGSLLMIAKTSRE-PV------LYAANASGFVKV--GNA---
A0A0Q6VV12      DFVRLTRAYVWVLIGCTVLGALLMMAKTTRD-PV------LYSATSSGLVVV--GNA---
A0A495NTA9      DFVRLTRAYVWVLIGCTVLGALLMMAKTTRD-PV------LYSATSSGLVVV--GNA---
A0A0Q9QB08      DFVRLSRAYVWVLIGCTVLGAALMVAKTTQD-PV------LYSATANGLVKV--GEA---
A0A4Q2SA86      DFVRLSRAYVWVLIGCTVLGAVLMAAWTTRE-PV------LYSATSSGLVTV--GNA---
A0A4Z1C3Z0      DFVRLTRAYVWVLVGCTVLGAAVMAAWTTRE-PV------LYSATSAGLVQV--GNA---
A0A542J310      DYLRGLRRHWVAIILMTGIGVGAGFGWTLLQ-TP------VYVASASGIVQS--TGI---
A0A4Q2JUT1      DYLRGLRRHWVAILLLTLVGVGAGYGWTVLQ-TP------VYVASTSGIVQS--TGV---
A0A6L5R0V7      DYLRGLRRHWVAIVLLTLVGVGAGYGWTVLQ-TP------VYVASTSGIVQS--TGE---
A0A444BL03      DFVRLTRTHLLFLVVLTLAGGAAAYGLTLRM-PS------VYLADASGYVRID-GAG---
A0A4Y8X357      DFLRVLRNNKLLLLGGIVLGVVAGLVYSLLQ-PT------LYTATSTGFVTVQGEAS---
R4LD52          ----------------MLAALVLGALVTVQT-AP------RYATSVTFFVT---TPN---
A0A4T2CD79      ----------MTVVAITLLGAAAAFGWTFTQ-TR------VYTANSSGIVTL--MSD---
A0A6L6AM03      DFVRLSRAYVWVLIGCTILGALLMIGKTTRD-PV------LYSATSSGLVRVG-TNV---
A0A4Q2RU39      DFVRLSRAYVWVLIGCTILGALLMIAKTTRD-PV------LYSATASGLVRVG--NA---
A0A4Q2SK58      DFVRLSRAYVWVLIGCTILGALLMIAKTTRE-PV------LYSATSSGLVRVG--AA---
A0A2N3YJR1      DFVRLSRTHLLSLVLLTLLGGAAAFGLTTRL-PQ------VYQADASGYVRVT-AAG---
A0A6G8FYB9      DFVRLTRAHLLSLVFLTLVGGAVAYGLTLRM-PE------VYLADASGYVRVA-GSG---
A0A4Q4D742      QFFGTLQARWRFALVTFVLGAIATVVLVTSM-AP------QYGSTVKIFMS---TPG---
A0A1C6T1J1      RQLRLVRRHWWIVLVTLMVALGTTALVTIRS-EP------RYVASVTFFVT---TPS---
A0A2W2CFC8      RQLRLVRRHWWIVLVTLMVSLGVTALVTVRA-QP------RYLATVTYFVT---TPS---
A0A2W2A4B0      PLTRALVLRWYFAVGGALLGFVVAIALSSTV-TP------QFRATSKIWISISGDAE---
A0A4Y9MDA5      VFLGTLRRRWSLLLAGVLVGLTVAGIGSLTA-ER------LYTAESRLFFAL--ESG---
A0A1H7N9P7      VFLGLIRRRSSWLVAGVVLAVAVAGVGSLTA-TR------LYTAEARLFFTL--EYG---
A0A1M7V0F8      AFLGVLRRRSSWLLVSVLVGLTVAGAGSAAA-TR------LYTAEASLFFAL--EYG---
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------MAIGLV
A0A357ZCV8      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------STIEK-
A0A538AM15      --------------------------------------------------------MSK-
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      -----------------------------------------------------MAQLKE-
A0A6N4VXX3      ---------------------------------MLAQRTVDAL-----HLDMSAQALRK-
A0A1H4I042      -----MDTYQGNLLSQERVRSYT----ILLTGEALAQRTIDAL-----HLDMSARALRQ-
A0A4R7A6D9      -----MDTYQGNLLSQERVRSYT----ILLTGEALAQRTIDAL-----HLDMSARALRQ-
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A4Y5YMQ6      ---------------MLSFASLA----TSGAVLEPVVEDLAEA-----GIDISLPQLRR-
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q5APW3      ---------------MSQIKSYP----VLTTTQSVLQPVIEDL-----GLHTTVAQLKE-
A0A4Q5B0V3      ---------------MSQIKSYP----VLTTTQSVLQPVIEDL-----GLHTTVAQLKE-
A0A1Q2CRV2      -------MQAGSNYAANQVQSFA----KVAKSGFVLTPVIEDL-----QLSVTPEQLAR-
A0A222TG79      ------AAYQGSLASQQRIASYA----QLASSDAVISNAVSES-----RKSISSEDVRK-
A0A6I3DFP2      ---------------------------MQAQRVVLQKQLSDLP-----------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          -----SASYQNSLASAQRVASYA----ELVDSDVIVSRALEST-----GVGLKQDEAKD-
A0A1L2ZMQ6      G-----EAIAGNSLAQDRAGSYA----VMASSQRTAERAVEKLEKQGVADVPDAGSLIS-
A0A3L8NYD3      S-----DVYSATSLAQQKLSVYV----GLVSSTAVAQDVID--S---LKLDETPSDIAS-
A0A1M6K628      N-----AGAR--NPAAEKAATYL----PLAESRSVAETVAQ--E---LG--VQSGEVSL-
A0A561E8R3      G-----SALNGVSLAQTKAQEYA----ALASSAPVAERAAQ--A---LGPNAPGGSISA-
A0A3E2DN22      G-----EAMSGNAIAQQRAATYT----KLVETRTMAQKTSE--I---LKKHGMPEAANG-
A0A3Q9ULZ9      G-----GAMSGNTIAQQRASAYS----TLIGTEAVDNRVQK--T---LGSKGLSKAADG-
A0A3S9JFL2      G-----GAMSGNTIAQQRASAYS----TLVGTAAVDNRVRA--T---LNKQGLSKATDG-
A0A3L7ADK2      S-----NAYSSEALSKSQAASYA----TVATSLAVAERVEK--A---GVVKQSAGVLLG-
A0A1Q2CI19      ------PDAGAGYASLGRVALFI-------TTGEVPRNAAA--A---LGYEGDPALLAK-
A0A512T3M3      ------NPQLPPSLPLGRIALYV-------TTGVVPVRVAK--K---VGFVGQPTELAG-
W6JTW4          ------ERV---TVGLPRIAFFI-------TTGDIPQAAAD--K---LKYADGPFALAR-
A0A0A0JTY0      ------AA-TAVAPNLDRVALYL-------KTGEVPKRAAK--K---VGYEGDPAVLAS-
A0A0A0JXF2      ------TD-PERTGNMGRIPLYM-------TTGEIPRRAAA--V---VGYEGDPARLAA-
E6S8H2          ------TE-TDSESPMGRIALYL-------TTGEIPQRAAA--E---LGYTGDPAVLAS-
A0A0A0JGH0      ------AT-ADEQVSVDRVVLYA-------KTGAIPTAAAK--A---LEFEGDPAILAS-
N0E4U7          ------GG-PPELVSIDRLALFI-------KTGEIPSRAAK--V---LSFDGDPALLAS-
A0A0A0IYK2      ------TDPENPNPNMGRIPLYM-------TTGEIPRRAAA--A---VGYDGDPALLAR-
A0A0Q9L0H3      ------NDPETGSTNLGRIALYM-------TSGEVPKRAAA--R---VDFTGDPALLAS-
A3TMK0          ------KDPEATGSNLGRIALYL-------TTGEVPKRAAA--V---VKFEGDPALLAR-
A0A543PXP1      ------S--ADSTAQMGRIALYL-------TTGEIPRRAAA--K---LGYTGDPAMLAS-
A3TMH6          ------T--EDVNSQLGRIALFL-------TTGDIPRGAAK--R---LGYPGDPALLAA-
A0A1H6WL79      G-----LSLAGDSLAKSKAKGYQ----SVGESILVAESVIR--T---LGLKESAPDITR-
A0A101LAM5      G-----MSLAGDSLAKSKAKGYQ----SVGESILVAESVIK--S---LGLKESAPDVTR-
A0A4Y3NEG0      G-----MSLAGDNLAKSKAKGYQ----SVGESILIAESVIE--S---LGLKESAPDITR-
A0A6I2XCV4      ------TIVEADGSGTANLSQVA----FLLQSAEVQGQIAT-------AMNLPVETLRG-
A0A5R8VLL6      S-----SLLAGDTLAKAKAKTYK----SLAESRLVADKVSA--S---TGVNMTGESLLG-
A0A538JQF8      ------NNTLAPEDTQKPLNVYA----LFIKVGEVPKLAAE--R---LGYKKEAFELVR-
A0A1H6YPK1      ------DEVGDAATVESRMAVYT----RLATSDQVAAVVAE-------SIGGDADALRS-
A0A2R7MGI0      TG----SALAGDQLALSKVKSFV----DMGYWRSVAEAARQ--T---LGVNDSPESLVQ-
A0A2T7WQY4      TG----SALAGDQLALSKVKSFV----DMGYWRSVAEAARE--S---LGVEDSPESLVQ-
A0A1G6GTN3      TG----AALAGDQLALSKVKSFI----DMGYWRSVAETARQ--D---LGLSDPAESLVQ-
A0A1N7DLV3      TS----SALAGGTLALSRVKSFI----DMGYWKSVAETARD--E---LGLTDSPESLVQ-
A0A1V2NSB5      TG----SALAGGTLALARVKSFI----DMGYWKSVAETARD--E---LGLTDSPESLVQ-
A0A0Q5Q5L3      TG----AALAGDQLALSKVKSFI----DMGYWRSVADTARQ--Q---LGLSDSPEALVE-
A0A0Q6DVM4      TG----AALAGDQLALSKVKSFI----DMGYWRSVADTARQ--Q---LGLSDSPEALVE-
A0A1R3WWR6      TG----AALAGDQLALSKVKSFI----DMGYWRSVAETART--E---LGITDSPEALVQ-
A0A0Q5JKD6      TG----AALAGDQLALSKVKSFI----DMGYWRSVAETARG--E---LGLSDSPESLVQ-
A0A0Q9TBP0      ------SASSGTKIDADEVATQV----QVVTSLPVSRLVQERFS---LASPPDLSELVS-
A0A5Q2FA83      GTN---TGGGGYVLTTNDLGTYE----QLVSSPVVMDPLRQQLK---LAPSTPL------
A0A346XTB0      ------DELQGIVSARISAEEYVPRQAARIQSRAVLQEAAD--L---IDNRISVGELGS-
A0A0G3V3M7      S-----SGSANTSVNGRDYDRLA----LLMITGEVPKRVAEAID---EVRWPQIQNANAN
A0A6I3DD56      S-----NGSANTSVNGRDYDRLA----LLMTTGEVPKRVAEAID---EVRWPQIQSATAN
A0A2W6DK08      ------TVLQAPDVKEAVASTTL-----LVTAEPVAERVSK--M---LNTHHAPQDLLL-
A0A2S0LQ32      ------DAWSANSVAQQKAGVFA----KLAGSAAVAQSVSQ---------SLGLQDLGG-
A0A2N6V1R5      ------DAFSQNSISGQKASVYA----VLAGSQNVANRVAK---------TLKTSNMEG-
G9PHS6          ------DAFSQNSISGQKASVYA----VLAGSQNVANRVAK---------TLKTSNMEG-
U1PLM7          ------DAFSQNSISGQKASVYA----VLAGSQNVANRVAK---------TLKTSNMEG-
A0A6I1G2U1      E--------PAGAVSLDRVVLYM-------TTGEVPALAAQ--Q---VGYTREPALLAN-
A0A351ETF8      F-----PFPATGPLALNREGEIE----TLYVTSPAFTEAAL-------------LKSPP-
A0A542FTE6      G-----LALAAENLAKSKAKTYV----ELAKSQAVAESVAE------AIGSSSPGSLLA-
A0A349B7N2      P--------------------NLAQLSLLLRVGDVPERVAA-------EFGVEPDVLVS-
A0A2S5UYV0      G------YIGGSEAAIAKAQSYI----PLITSQPVYAKIAENPA---LGLAEG-QALTG-
A0A2S5X9U6      G------YINGSEAAIAKANSYI----PLITSQPVYAKIAENPD---SGLAEG-ETLNG-
A0A2S5ULV5      S------SIDGSEQAITKANSYL----PLITSQPVYAKIAENPN---SGLAAG-ETLTG-
A0A653YMF0      G------YINGSEAAIAKANSYL----PLITSQPVYNKIAENPN---SGLAAG-ETLNG-
A0A346Y185      -------LFGETGVNFLDPSRYVRNQAEFAQSNAVAERASV--L---LGGRLDSDQVRE-
A0A259S8H9      -------VIAGSDEAVARAGAYM----PLINTSQVRDEIAK--E---AGVSA--AELHG-
A0A0Q5L115      N-----LAFAADQLAKSQAQSYV----ELGGSLAVAESAAA--A---LGGAASPASLLG-
A0A2W1Z497      N-----LDYAADQLSKSQAETYV----ELGGSLAVAKRVVR--A---TGTSASPQELLG-
A0A4V1VGV9      N-----SAVLSQQLSTGRAGYYA----QLASSSGVANRIAEESK---GSLRAGEFSVVG-
A0A3Q9IY80      SGNDAGSALVAENLAKAKVGSYL----DLGSWRAVAEHAIA--E---LGLTSSPESLVN-
A0A0F0LP73      ------AVIAGTNIAIDRAGAYM----PLVDTAQVREEIAK-------DAKVPLSKLNG-
A0A1F1X071      NGDPIQQASGNMEFQYSKAQSYL----PLFNTRAVGQRIVD--E---LGLEASPDEVAG-
A0A3R8RWC7      NGDPIQQASGNMAFQYQKAQSYL----PLFNTRAVGQRIVD--E---LGLEASPDAVAG-
A0A4U0RJZ4      S-----AAMVNQQLANQRSGAYA----QLASGSGVADRVVALSN---GALSPGDFVLAG-
A0A4R1FGL9      S-----AAMVNQQLANQRSGAYA----QLASGSGVADRVVALSK---GALSPGDFVLAG-
E3B8H1          S-----AAMVNQQLANQRSGAYA----QLASGSGVADRVVALSK---GALSPGDFVLAG-
A0A7D7WDT9      -------VIAGSDAAVARAGSYT----PLIDSAQVREAIAK--E---AGVDVSD--LSG-
A0A0Q5AWK6      A-----DAISGAQTAVTRANAYL----PLISSSAVYERIQS--D---PEANPGGEALNG-
A0A6P1F176      A-----DAISGAQTAVTRANAYL----PLISSSAVYERIEA--D---PEANPGGERLNG-
A0A3N1NLD3      A-----DAISGAQTAVTRANAYL----PLISSSAVYERIES--D---PEANPGGEPLNG-
A0A3N2FVI8      A-----DAISGAQTAVTRANAYL----PLISSSAVYERIES--D---PEANPGGEPLNG-
A0A2S5XDQ6      A-----DAISGSQTAVTRANAYL----PLISSSAVSERIEA--D---PEANPGGEALSG-
A0A2S5XNN6      A-----DAISGSQTAVTRANAYL----PLISSSAVSERIEA--D---PEANPGGEALSG-
A0A4Q4D4T1      -------TSPATSLSGRAVESYA----HVLGGTALEQRAVKALG----LEDAGDAEVRG-
A0A261FE22      ---------GASNGGSSPLASYA----QLVQSDAVLEPVVNNL-----GLHTSVAGLRG-
A0A5C8C085      --------------------------------------------------NESPASLIG-
A0A1E4BP96      ---ETGSPLVGDQLARSKVTSYL----DIGSWRAVAEHAIEDL-----GLSASPESLVG-
A0A439DNZ6      ------------------MISYT----ELLMGETLAQRTIDKL-----DLEMSAGELQN-
A0A0J6YE86      ---------------------------------------------------MSADELQA-
A0A5Q5BFU2      ----MADTYQGNRFSQERVISYA----ELLMGETLAQRTIDKL-----GLDMTAQALQE-
A0A151BT98      ---------QGTPVQRDDLATYA----QVVSAPAVQKVIRQQA--------KLGPSVPV-
A0A2Y8ZRF8      ---------QGTPVQRDDLATYA----QVVSAPAVQEVIRKQA--------KVGPTAAV-
A0A2R9UAT1      --------MLANNLALSKVVSYV----DIGSWRSVAEYAIEKL-----RLDSSPEALVR-
A0A4Q5J5D7      ----------ADTLAKSRAKSYV----DIARSRATAEGVIDEL-----GLDDSPASLIG-
A0A1Y4CKD6      --GDGSSLYSSVSSASQLSKTFP----YVLDSSYFRGVLEDAL---------GTDSLDG-
A0A3S0V9U6      TTGSAGEILSGDAAAQSKAKAYL----PLITSAPVAQKIASSS-----KTSLDAAAIPS-
A0A1S2N0P2      --SAVGDILSGDSAAQAKASAYL----PLVTSGPVAKKIAENN-----SVGIDESAIPS-
A0A0Q3BEY5      --SAVGDILSGDSAAQAKASAYL----PLVTSGPVAKKIAENN-----SVGIDESAIPS-
A0A4R6Q3C6      --SAVGDILSGDSAAQAKASAYL----PLVTSGPVAKKIAENN-----SVGIDESAIPS-
A0A2X3GKL3      --SAVGDILSGDSAAQAKASAYL----PLVTSGPVAKKIAENN-----SVGIDESAIPS-
A0A0Q7KBQ4      --GQQVTDPTAAYFASQRLASYA----DLAREPSLLQDVINRLN----LTGVTREELAG-
A0A1F1IHY9      --ESLGVALTADNLAKSKAQQYA----LLGESRAVSDKAVEEL-----PFDLSSGEALR-
A0A542HCT5      --TNPGEASVLDSLAKSRATSYV----DLAQGRATAQDVIKTL-----GLDAQPAGLIG-
A0A2S8WHZ8      --ENIGNALAGDNLAKSKAVGYK----SIAGTRTIADLVRKEL-----KLDESSDVLLG-
A0A537WNY9      ------KTLNDPNSAYVFFGTLD----AIVPVYADAAAARSTKE----RASALLGRSVA-
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ---KGADAYSSLAQASQMTAVYS----EVFQSSALRNEISASV----------GEPVEG-
A0A0Q5M6Z7      --ESLSMAFAGESLAKSRAESYV----RVANSDAVADRARKIL-----GTDRSIGDLLG-
A0A3N3ZPU0      --NTLGDYMTADSVSLSKADSYM----QLGGSPEVAQIAAESL----------DGTPVH-
A0A359IQX7      --NSIGDATAGMVLAEQKAAAYT----ILTGTRQVSQDVADGL------RSKYGKDVPF-
A0A433EDP2      --GGTIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQEKNP----NMGMTVSGIRG-
A0A231VTW0      --GGTIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQEKNP----NMGMTVSGIRG-
A0A433ECD0      --GGTIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQEKNP----NMGMTVSGIRG-
U7V3Z1          --GGTIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQEKNP----NMGMTVSGIRG-
A0A1F1J417      --SGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNS----D--LSIGTIRG-
A0A2A8D6P2      --SGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNS----D--LSIGTIRG-
A0A1F0THV9      --SGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNS----D--LSIGTIRG-
A0A5F0M6Y0      --SGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNS----D--LSIGTIRG-
D8USQ4          --SGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNS----D--LSIGTIRG-
E3H5W1          --SGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNS----D--LSIGTIRG-
A0A1F1QKB0      --SGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNS----N--LSIGTIRG-
A0A509JY23      --SGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNS----D--LSIGTIRG-
A0A448USF4      --SGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNS----D--LSIGTIRG-
A0A0Q9LZR0      --SNPGEASVGDSLAKSRATSYV----DLAKSRATAQDVINTL-----GLGAQPAGLIG-
A0A1N7E3F1      --GGLSTALQAGALSQQRVQSYA----ALLTSRQVVGRIAGGE---------DVADVQA-
A0A544ZKQ1      --GGLSTALQAGALSQQRVQSYA----TLLTSRQVIGRIARGE---------AVDDLQA-
A0A372P1T1      --GGLSTALQAGALSQQRVQSYA----TLLTSRQVVGRIARGE---------DVTDLQA-
A0A5D0Q2X0      --GGLSTALQAGALSQQRVQSYA----TLLTSRQVVGRIARGE---------DVTDLQA-
A0A5R8Z2E7      --GGLSTALQAGALSQQRVQSYA----TLLTSRQVVGRIARGE---------DVTDLQA-
A0A1L2ZMV4      --NNLGSYLSAETLANTKAETYL----ALGNAPEVSQLVSKHF------AEEGQAVSWK-
A0A6I3F378      --TSLFGPVAGAGDARRRLLNEI----AIVTGVEVRLGVQQ-------QLHLSSPPPRA-
A0A1E9T6I0      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNTP----ELSLTTGQIRS-
A0A1S1CQC5      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNTP----ELSLTTGQIRS-
A0A1S1CAD0      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNTP----ELSLTTGQIRS-
G5ET14          --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNTP----ELSLTTGQIRS-
A0A1E9DXX2      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRG-
A0A1E8S156      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRG-
A0A1E8S5S2      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRG-
A0A1S1DFA8      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRG-
A0A2I1Z490      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNTP----ELSLTTGQIRS-
A0A1F0DAA9      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSLSTGQIRS-
A0A1F0PHK9      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSLSTGQIRS-
A0A1F0VZG6      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSLSTGQIRS-
A0A1E9G8X4      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRA-
A0A1E9IAW2      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRA-
A0A1E9ZBC9      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRA-
A0A1E9ZDP4      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRA-
A0A1F0R6B5      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRA-
A0A1F0Z7N5      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRA-
A0A1F1D897      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRA-
D2NP38          --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRA-
A0A1F1FV74      --SGTVDVLSGSSAAKERARSYA----AIVSSEAVAQKIKQNNP----DLSLTTGQIRA-
A0A1E9M791      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRA-
A0A291DEI8      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSMTTGQIRA-
A0A1S1D5T1      --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNTP----ELSLTTGQIRS-
A0A1E8TRD6      --SGTVDVLSGSSAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSLTTGQIRA-
A0A1F0XT88      --SGTVDVLSGSSAAKERARSYA----AIVSSEAVAQKIKQNTP----ELSLTTGQIRA-
A0A1F1EVP5      --SGTVDVLSGSSAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSLTTGQIRA-
C6R548          --SGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNTP----ELSLTTGQIRS-
A0A0K2RXS2      --SGTVDVLSGSSAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSLSTGQIRA-
A0A1F0KX60      --SGTVDVLSGSSAAKERARSYA----AIVSSEAVAQKIKQNNP----ELSLSTGQIRA-
A0A542I3V2      --DSVNTLLTGDALAKSKIKNYE----SIAESRLIADQVIATV-----GLNTTADALLP-
A0A2T0UZ65      --QNTGDVFAGSTLAGSKAESYL----PLINSRAVGKRAGEII-----GSDAPPEVLAA-
A0A1R4JTI6      --ENLGIALTADNLAKSKATQYQ----ELATSRAVAEGAVKQA-----GLDISPEAASG-
A0A4R7TM52      --SDTGGALIADNLAKSKVKSYL----DVGTWRSVADDAISQL-----GLNTQPEALVR-
A0A542XE74      --ISVGDTMSGDTVTVSRASMYA----SLVNTSAVAQRADRTLA----SQGITRD---G-
A0A0G3V3F3      --TGLGINADQATFL---AKSYA----LYAETPRVTAAAAKSS-----GLDITANDAAS-
A0A0Q7QDF6      -------TSPATSLSGRAVESYA----HVLGGTALEQRAVKAL-----GLEDAGDA----
A0A5R8L819      --SDAGSALIGENLAKAKVKSYI----DLGSWRAVAQHAIDEL-----GLKVTPEYLVN-
A0A261FQA1      --TNAQSAAADGSTSDSRMGVVS----RVATSSAVLEPVIDEL-----DLDTSVDAMAS-
A0A1Q2CJ92      --ATVGDAFAGSTLAAEKAGTYL----PLVQSRSVANRIAEEL-----ALP-STGPVVG-
A0A2T0S3C8      --NGVTDAYQGGLFSQQRVKSYA----TLLTGDRLAKVVAAKTP----GLELTPAEVRE-
A0A4Y8WZJ3      --ESLGVALTADNLAKSKAQQYA----LLGESRAVSDKAVEEL-----PFDLSSGEALR-
A0A285VUW0      --ESSGNLY---QMPAGERSTLA----RIARSPLMLDPVRETL-----GLDASVPLSVE-
A0A2R7Z032      --SSAGEEMSNQSLASDKAALYV----ALANTTPVAERVVEKL-----GLDVDPGAIAG-
A0A6J4MTQ2      --TSAGEEAGNLALARDKAELYV----TLVPTTPVAERVVEEL-----SLDLPPSAVAS-
A0A1I0W453      --ATAGEEQGNAQLAEDKANLYA----FLVSKTPVAAQVVEDL-----DLDVPPEAIAG-
A0A1H4LCS9      --TTAGEEQNNAQLAEDKANLYA----FLVSKLPVAQLVVDDL-----GLDVPPEAIAG-
A0A4Q2RZP8      --TTAGEEQGNAQLAEDKANLYA----FLVSKLPVAQLVVDDL-----GLDVPPEAIAG-
A0A0Q6VV12      --TTAGEEQGNAALAEEKAGLYA----FLVSSMPVAEKVVDDL-----GLDVPPSEIAG-
A0A495NTA9      --TSAGEEQGNSALAEEKAGLYA----FLVNSEPVAEKVVEDL-----GLSTPPSEIAG-
A0A0Q9QB08      --GSAAEEQGNASLAEDKANLYA----FLVPTTPVAEQVVKEL-----GLDMPPSAIAS-
A0A4Q2SA86      --TTAGEEQGNAQLAEDKAVLYA----FLVSTTPVAEKVVEDL-----GLDVPPSAIAG-
A0A4Z1C3Z0      --ASAAEEQGNAQLAEDKAVLYA----YLVSTTPVAERVVEDL-----GLDVPPSAIAG-
A0A542J310      --GDVSNVSLGDSVARSRVPSYL----VMAGWTDVAEGVIADL-----GLETTPEALIE-
A0A4Q2JUT1      --GDVSNVSLGDSVARSRVPSYL----VMAGWTDVAQGVIDDL-----DLSTTPEALIQ-
A0A6L5R0V7      --GDVVNASLGDSVARSRVPSYL----VMAGWTDVAQGVIDDL-----ELTTTPEALIQ-
A0A444BL03      --ASTGESIAANSLGGSKADSYL----PLVTSRAVAQRAITAT-----GIDASPEDVAR-
A0A4Y8X357      --------ISGTETAQTRAQSYV----PLINSRTVRERISQG----------GVDTAGA-
R4LD52          --TGVTDAYQGGLFSQQRVKSYA----SLLVSDRLAQLVAAEP-----GVGLDARHIRE-
A0A4T2CD79      --GSIGDTVASDALAKSKATTYV----AVGESRAVAQLVITAL-----GLTASPETVAG-
A0A6L6AM03      --QSAGEEQGNATLAEDKANLYA----FLVSTTPVAEQVVEDL-----DLAIPPSAIAG-
A0A4Q2RU39      --ESAGEEQGNNQVAEDKANLYA----FLVSKTPVAQEVVDEL-----GLDVPPSAIAG-
A0A4Q2SK58      --STAGEEQSNSQLAEDKANLYA----FLVTKTPVAAEVVDDL-----GLDVPPEAIAG-
A0A2N3YJR1      --SSTGEGIAANALSGSKADSYL----PLVTSRAVAQRAIEAT-----GVKASPASVAS-
A0A6G8FYB9      --TSTGDSLAANSLGGSKADSYL----PLVTSRAVAERAIAAT-----GIDASPAEVAG-
A0A4Q4D742      --GGQTE-YVAAYTLQQRVASYA----DLAVDPAVLQTVVDRL-----NLDESPTQLAG-
A0A1C6T1J1      --EGVAAAYQGGLFLQQRIKSYA----DLLVSDRLAQSVVAEG-----QVGLTAEQIQG-
A0A2W2CFC8      --QGVSDAYQGGLFLQQRVKSYE----QLLTSDRLARSVVADN-----QLGLTAEQVRG-
A0A2W2A4B0      --SSALDLAQGTNAAQQRIHSYL----DLVPQPIVLQPVIDEL-----HLDVKASELAR-
A0A4Y9MDA5      --NSAGDLAQGSNYLQGQVTSFA----LLAETPTVLGPAGEAP-----DVAA-TGSLAG-
A0A1H7N9P7      --DSAGDLAQGSNYLQSQVASFA----LLAETPTVLGPAGEAP-----DVAAGSRSLAA-
A0A1M7V0F8      --DSAGDLAQGSNYLQSQVSSFA----LLAGTPTVLGPAGERA-----GVSADARSLAG-
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      SGIVLGVMVALIKDLLDTRVRRD-------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A4R1CW45      ----------------MAEAVSS-------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ----------MMGMAMSHELKRE-------------------------------------
A0A6J4SUA1      -------------LDRLDRRFRY-------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ----------MFGRSRLGTRIRD-------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ----------MRTRSSRGGAEVR-------------------------------------
A0A510HHA8      -----------MVRLNLKRRARE-------------------------------------
A0A6G8Q9J3      -----------MARPKVKRPARK-------------------------------------
A0A5Q2F9A3      ----------MLRNSLDTRVRTA-------------------------------------
A0A4R1BMZ2      --------------MIISRRKKR-------------------------------------
A0A023X491      --------------MARSKPLKK-------------------------------------
A0A6G8QDQ0      ----------MQQPKTESKMGKE-------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ---------------MARKNKTN-------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      -------------TIDAPVLSSV-------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      --------------------------------------------MSTFFSAREQAERDRA
A0A348NU28      ------------------------------------SIEVTIPLNTVILEIKSSSGDPES
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------VIDSNIATDTGNMRVVCRLPDPLR
A0A538AM15      ------------------------------------FFKALEQAERDRALQQGRAPEAPP
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------QVSVTNPTNTAFVNISVTDGDPAQ
A0A6N4VXX3      ------------------------------------EVTARSKAGTVLIDVDVLDPSPVR
A0A1H4I042      ------------------------------------EVSARSKMGTVLIDVDVLDPSPVR
A0A4R7A6D9      ------------------------------------EVSARSKMGTVLIDVDVLDPSPVR
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------AVAVTIPQNTVILDITAASADPRD
A0A255G8R8      -------------------------------------MTTTVPQKTVIVEVTVTDPDAAS
A0A6G7Y423      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------QVSVTNPTNTAFVNISVTDGNPAQ
A0A4Q5B0V3      ------------------------------------QVSVTNPTNTAFVNISVTDGNPAQ
A0A1Q2CRV2      ------------------------------------RVAVTIPAQTATMDLAVTADSPEE
A0A222TG79      ------------------------------------KLSTSWDPDTVLLNVTVEDSDRSV
A0A6I3DFP2      ------------------------------------ALDPQAASIQANIDALNQVEAERR
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------SLSVSTSPDTVLLVVTAENANPDL
A0A1L2ZMQ6      ------------------------------------SITAAVLEGSTELRVTASASDPVF
A0A3L8NYD3      ------------------------------------RFSAVGDADNPQLTIYATASSPSQ
A0A1M6K628      ------------------------------------DAKNDGVI----FEITAQAPTAEG
A0A561E8R3      ------------------------------------SVSAVSSV----INFTAISSTPNG
A0A3E2DN22      ------------------------------------QVSASVPGDTAFIDIKATGGTAKN
A0A3Q9ULZ9      ------------------------------------TLAAKVVSGTSFIKITATGSSALN
A0A3S9JFL2      ------------------------------------TLSAKVVTGTSFIRITATGSSAQN
A0A3L7ADK2      ------------------------------------RITALQPQDTVLIEITAKGPTGDS
A0A1Q2CI19      ------------------------------------QITVETQGESASVTITTTASDGER
A0A512T3M3      ------------------------------------RIDVGQDSEAMALTITSSNTDSKR
W6JTW4          ------------------------------------RIVVAPDPAASTISISATDPHATT
A0A0A0JTY0      ------------------------------------GLTVVTDPAAQAITVAATASDGKQ
A0A0A0JXF2      ------------------------------------GLTVTPDNAAEALTVSATASDGEE
E6S8H2          ------------------------------------GLTVTPDFSAGALTVAVTDAEGKR
A0A0A0JGH0      ------------------------------------QVTITSDPSGAALTIAASDRDGAK
N0E4U7          ------------------------------------QITVTPDPAAAALTIAASAPDGER
A0A0A0IYK2      ------------------------------------GLTVTPDVVAAAITVSATASDGSR
A0A0Q9L0H3      ------------------------------------GLTVTPDTVAQALTVSATASDGKQ
A3TMK0          ------------------------------------GLTVTPDTVSQALMVSATASDGKQ
A0A543PXP1      ------------------------------------GLTVTPDFNAAALTVAATAPDGQR
A3TMH6          ------------------------------------GLTVKPEFIATALTVSATASDGAR
A0A1H6WL79      ------------------------------------SISVSVPLDSVEIRITARSSDAQT
A0A101LAM5      ------------------------------------SISVSVPLDSVEIRVSARSSDPQT
A0A4Y3NEG0      ------------------------------------SVSVSVPLDSVEIRISARSSDPQT
A0A6I2XCV4      ------------------------------------LIAAQDQSNVSAIDVTAISTDPQF
A0A5R8VLL6      ------------------------------------AVTVTVPRDTAEMRIKAESPNPTT
A0A538JQF8      ----------------------------------SANVQARPNVEVGTLTITANDRDPKR
A0A1H6YPK1      ------------------------------------RISVSGSTETAIMLFTGTGSAPES
A0A2R7MGI0      ------------------------------------RVRVSNPVDTVNVRVDATGPTPES
A0A2T7WQY4      ------------------------------------RVRVSNPVETVNVRVDATGSTPES
A0A1G6GTN3      ------------------------------------RIRVSNPVDTVNVRVEATGPTPES
A0A1N7DLV3      ------------------------------------RIRVSNPVDTVNVRVDATGPTPEA
A0A1V2NSB5      ------------------------------------RVHVSNPVDTVNVRVDATGPTPEA
A0A0Q5Q5L3      ------------------------------------RIRVSNPVDTVNVRVDATGATPES
A0A0Q6DVM4      ------------------------------------RIRVSNPVDTVNVRVDATGATPES
A0A1R3WWR6      ------------------------------------RVHVSNPIDTVNVRVDATGPTPES
A0A0Q5JKD6      ------------------------------------RVRVSNPIETVNVRVDATGPTPES
A0A0Q9TBP0      ---------------------------------------VQAVGTSRILRVTAQDSSPDR
A0A5Q2FA83      ------------------------------------NVTAKAATGSPMLDITATSSSPRV
A0A346XTB0      ------------------------------------NFDIESSAETLEIVLVAEDETAEG
A0A0G3V3M7      KCTETGADATSPDCKKSGRRVSAGSGQVELGTGGFIKASAIPDPATGSLAITAQVGDAEL
A0A6I3DD56      KCAETGADSSSPDCKKSGRPVSAGSGQVQLGTGGFIKASATPDPATGSLAITAQVGDAVL
A0A2W6DK08      ------------------------------------KVTAVADKPSNAINITASDVDPQN
A0A2S0LQ32      ------------------------------------SLTGAAEPSSPIVTITAVSSDPSR
A0A2N6V1R5      ------------------------------------TLSGSADAVPGLFTLTATASTPER
G9PHS6          ------------------------------------TLSGSADAVPGLFTLTATASTPER
U1PLM7          ------------------------------------TLSGSADAVPGLFTLTATASTPER
A0A6I1G2U1      ------------------------------------QLTVTPNPSAQSLTVEMSGADAEY
A0A351ETF8      ------------------------------------EVKVAAAGTGSTLTFNARGAVPED
A0A542FTE6      ------------------------------------ATTPYLADDSSLIQISASASTPEA
A0A349B7N2      ------------------------------------QVQVRQNPQVATLDITSVGTDPDR
A0A2S5UYV0      ------------------------------------RLSASVAPGSNLIQVQASADSPSS
A0A2S5X9U6      ------------------------------------RLSATVAPNSNLINVQATASTPSS
A0A2S5ULV5      ------------------------------------RLSATVAPNSNLIQVSASASTPSS
A0A653YMF0      ------------------------------------RLSATVAPSSNLIQVSASASTPSS
A0A346Y185      ------------------------------------QSRIRPASDLDQLSISATDGTASG
A0A259S8H9      ------------------------------------SLSARVVPGSTLVEVTADAADPKS
A0A0Q5L115      ------------------------------------RVTTSLPEDTAIITVTSRGSTPAD
A0A2W1Z497      ------------------------------------RVQTRLPEGTAIIDVTASGATPRE
A0A4V1VGV9      ----------------------------------------ASSEGSATLTLTASAATPAK
A0A3Q9IY80      ------------------------------------RVQVSNPTDTVNIRVVASASSPEG
A0A0F0LP73      ------------------------------------SLSAQVVPGSTMVRVTANAPDPQS
A0A1F1X071      ------------------------------------SLQTTLDPNAPIITVEAVAPTAEE
A0A3R8RWC7      ------------------------------------SLQTTLDPNAPIITVEAVAPTAEE
A0A4U0RJZ4      ----------------------------------------AGSEGTSNLSLTASSSSAAK
A0A4R1FGL9      ----------------------------------------AGSEGTSNLSLTASSSSAAK
E3B8H1          ----------------------------------------AGSEGTSNLSLTASSSSAAK
A0A7D7WDT9      ------------------------------------ALSADVVPGSTMIRVTATSSSPKA
A0A0Q5AWK6      ------------------------------------RLTASVAPGSTLIQVTAEASTPEN
A0A6P1F176      ------------------------------------RLTAAVAPGSTLIEVTAAASTPEN
A0A3N1NLD3      ------------------------------------RLTAAVAPGSTLIEVTASASTPEN
A0A3N2FVI8      ------------------------------------RLTAAVAPGSTLIEVTASAATPEN
A0A2S5XDQ6      ------------------------------------RLTARVAPGSTLIEVTAAAGTAQN
A0A2S5XNN6      ------------------------------------RLTARVAPGSTLIEVTAEAGTAQN
A0A4Q4D4T1      ------------------------------------EVVG----NSSVVRVVVRTTDPER
A0A261FE22      ------------------------------------NVSASASDGSAFVSMTVTYSDPND
A0A5C8C085      ------------------------------------RISAEQPTDTVLIKITAKADSPHA
A0A1E4BP96      ------------------------------------NVTVSNPLDTVVIHVAATAATPES
A0A439DNZ6      ------------------------------------KVKASSKLDTVLINVSVLDESPVR
A0A0J6YE86      ------------------------------------RITATAKPDTVLIDVAVLDESAVR
A0A5Q5BFU2      ------------------------------------NVKAGAKPDTVLIDVAVLDQSPVR
A0A151BT98      ------------------------------------TVSATLSDTANIMTATASSGSAQE
A0A2Y8ZRF8      ------------------------------------NVNATLSDTANIMTGTASSGSAQE
A0A2R9UAT1      ------------------------------------RVDVTNATGTVTIKVQASAPTPET
A0A4Q5J5D7      ------------------------------------KISVEQPLDTVLIKVTARDATPLG
A0A1Y4CKD6      ------------------------------------TIEAQTIDNSNMVTMWVDSASPEN
A0A3S0V9U6      ------------------------------------HLEPSVEDGSTLIRVRATASSPED
A0A1S2N0P2      ------------------------------------HLSASVEPNSTLIKVTATASSPQD
A0A0Q3BEY5      ------------------------------------HLSASVEPNSTLIKVTATASSPQD
A0A4R6Q3C6      ------------------------------------HLSASVEPNSTLIKVTATASSPQD
A0A2X3GKL3      ------------------------------------HLSASVEPNSTLIKVTATASSPQD
A0A0Q7KBQ4      ------------------------------------QVTAQIIATTQTLQVDVTADSAEL
A0A1F1IHY9      ------------------------------------NVEVASTSGSAQIVVRAEDSSPER
A0A542HCT5      ------------------------------------RITVKQPLDTVGIKISARASTPRG
A0A2S8WHZ8      ------------------------------------KVEVTVPTNTAEIRVTASSQGAEE
A0A537WNY9      ------------------------------------AISVETFKGTGIIKITARSTSRSL
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------SVSCSQVSGTNLLTLSVTSPTPRQ
A0A0Q5M6Z7      ------------------------------------HIQASLPADTAVIEITARASTPDG
A0A3N3ZPU0      ------------------------------------DVAFSVVPGTSQIKVEGRSDSPEG
A0A359IQX7      ------------------------------------SLSPGVTGGSVLFTVTAIAPTPSE
A0A433EDP2      ------------------------------------SVTASTDENSSLIKVSAHASTPEQ
A0A231VTW0      ------------------------------------SVTASTDENSSLIKVSAHASTPEQ
A0A433ECD0      ------------------------------------SVTASTDENSSLIKVSAHASTPEQ
U7V3Z1          ------------------------------------SVTASTDENSSLIKVSAHASTPEQ
A0A1F1J417      ------------------------------------SLSATTEENSSLIKVRATASSPEQ
A0A2A8D6P2      ------------------------------------SLSATTEENSSLIKVRATASSPEQ
A0A1F0THV9      ------------------------------------SLSATTEENSSLIKVRATASSPEQ
A0A5F0M6Y0      ------------------------------------SLSATTEENSSLIKVRATASSPEQ
D8USQ4          ------------------------------------SLSATTEENSSLIKVRATASSPEQ
E3H5W1          ------------------------------------SLSATTEENSSLIKVRATASSPEQ
A0A1F1QKB0      ------------------------------------SLSATTEENSSLIKVRATASSPEQ
A0A509JY23      ------------------------------------SLSATTEENSSLIKVRATASSPEQ
A0A448USF4      ------------------------------------SLSATTEENSSLIKVRATASSPEQ
A0A0Q9LZR0      ------------------------------------SITVTQPVDTVLLKISARAATPRG
A0A1N7E3F1      ------------------------------------RITANAIPETTLLRATVADSVPTR
A0A544ZKQ1      ------------------------------------RITAGAVPDTTLLRATVADSVPAR
A0A372P1T1      ------------------------------------RITADAIPDTTLLRATVADSVPVR
A0A5D0Q2X0      ------------------------------------RITADAIPDTTLLRATVADSVPVR
A0A5R8Z2E7      ------------------------------------RITADAIPDTTLLRATVADSVPVR
A0A1L2ZMV4      ------------------------------------GVTFTKDPSNSQIRVTATAENPEH
A0A6I3F378      ------------------------------------KFNTSTTSD--VVTFFVESPDAQL
A0A1E9T6I0      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1S1CQC5      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1S1CAD0      ------------------------------------SITAAAGENAALITVSAKASSPKN
G5ET14          ------------------------------------SITAAAGENAALITVSAKASSPKN
A0A1E9DXX2      ------------------------------------SLTATAGENAALITVNAKASSPKN
A0A1E8S156      ------------------------------------SLTATAGENAALITVSAKASSPKN
A0A1E8S5S2      ------------------------------------SLTATAGENAALITVSAKASSPKN
A0A1S1DFA8      ------------------------------------SLTATAGENAALITVSAKASSPKN
A0A2I1Z490      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1F0DAA9      ------------------------------------SLTATAGDNAALITVNAKASSPKN
A0A1F0PHK9      ------------------------------------SLTATAGDNAALITVNAKASSPKN
A0A1F0VZG6      ------------------------------------SLTATAGDNAALITVNAKASSPKN
A0A1E9G8X4      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1E9IAW2      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1E9ZBC9      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1E9ZDP4      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1F0R6B5      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1F0Z7N5      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1F1D897      ------------------------------------SLTATAGDNAALITVSAQASSPKN
D2NP38          ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1F1FV74      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1E9M791      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A291DEI8      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1S1D5T1      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1E8TRD6      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1F0XT88      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1F1EVP5      ------------------------------------SLTATAGDNAALITVSAQASSPKN
C6R548          ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A0K2RXS2      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A1F0KX60      ------------------------------------SLTATAGDNAALITVSAQASSPKN
A0A542I3V2      ------------------------------------TVSVNVPVETAEIRITATSPDPVM
A0A2T0UZ65      ------------------------------------RVAGSVAPGSVILKINATGPTPTD
A0A1R4JTI6      ------------------------------------AVTATVPPDTAEVRLSVVQDSPDA
A0A4R7TM52      ------------------------------------QVKVTNPTDTVNLVVQASASTPEG
A0A542XE74      ------------------------------------TVTATASEGSPFINVTAQAPTARD
A0A0G3V3F3      ------------------------------------LISASAVGDLGFLEVYAKGPSVSE
A0A0Q7QDF6      ------------------------------------EVRGEVVGNSSVVRVVVRTTDPER
A0A5R8L819      ------------------------------------RVAVTNPLDTVNINVRAQASTPEG
A0A261FQA1      ------------------------------------SVSASVDASG-LMTVTATSSDSQQ
A0A1Q2CJ92      ------------------------------------NLEGSV--DGVIFRIRATADSPEL
A0A2T0S3C8      ------------------------------------RITAEALPETVLLQATVTDGSAER
A0A4Y8WZJ3      ------------------------------------NVEVASTSGSAQIVVRAEDSSPER
A0A285VUW0      ------------------------------------AVPGG--DDTALFDFVVRSDSPDH
A0A2R7Z032      ------------------------------------RFSASVDTDINLLTVQAIGTTPEE
A0A6J4MTQ2      ------------------------------------RFTASVDATGIVLTVQATGTSPVE
A0A1I0W453      ------------------------------------RFSASVDADVNALTVTAIGTTPEE
A0A1H4LCS9      ------------------------------------NFSASVDTTVNALTVTATASTPQD
A0A4Q2RZP8      ------------------------------------NFSASVDTSVNALTVTAVSTSPTD
A0A0Q6VV12      ------------------------------------RFSATVNADVNALTITAIGSTPEQ
A0A495NTA9      ------------------------------------RFTATVNADVNALTVTAIGSTPEE
A0A0Q9QB08      ------------------------------------RFSATVNSDVNAITISAVGTTPEE
A0A4Q2SA86      ------------------------------------RFSASVDASVNALTVTAIGSTPEE
A0A4Z1C3Z0      ------------------------------------RFSASVDASVNALTVTAIGSTPQE
A0A542J310      ------------------------------------RIVVENPAGTVILSVTARAETAEG
A0A4Q2JUT1      ------------------------------------RVTVENPTGTVILSVTAQAPTAEG
A0A6L5R0V7      ------------------------------------RVTVDNPSGTVILSVTAEASTAED
A0A444BL03      ------------------------------------RVTGTVAENSVIMQVTATGPTPDE
A0A4Y8X357      ------------------------------------SLSAALVPGSNLITVSAIAPDAQQ
R4LD52          ------------------------------------RVAAQAVPETVLLQATVTDTDRDR
A0A4T2CD79      ------------------------------------EITVTNIKDTPTINVTARASSGIE
A0A6L6AM03      ------------------------------------RFSASVDAEVNSLTVSAVGSTPEE
A0A4Q2RU39      ------------------------------------RFSATVDASVNSITISAIGTTPVE
A0A4Q2SK58      ------------------------------------RFSASVDAAVNSLTVSAVGTTPEE
A0A2N3YJR1      ------------------------------------RVTASVAPDSVILKVTATAPSPEE
A0A6G8FYB9      ------------------------------------RVGASVAANSVILKVTATGPTPEE
A0A4Q4D742      ------------------------------------QISATVVTGTINIQIDVTADTAEQ
A0A1C6T1J1      ------------------------------------RVSTSTETGTVLLRASVTDTDQTR
A0A2W2CFC8      ------------------------------------RISTSTETGTVLLRASVVDTDQTR
A0A2W2A4B0      ------------------------------------SVSATSPTGSVVMQIAVTSPDRQR
A0A4Y9MDA5      ------------------------------------QVTATVVPDTVIVAITATDPSADR
A0A1H7N9P7      ------------------------------------QVSASVVPETVVVQISATDPSPAR
A0A1M7V0F8      ------------------------------------RVTATVVPETVVVRIAATDPSPAR
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------SDVTTVIDAPVLGSLSRNEAYVGT
A0A357ZCV8      ------------------------------------------------------------
A0A4R5Z7B0      -------------------------------------------------------MVFKK
A0A6M8GFV5      -----------------------------------------------------------M
A0A4R1CW45      ------------------------------------SMNIKSLQLETLRVVQPNRDAVAS
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      -----------------------------------------------------------M
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ---------------------------------------------KPVVGTIPEEKSFTA
A0A1I6IST1      ---------------------------------------------KPVVGTIPEEKSFTA
A0A412JBM5      ------------------------------------SGHMRPAC----------------
A0A6J4SUA1      ------------------------------------PEQVTDDLGLDILGAVPMLRSP-R
A0A1C2B334      ------------------------------------MGVVDSPV----IGLVPGDSAL-D
R7Y679          ------------------------------------EGDLDDAIGVHSLGVVASDGAF-A
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------S-----------------------
A0A510HHA8      ------------------------------------EQRNGDLSGRLITLHD--------
A0A6G8Q9J3      ------------------------------------GNAEGGPSASLVTVTD--------
A0A5Q2F9A3      ------------------------------------SDVAQLTDSPLVGRIGYDAASERG
A0A4R1BMZ2      ------------------------------------SEREEDLSGRLVTILD--------
A0A023X491      ------------------------------------HKKTENLTDRLVSLSD--------
A0A6G8QDQ0      ------------------------------------TGASAIAAENLITLAE--------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ---------------------------------------MPHVERRNGSGEE--------
A0A6D1QMN1      ------------------------------------QPDMSEKQRSLITEFD--------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------MGEHLVSLLN--------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------AYDADVPKHPLLTEVG--------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      LRGQIESS----------------------------------------------------
A0A348NU28      AAEIANGV-------------------ADSLTAVVR------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      AERCANAF-------------------AKQAVVFSK------------------------
A0A538AM15      PAPVVPEV-------------------HTANEAAPR------------------------
A0A022KX11      ---------------------------------MAG------------------------
A0A4Q5A868      AADIANAI-------------------AKSLSSVV-------------------------
A0A6N4VXX3      ARDIANTL-------------------SSEFVAMVK------------------------
A0A1H4I042      ARDIANTL-------------------SDQFVKMVR------------------------
A0A4R7A6D9      ARDIANTL-------------------SDQFVKMVR------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A4Y5YMQ6      AAEIANSV-------------------ADNLTEVVY------------------------
A0A255G8R8      AARIANAI-------------------GDQVAETVR------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q5APW3      AADIANAI-------------------AKSLSSVVE------------------------
A0A4Q5B0V3      AADIANAI-------------------AKSLSSVVE------------------------
A0A1Q2CRV2      AARIAHAI-------------------TERLIVAVD------------------------
A0A222TG79      AVVLANSV-------------------AASLQDYVE------------------------
A0A6I3DFP2      AQPANRVN----------------------------------------------------
A0A2S5WZJ5      ------------------------------MADVIT------------------------
K6WHS4          AARLASGV-------------------SQALIEYVE------------------------
A0A1L2ZMQ6      AQQLANVW-------------------IDALAEEAH------------------------
A0A3L8NYD3      ARDLANAV-------------------IGAMSTEAA------------------------
A0A1M6K628      ARLMADAG-------------------IRATSVAAN------------------------
A0A561E8R3      ARELADAA-------------------VNATRDEAA------------------------
A0A3E2DN22      AQALANAG-------------------LEALISEAL------------------------
A0A3Q9ULZ9      AQSLANAA-------------------LVGLQAEAL------------------------
A0A3S9JFL2      AQALANAA-------------------LVGVQAEAL------------------------
A0A3L7ADK2      ARTLADAW-------------------ITAMSEQIE------------------------
A0A1Q2CI19      AANVVNTF-------------------ANETIAFFE------------------------
A0A512T3M3      AGLIVNTF-------------------ADEAVAFFS------------------------
W6JTW4          AESIAQTF-------------------AEAAKAYFA------------------------
A0A0A0JTY0      AAAVANAF-------------------ANETINYIK------------------------
A0A0A0JXF2      AAAVANAF-------------------ATETVKFFK------------------------
E6S8H2          AASIANTF-------------------ADETVTYFK------------------------
A0A0A0JGH0      AAETANAF-------------------AKQTVAFFA------------------------
N0E4U7          AAATANAF-------------------ADETVAFFE------------------------
A0A0A0IYK2      AAAVANAF-------------------ATETVKFFR------------------------
A0A0Q9L0H3      AAAVANAF-------------------ATETVKFIE------------------------
A3TMK0          AAAVANAF-------------------ANQTVLFIE------------------------
A0A543PXP1      AAAVANAF-------------------ADETVAFFK------------------------
A3TMH6          AAAVANAF-------------------ADEAVSFFD------------------------
A0A1H6WL79      AQNVADAW-------------------VAALASQVY------------------------
A0A101LAM5      AQNVADAW-------------------VTALAAQVY------------------------
A0A4Y3NEG0      AQNVADAW-------------------VAALASQVY------------------------
A0A6I2XCV4      AVTLADTSAKILMDSWSTDSKRRAAESSDAVIARID------------------------
A0A5R8VLL6      AQRVADAW-------------------IVELARQVE------------------------
A0A538JQF8      AALIADTFADSLKTVLADQTTQRRQLQIDSQLKAAE------------------------
A0A1H6YPK1      AQELVNAW-------------------MDATFLVVS------------------------
A0A2R7MGI0      ARDLAEAW-------------------IRGMTTQVD------------------------
A0A2T7WQY4      ARDLAEAW-------------------IRGMTTQVD------------------------
A0A1G6GTN3      ARDLAEAW-------------------IRGMTVEVD------------------------
A0A1N7DLV3      ARDLAQAW-------------------LQGMTVQVD------------------------
A0A1V2NSB5      ARDLAQAW-------------------LHGMTVQVD------------------------
A0A0Q5Q5L3      ARDLAEAW-------------------IRAMTTQVD------------------------
A0A0Q6DVM4      ARDLAEAW-------------------IRAMTTQVD------------------------
A0A1R3WWR6      ARDLAEAW-------------------IRGMTTEVD------------------------
A0A0Q5JKD6      ARDLAEAW-------------------IRGMTEEVD------------------------
A0A0Q9TBP0      AARTANIVATSYLQFREQDSVGRYEQARDRLAQEQA------------------------
A0A5Q2FA83      AADAANAVGPQ----------------LASIGKEFA------------------------
A0A346XTB0      AAELVNAVAEAYRTQKRAQEVQRAEDAVAELRAQQV------------------------
A0A0G3V3M7      AAKVANLFAAKLVGYVDELGQKQYDEQIFGLTISRG------------------------
A0A6I3DD56      AAKVANLFAATLVGYVDELGQKQFDEQIFGLTLSRS------------------------
A0A2W6DK08      AVALANAFAAGTVDEFRARHAAAAAARFRSLEGQLT------------------------
A0A2S0LQ32      ARDLANAA-------------------IPALGSYIA------------------------
A0A2N6V1R5      ARDIANAG-------------------IKAVSDEAN------------------------
G9PHS6          ARDIANAG-------------------IKAVSDEAN------------------------
U1PLM7          ARDIANAG-------------------IKAVSDEAN------------------------
A0A6I1G2U1      VAAVANAFAEQSVAYFATPRDGTGEAELSILAE---------------------------
A0A351ETF8      LAAAANVWAQTYVTARYAETLAQNVESIEFLQALIA------------------------
A0A542FTE6      ARVLADAW-------------------IAAMSQRVE------------------------
A0A349B7N2      AVRIADGFAGALLATLTETTQQERAEAQTRLSARLD------------------------
A0A2S5UYV0      AVALANGA-------------------LQALADVIT------------------------
A0A2S5X9U6      AVALANGA-------------------LQAMADVIT------------------------
A0A2S5ULV5      AVALANGA-------------------LQAMADVIT------------------------
A0A653YMF0      AVALANGA-------------------LQAMADVIT------------------------
A0A346Y185      AAQIANAIGEAYQAVVREEAERSTQASLSELQTQRA------------------------
A0A259S8H9      ALKLANGA-------------------LHALAKVVA------------------------
A0A0Q5L115      AAALTDAW-------------------LAAMGEQIA------------------------
A0A2W1Z497      SADLADAW-------------------IAGMGRQIA------------------------
A0A4V1VGV9      AQRAADLA-------------------RTALADEAK------------------------
A0A3Q9IY80      ARDLAQAW-------------------IRAMATEVE------------------------
A0A0F0LP73      ALRLANGA-------------------LHALANVVA------------------------
A0A1F1X071      ASAIANAA-------------------VEATAAEAR------------------------
A0A3R8RWC7      ASAIANAA-------------------VEATAAEAR------------------------
A0A4U0RJZ4      AQQAANLA-------------------PAALSQEIK------------------------
A0A4R1FGL9      AQQAANLA-------------------PAALSQEIK------------------------
E3B8H1          AQQAANLA-------------------PAALSQEIK------------------------
A0A7D7WDT9      ALELANGS-------------------LHALAAVVE------------------------
A0A0Q5AWK6      AAALANGA-------------------LAALAAVIA------------------------
A0A6P1F176      AAALANGA-------------------LAALAEVIA------------------------
A0A3N1NLD3      AAALANGA-------------------LAALADVIA------------------------
A0A3N2FVI8      AAALANGA-------------------LAALADVIA------------------------
A0A2S5XDQ6      AAALANGA-------------------LAALAAVIT------------------------
A0A2S5XNN6      AAALANGA-------------------LAALAAVIT------------------------
A0A4Q4D4T1      AAQLAGQV-------------------AEELVSWIA------------------------
A0A261FE22      TVTILNEV-------------------VKQLNKQIT------------------------
A0A5C8C085      AQALADAW-------------------IVALQDQIE------------------------
A0A1E4BP96      ARDLAEAW-------------------IRGMTAAID------------------------
A0A439DNZ6      ARDIADAL-------------------SEEFVVMVR------------------------
A0A0J6YE86      ARDIANTL-------------------SDEFVGRVR------------------------
A0A5Q5BFU2      ARDIANTL-------------------SDEFVAMVR------------------------
A0A151BT98      AAAIANAT-------------------GPALAAVAP------------------------
A0A2Y8ZRF8      AAAIANAT-------------------GPALAAVAP------------------------
A0A2R9UAT1      ARDLAEAW-------------------IQGMATEID------------------------
A0A4Q5J5D7      AQQLADAW-------------------VSALADQVA------------------------
A0A1Y4CKD6      ARAILEKA-------------------LEVYPEVSR------------------------
A0A3S0V9U6      AVALANAS-------------------LKATADTVN------------------------
A0A1S2N0P2      AATLANNA-------------------LQATADYVS------------------------
A0A0Q3BEY5      AATLANNA-------------------LQATADYVS------------------------
A0A4R6Q3C6      AATLANNA-------------------LQATADYVS------------------------
A0A2X3GKL3      AATLANNA-------------------LQATADYVS------------------------
A0A0Q7KBQ4      AQQIAEAE-------------------AEGIVSLVA------------------------
A0A1F1IHY9      AQQLASAW-------------------LGALEAQAT------------------------
A0A542HCT5      AQQLADAW-------------------VAALARQVQ------------------------
A0A2S8WHZ8      ARNLADAW-------------------VVALAAQVE------------------------
A0A537WNY9      AQQSAQAA-------------------TDALVERTR------------------------
A0A5B8M469      ---------------------------------MIT------------------------
A0A1Y4CTD2      AYLFIQSA-------------------LQNYERVSG------------------------
A0A0Q5M6Z7      AAKLANAW-------------------IAGLTKQVR------------------------
A0A3N3ZPU0      SAKVADAY-------------------AGALTQEVQ------------------------
A0A359IQX7      AKDAADLG-------------------LTATADAAA------------------------
A0A433EDP2      AQVLANSA-------------------LHATAEYIK------------------------
A0A231VTW0      AQVLANSA-------------------LHATAEYIK------------------------
A0A433ECD0      AQVLANSA-------------------LHATAEYIK------------------------
U7V3Z1          AQVLANSA-------------------LHATAEYIK------------------------
A0A1F1J417      ARVLANSA-------------------LHATAQYIE------------------------
A0A2A8D6P2      ARVLANSA-------------------LHATAQYIE------------------------
A0A1F0THV9      ARVLANSA-------------------LHATAQYIE------------------------
A0A5F0M6Y0      ARVLANSA-------------------LHATAQYIE------------------------
D8USQ4          ARVLANSA-------------------LHATAQYIE------------------------
E3H5W1          ARVLANSA-------------------LHATAQYIE------------------------
A0A1F1QKB0      ARVLANSA-------------------LHATAQYIE------------------------
A0A509JY23      ARVLANSA-------------------LHATAQYIE------------------------
A0A448USF4      ARVLANSA-------------------LHATAQYIE------------------------
A0A0Q9LZR0      AQQLADAW-------------------VAALARQVQ------------------------
A0A1N7E3F1      AAARANAL-------------------GAAFARLID------------------------
A0A544ZKQ1      AAARANAL-------------------GAAFAQLID------------------------
A0A372P1T1      AAARANTL-------------------GATFAALID------------------------
A0A5D0Q2X0      AAARANTL-------------------GATFAALID------------------------
A0A5R8Z2E7      AAARANTL-------------------GATFAALID------------------------
A0A1L2ZMV4      ARASADAF-------------------ASALAEEAE------------------------
A0A6I3F378      AADVANAY-------------------IEQYNIYTAKISADTLAGAVD------------
A0A1E9T6I0      AQLLANSA-------------------LQATADYIK------------------------
A0A1S1CQC5      AQLLANSA-------------------LQATADYIK------------------------
A0A1S1CAD0      AQLLANGA-------------------LQATADYIK------------------------
G5ET14          AQLLANGA-------------------LQATADYIK------------------------
A0A1E9DXX2      AQLLANSA-------------------LQATADYIK------------------------
A0A1E8S156      AQLLANGA-------------------LQATADYIK------------------------
A0A1E8S5S2      AQLLANGA-------------------LQATADYIK------------------------
A0A1S1DFA8      AQLLANGA-------------------LQATADYIK------------------------
A0A2I1Z490      AQLLANGA-------------------LQATADYIK------------------------
A0A1F0DAA9      AQVLANSA-------------------LQATADYIK------------------------
A0A1F0PHK9      AQVLANSA-------------------LQATADYIK------------------------
A0A1F0VZG6      AQVLANSA-------------------LQATADYIK------------------------
A0A1E9G8X4      AQLLANGA-------------------LQATADYIK------------------------
A0A1E9IAW2      AQLLANGA-------------------LQATADYIK------------------------
A0A1E9ZBC9      AQLLANGA-------------------LQATADYIK------------------------
A0A1E9ZDP4      AQLLANGA-------------------LQATADYIK------------------------
A0A1F0R6B5      AQLLANGA-------------------LQATADYIK------------------------
A0A1F0Z7N5      AQLLANGA-------------------LQATADYIK------------------------
A0A1F1D897      AQLLANGA-------------------LQATADYIK------------------------
D2NP38          AQLLANGA-------------------LQATADYIK------------------------
A0A1F1FV74      AQLLANGA-------------------LQATADYIK------------------------
A0A1E9M791      AQLLANGA-------------------LQATADYIK------------------------
A0A291DEI8      AQLLANGA-------------------LQATADYIK------------------------
A0A1S1D5T1      AQLLANGA-------------------LQATADYIK------------------------
A0A1E8TRD6      AQLLANGA-------------------LQATADYIK------------------------
A0A1F0XT88      AQLLANGA-------------------LQATADYIK------------------------
A0A1F1EVP5      AQLLANGA-------------------LQATADYIK------------------------
C6R548          AQLLANGA-------------------LQATADYIK------------------------
A0A0K2RXS2      AQLLANGA-------------------LQATADYIK------------------------
A0A1F0KX60      AQLLANGA-------------------LQATADYIK------------------------
A0A542I3V2      AQRVADAW-------------------VAELAKRVQ------------------------
A0A2T0UZ65      ARDLADAT-------------------MEAVAAEAN------------------------
A0A1R4JTI6      ARALADSW-------------------VSSLAEEVS------------------------
A0A4R7TM52      ARDLAQAW-------------------VKAMSNEVK------------------------
A0A542XE74      AQALANAT-------------------LSALRVEAL------------------------
A0A0G3V3F3      AEQLSSAA-------------------TVALIDAVRAQQTASLAQDIAPIQAQRVILQKQ
A0A0Q7QDF6      AAQLAGQV-------------------AEELVSWIA------------------------
A0A5R8L819      ARDLAQAW-------------------LAGMAVEVQ------------------------
A0A261FQA1      AADIANAV-------------------YDSLVQQIE------------------------
A0A1Q2CJ92      AASLADAA-------------------IRATSVEAN------------------------
A0A2T0S3C8      SRLIAGVL-------------------AREFTTMVE------------------------
A0A4Y8WZJ3      AQQLASAW-------------------LGALEAQAT------------------------
A0A285VUW0      ASAVAEAL-------------------PQQLATTAR------------------------
A0A2R7Z032      ARDLASIV-------------------VQAIADEAE------------------------
A0A6J4MTQ2      ARDLANAV-------------------VAAVAEEAA------------------------
A0A1I0W453      ARDLANAV-------------------VDAVVVVAQ------------------------
A0A1H4LCS9      AQDLANAV-------------------IKAVVVYAA------------------------
A0A4Q2RZP8      ARDLANAV-------------------IDAVVIYAA------------------------
A0A0Q6VV12      ARDLANGV-------------------VDAVVEYAQ------------------------
A0A495NTA9      ARDLATSV-------------------VDAVVEYAQ------------------------
A0A0Q9QB08      ARDLANAV-------------------VDAVVVVAQ------------------------
A0A4Q2SA86      ARDLASAV-------------------VDAVVVYAQ------------------------
A0A4Z1C3Z0      ARDLATAV-------------------VDAVVVYAQ------------------------
A0A542J310      ARALAEAW-------------------LSSLGEVVD------------------------
A0A4Q2JUT1      ARELAEAW-------------------LISLGSVVE------------------------
A0A6L5R0V7      ARRLAEAW-------------------LTSLGTVVE------------------------
A0A444BL03      SRRLADAV-------------------IKATAQEAN------------------------
A0A4Y8X357      AAALANTA-------------------LVATADVAN------------------------
R4LD52          SARIATVL-------------------AGQFKQLVE------------------------
A0A4T2CD79      AKKLADAW-------------------IVGLTTQIA------------------------
A0A6L6AM03      ARDLANAV-------------------VEAVVVVAQ------------------------
A0A4Q2RU39      ARDLANAV-------------------VDAVVVVAE------------------------
A0A4Q2SK58      ARDLANAV-------------------VDAVVVVAR------------------------
A0A2N3YJR1      ARVLADAV-------------------IKATAEEAN------------------------
A0A6G8FYB9      SRVLADAV-------------------IKATAEEAN------------------------
A0A4Q4D742      AQLIAGAE-------------------ADAIVALVK------------------------
A0A1C6T1J1      ALKLTELL-------------------SAKFVDLVQ------------------------
A0A2W2CFC8      ALRVTEAV-------------------SAKFVELVK------------------------
A0A2W2A4B0      VAEITDSI-------------------VRSFSSVVQ------------------------
A0A4Y9MDA5      AAAIANAV-------------------ATQLERAVL------------------------
A0A1H7N9P7      AAAIANAV-------------------AAELELAVE------------------------
A0A1M7V0F8      AAAIADAV-------------------ADQLERTVE------------------------
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      SPVIISRP----------------------------------------------------
A0A357ZCV8      ---MARHR----------------------------------------------------
A0A4R5Z7B0      NKKVRTTD----------------------------------------------------
A0A6M8GFV5      SKQTAKET----------------------------------------------------
A0A4R1CW45      NNVVGFDS----------------------------------------------------
A0A419GS64      MAMKTKSR----------------------------------------------------
A0A2V2CXY5      ASEGRAGM----------------------------------------------------
A0A2S8MDM2      ---LDKER----------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      DNRLLPFD----------------------------------------------------
A0A1I6IST1      DNRLLPFD----------------------------------------------------
A0A412JBM5      DRKLLTY-----------------------------------------------------
A0A6J4SUA1      ARDISP------------------------------------------------------
A0A1C2B334      GEGFVDFG----------------------------------------------------
R7Y679          DRSLIDFR----------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      -------P----------------------------------------------------
A0A510HHA8      -------P----------------------------------------------------
A0A6G8Q9J3      -------P----------------------------------------------------
A0A5Q2F9A3      LTLISDAI----------------------------------------------------
A0A4R1BMZ2      -------P----------------------------------------------------
A0A023X491      -------P----------------------------------------------------
A0A6G8QDQ0      -------P----------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      -------G----------------------------------------------------
A0A6D1QMN1      -------Q----------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      -------P----------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      -------S----------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ----------------EISPSSANGSSRISANL---------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      ----------------EFSTLLKSSGQ---------------------------------
A0A4Q5A868      ----------------ETTLYASGSHS---------------------------------
A0A6N4VXX3      ----------------QLETSGDGNLP---------------------------------
A0A1H4I042      ----------------ELETPGDGSLP---------------------------------
A0A4R7A6D9      ----------------ELETPGDGSLP---------------------------------
A0A345NSU7      --------------------MLQMSGS---------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A4Y5YMQ6      ----------------DIAPKDDRGES---------------------------------
A0A255G8R8      ----------------ELSPKRD-GQD---------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A1Q2CRV2      ----------------ELSPPGADGQKP--------------------------------
A0A222TG79      ----------------SLETPAGGGSP---------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A2S5WZJ5      ----------------DVETQVGGGVS---------------------------------
K6WHS4          ----------------VLEVPSAGGDP---------------------------------
A0A1L2ZMQ6      ----------------DIES----------------------------------------
A0A3L8NYD3      ----------------KLES----------------------------------------
A0A1M6K628      ----------------ELET----------------------------------------
A0A561E8R3      ----------------QIET----------------------------------------
A0A3E2DN22      ----------------RMET----------------------------------------
A0A3Q9ULZ9      ----------------RMET----------------------------------------
A0A3S9JFL2      ----------------RMET----------------------------------------
A0A3L7ADK2      ----------------AIQG----------------------------------------
A0A1Q2CI19      ----------------T-SP----------------------------------------
A0A512T3M3      ----------------G-TR----------------------------------------
W6JTW4          ----------------K-AS----------------------------------------
A0A0A0JTY0      ----------------EKPR----------------------------------------
A0A0A0JXF2      ----------------ETSP----------------------------------------
E6S8H2          ----------------K-NR----------------------------------------
A0A0A0JGH0      ----------------K-PR----------------------------------------
N0E4U7          ----------------K-GA----------------------------------------
A0A0A0IYK2      ----------------ERSR----------------------------------------
A0A0Q9L0H3      ----------------ERKR----------------------------------------
A3TMK0          ----------------QARR----------------------------------------
A0A543PXP1      ----------------Q-SR----------------------------------------
A3TMH6          ----------------T-PR----------------------------------------
A0A1H6WL79      ----------------ELDK----------------------------------------
A0A101LAM5      ----------------ELDK----------------------------------------
A0A4Y3NEG0      ----------------ELDK----------------------------------------
A0A6I2XCV4      ----------------ELAAKRDELESQIAR-----------------------------
A0A5R8VLL6      ----------------ERER----------------------------------------
A0A538JQF8      ----------------QIQGQINDINLQIARAP---------------------------
A0A1H6YPK1      ----------------DVER----------------------------------------
A0A2R7MGI0      ----------------DLET----------------------------------------
A0A2T7WQY4      ----------------ELET----------------------------------------
A0A1G6GTN3      ----------------QLET----------------------------------------
A0A1N7DLV3      ----------------QLES----------------------------------------
A0A1V2NSB5      ----------------QLES----------------------------------------
A0A0Q5Q5L3      ----------------ELES----------------------------------------
A0A0Q6DVM4      ----------------ELES----------------------------------------
A0A1R3WWR6      ----------------QLQS----------------------------------------
A0A0Q5JKD6      ----------------QLET----------------------------------------
A0A0Q9TBP0      ----------------DIESRLSEVNALLEK-----------------------------
A0A5Q2FA83      ----------------PLLN----------------------------------------
A0A346XTB0      ----------------RLEEERSGLQSSLEA-----------------------------
A0A0G3V3M7      ----------------NSETLISKIDSQLAAPGL--------------------------
A0A6I3DD56      ----------------NSETLIRQIDSQLAAPGL--------------------------
A0A2W6DK08      ----------------EVDN----------------------------------------
A0A2S0LQ32      ----------------SLEAIGSGQSPSPADAQPPAAGSDQPSTPSPADEQPAAPEPATP
A0A2N6V1R5      ----------------AITTLNA-------------------------------------
G9PHS6          ----------------AITTLNA-------------------------------------
U1PLM7          ----------------AITTLNA-------------------------------------
A0A6I1G2U1      ------------------------------------------------------------
A0A351ETF8      ----------------EIAEDRDAIRVEVDFYD---------------------------
A0A542FTE6      ----------------ELEV----------------------------------------
A0A349B7N2      ----------------ELEARLADLDAQIEDGA---------------------------
A0A2S5UYV0      ----------------DLES----------------------------------------
A0A2S5X9U6      ----------------EIET----------------------------------------
A0A2S5ULV5      ----------------EIET----------------------------------------
A0A653YMF0      ----------------EIET----------------------------------------
A0A346Y185      ----------------ALEDAIAAAEARLAASP---------------------------
A0A259S8H9      ----------------HIEQVAQSAAPVDPSLP---------------------------
A0A0Q5L115      ----------------AMQE----------------------------------------
A0A2W1Z497      ----------------AIQS----------------------------------------
A0A4V1VGV9      ----------------YLET----------------------------------------
A0A3Q9IY80      ----------------NLET----------------------------------------
A0A0F0LP73      ----------------RIED----------------------------------------
A0A1F1X071      ----------------ELET----------------------------------------
A0A3R8RWC7      ----------------ELET----------------------------------------
A0A4U0RJZ4      ----------------HIET----------------------------------------
A0A4R1FGL9      ----------------HIET----------------------------------------
E3B8H1          ----------------HIET----------------------------------------
A0A7D7WDT9      ----------------EIEK----------------------------------------
A0A0Q5AWK6      ----------------DIET----------------------------------------
A0A6P1F176      ----------------DIET----------------------------------------
A0A3N1NLD3      ----------------DIET----------------------------------------
A0A3N2FVI8      ----------------DIET----------------------------------------
A0A2S5XDQ6      ----------------DIET----------------------------------------
A0A2S5XNN6      ----------------DIET----------------------------------------
A0A4Q4D4T1      ----------------SYQDRAAERAGE--------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ----------------AVENPNGKNEA---------------------------------
A0A1E4BP96      ----------------DIEGTGVAGSA---------------------------------
A0A439DNZ6      ----------------ELETPPDGTRP---------------------------------
A0A0J6YE86      ----------------ELETPENSTRA---------------------------------
A0A5Q5BFU2      ----------------ELETPEDGSSP---------------------------------
A0A151BT98      ----------------QFSQLLSGAGSV--------------------------------
A0A2Y8ZRF8      ----------------QFSQLLSGAGSV--------------------------------
A0A2R9UAT1      ----------------GLESDGGKVQA---------------------------------
A0A4Q5J5D7      ----------------EIENPRGEAGA---------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A3S0V9U6      ----------------EIDGSRS-------------------------------------
A0A1S2N0P2      ----------------DLEGRES-------------------------------------
A0A0Q3BEY5      ----------------DLEGRES-------------------------------------
A0A4R6Q3C6      ----------------DLEGRES-------------------------------------
A0A2X3GKL3      ----------------DLEGRES-------------------------------------
A0A0Q7KBQ4      ----------------RLEKPTSGN-----------------------------------
A0A1F1IHY9      ----------------EVEAGGIAGQS---------------------------------
A0A542HCT5      ----------------AVENPTGKSEQ---------------------------------
A0A2S8WHZ8      ----------------ELESVSVGG-----------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ----------------EIQKAGG-------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      ----------------ALEAPEG-------------------------------------
A0A3N3ZPU0      ----------------RIESIATEGNN---------------------------------
A0A359IQX7      ----------------RLESLTTTG-----------------------------------
A0A433EDP2      ----------------NIEGNNGGSGNA--------------------------------
A0A231VTW0      ----------------NIEGNNGGSGNA--------------------------------
A0A433ECD0      ----------------NIEGNNGGSGNA--------------------------------
U7V3Z1          ----------------NIEGNNGGSGNA--------------------------------
A0A1F1J417      ----------------NIEKNGSGNNST--------------------------------
A0A2A8D6P2      ----------------NIEKNGSGNNST--------------------------------
A0A1F0THV9      ----------------NIEKNGSGNNST--------------------------------
A0A5F0M6Y0      ----------------NIEKNGSGNNST--------------------------------
D8USQ4          ----------------NIEKNGSGNNST--------------------------------
E3H5W1          ----------------NIEKNGSGNNST--------------------------------
A0A1F1QKB0      ----------------NIEKNGSGNNNT--------------------------------
A0A509JY23      ----------------NIEKNGSGNNST--------------------------------
A0A448USF4      ----------------NIEKNGSGNNST--------------------------------
A0A0Q9LZR0      ----------------AVENPTGKAAQ---------------------------------
A0A1N7E3F1      ----------------QIERPT--------------------------------------
A0A544ZKQ1      ----------------KIERPT--------------------------------------
A0A372P1T1      ----------------RIERPT--------------------------------------
A0A5D0Q2X0      ----------------RIERPT--------------------------------------
A0A5R8Z2E7      ----------------RIERPT--------------------------------------
A0A1L2ZMV4      ----------------RVERVMATGGTD--------------------------------
A0A6I3F378      ----------------SLQQQIDDLQKQ--------------------------------
A0A1E9T6I0      ----------------EIEQNPGNAQAL--------------------------------
A0A1S1CQC5      ----------------EIEQNPGNAQAL--------------------------------
A0A1S1CAD0      ----------------EIEQNPGNAQAL--------------------------------
G5ET14          ----------------EIEQNPGNAQAL--------------------------------
A0A1E9DXX2      ----------------EIEQNPGNAQAL--------------------------------
A0A1E8S156      ----------------EIEQNPGNAQAL--------------------------------
A0A1E8S5S2      ----------------EIEQNPGNAQAL--------------------------------
A0A1S1DFA8      ----------------EIEQNPGNAQAL--------------------------------
A0A2I1Z490      ----------------EIEQNPSNAQAL--------------------------------
A0A1F0DAA9      ----------------EIEQNPGNAQAL--------------------------------
A0A1F0PHK9      ----------------EIEQNPGNAQAL--------------------------------
A0A1F0VZG6      ----------------EIEQNPGNAQAL--------------------------------
A0A1E9G8X4      ----------------EIEQNPGNAQAL--------------------------------
A0A1E9IAW2      ----------------EIEQNPGNAQAL--------------------------------
A0A1E9ZBC9      ----------------EIEQNPGNAQAL--------------------------------
A0A1E9ZDP4      ----------------EIEQNPGNAQAL--------------------------------
A0A1F0R6B5      ----------------EIEQNPGNAQAL--------------------------------
A0A1F0Z7N5      ----------------EIEQNPGNAQAL--------------------------------
A0A1F1D897      ----------------EIEQNPGNAQAL--------------------------------
D2NP38          ----------------EIEQNPGNAQAL--------------------------------
A0A1F1FV74      ----------------EIEQNPGNAQAL--------------------------------
A0A1E9M791      ----------------EIEQNPGNAQAL--------------------------------
A0A291DEI8      ----------------EIEQNPGNAQAL--------------------------------
A0A1S1D5T1      ----------------EIEQNPSNAQAL--------------------------------
A0A1E8TRD6      ----------------EIEQNPGNAQAL--------------------------------
A0A1F0XT88      ----------------EIEQNPGNAQAL--------------------------------
A0A1F1EVP5      ----------------EIEQNPGNAQAL--------------------------------
C6R548          ----------------EIEQNPGNAQAL--------------------------------
A0A0K2RXS2      ----------------EIEQNPGNAQAL--------------------------------
A0A1F0KX60      ----------------EIEQNPGNAQAL--------------------------------
A0A542I3V2      ----------------LLESFVTAGQP---------------------------------
A0A2T0UZ65      ----------------RLE-LGGGEVK---------------------------------
A0A1R4JTI6      ----------------NIENQTLPGVE---------------------------------
A0A4R7TM52      ----------------KLESASGGEA----------------------------------
A0A542XE74      ----------------RLETFGRTQGR---------------------------------
A0A0G3V3F3      LSNLPAFDPQAASIQANIDALNKVEAE---------------------------------
A0A0Q7QDF6      ----------------SYQDRAAERAG---------------------------------
A0A5R8L819      ----------------NLE-GGSSGGG---------------------------------
A0A261FQA1      ----------------DDSFASNETGL---------------------------------
A0A1Q2CJ92      ----------------ALE-TLTITGE---------------------------------
A0A2T0S3C8      ----------------ALETPRDRTAS---------------------------------
A0A4Y8WZJ3      ----------------EVE-AGGIAGQ---------------------------------
A0A285VUW0      ----------------SYAPTLAQSGA---------------------------------
A0A2R7Z032      ----------------EIE-NTGRPAG---------------------------------
A0A6J4MTQ2      ----------------AIQ-STGQPAG---------------------------------
A0A1I0W453      ----------------EIE-TGEENPK---------------------------------
A0A1H4LCS9      ----------------QVD-NGGTTPK---------------------------------
A0A4Q2RZP8      ----------------QVE-NGGTTPK---------------------------------
A0A0Q6VV12      ----------------EVD-TGESNPR---------------------------------
A0A495NTA9      ----------------EVD-TGEANPK---------------------------------
A0A0Q9QB08      ----------------QYE-TGEENPR---------------------------------
A0A4Q2SA86      ----------------EVE-TGEESPR---------------------------------
A0A4Z1C3Z0      ----------------EVE-TGEENPR---------------------------------
A0A542J310      ----------------EVEKESSPTGD---------------------------------
A0A4Q2JUT1      ----------------EVEVESSPTGA---------------------------------
A0A6L5R0V7      ----------------EVEIESSPTGA---------------------------------
A0A444BL03      ----------------RIETTGSNAK----------------------------------
A0A4Y8X357      ----------------GLD-PAS-------------------------------------
R4LD52          ----------------SLE-TPPGKQV---------------------------------
A0A4T2CD79      ----------------TLENKAVTQQA---------------------------------
A0A6L6AM03      ----------------QIE-TGEENPR---------------------------------
A0A4Q2RU39      ----------------DVD-GAN-------------------------------------
A0A4Q2SK58      ----------------DID-GGT-------------------------------------
A0A2N3YJR1      ----------------RIE-TAGSGRG---------------------------------
A0A6G8FYB9      ----------------AIE-TAADPSA---------------------------------
A0A4Q4D742      ----------------RLERPATSGQA---------------------------------
A0A1C6T1J1      ----------------KVE-TPPSGEP---------------------------------
A0A2W2CFC8      ----------------QVE-TRPDGSA---------------------------------
A0A2W2A4B0      ----------------DRL-DANASGV---------------------------------
A0A4Y9MDA5      ----------------DLS-PVGEDGS---------------------------------
A0A1H7N9P7      ----------------GLS-PAGEDGS---------------------------------
A0A1M7V0F8      ----------------QLS-PAGEDGS---------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A1Q2CI19      ------------------------------------------------------------
A0A512T3M3      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A543PXP1      ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A1H6WL79      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A0A4Y3NEG0      ------------------------------------------------------------
A0A6I2XCV4      ------------------------------------------------------------
A0A5R8VLL6      ------------------------------------------------------------
A0A538JQF8      ------------------------------------------------------------
A0A1H6YPK1      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A0Q9TBP0      ------------------------------------------------------------
A0A5Q2FA83      ------------------------------------------------------------
A0A346XTB0      ------------------------------------------------------------
A0A0G3V3M7      ------------------------------------------------------------
A0A6I3DD56      ------------------------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      EPRQEEPRGGNQDEGANPGTGERRSTPGRGNGTGEEKEDAAADAQARVVPAVAGTGASLV
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A6I1G2U1      ------------------------------------------------------------
A0A351ETF8      ------------------------------------------------------------
A0A542FTE6      ------------------------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A2S5UYV0      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A653YMF0      ------------------------------------------------------------
A0A346Y185      ------------------------------------------------------------
A0A259S8H9      ------------------------------------------------------------
A0A0Q5L115      ------------------------------------------------------------
A0A2W1Z497      ------------------------------------------------------------
A0A4V1VGV9      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
A0A4U0RJZ4      ------------------------------------------------------------
A0A4R1FGL9      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A7D7WDT9      ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A6P1F176      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A4R6Q3C6      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
D8USQ4          ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A6J4MTQ2      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A6L5R0V7      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A6L6AM03      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A6G8FYB9      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------MA----------
A0A538BYZ4      ------------------------------------------------SL----P-----
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ----------------------------------KDRLLSAQ------------L-----
A0A538AM15      ----------------------------------QEPLVAVD------------A-----
A0A022KX11      ---------------------------------------KVV------ST----P-----
A0A4Q5A868      ---------------------------------------SVK------LS----V-----
A0A6N4VXX3      ---------------------------------------DTR------VV----V-----
A0A1H4I042      ---------------------------------------DTR------VV----V-----
A0A4R7A6D9      ---------------------------------------DTR------VV----V-----
A0A345NSU7      ---------------------------------------AVS------AE----T-----
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A4Y5YMQ6      ---------------------------------------TVG------AR----V-----
A0A255G8R8      ---------------------------------------TVK------AT----T-----
A0A6G7Y423      ------------------------------------------------------------
A0A4Q5APW3      -----------------------------NTLYASGSHSSVK------LS----V-----
A0A4Q5B0V3      -----------------------------NTLYASGSHSSVK------LS----V-----
A0A1Q2CRV2      ---------------------------------------VVA------TV----------
A0A222TG79      ---------------------------------------MAK------LT----T-----
A0A6I3DFP2      ------------------------------------------------------V-----
A0A2S5WZJ5      ---------------------------------------NVT------VI----P-----
K6WHS4          ---------------------------------------LAK------LT----V-----
A0A1L2ZMQ6      ---------------------------TGVDGVDKDFQPAVE------LM----P-----
A0A3L8NYD3      ----------------------------AARPSGAPVSTLVK------LV----A-----
A0A1M6K628      -------------------------MTVTGEPTD-QLV--VK------IA----P-----
A0A561E8R3      ----------------------------TGEPAGTQPS--VR------IY----P-----
A0A3E2DN22      --------------------YGQIAASDHKSDAQLAKMTSVH------VL----G-----
A0A3Q9ULZ9      --------------------YTQAQANPGYTQAQLEKLTAIH------VL----S-----
A0A3S9JFL2      --------------------YSQAQANPGYSQAQLEKLTAIH------VL----S-----
A0A3L7ADK2      -------------------------------NDGVIGAQNTK------FV----S-----
A0A1Q2CI19      ----PGAET------------------------------TRL------SV----L-----
A0A512T3M3      ----PEAAG------------------------------TRL------SI----L-----
W6JTW4          ----P-SGG------------------------------TRL------TI----V-----
A0A0A0JTY0      ----AGVEN------------------------------ARL------EV----L-----
A0A0A0JXF2      ----PGAEN------------------------------TTL------TI----L-----
E6S8H2          ----PGVGR------------------------------ANV------SI----L-----
A0A0A0JGH0      ----PGVGR------------------------------AVV------TI----L-----
N0E4U7          ----PGTGG------------------------------AAV------SV----L-----
A0A0A0IYK2      ----PGAEN------------------------------VAV------SI----L-----
A0A0Q9L0H3      ----PGAET------------------------------TTL------SL----L-----
A3TMK0          ----PGAEN------------------------------ATL------SV----L-----
A0A543PXP1      ----PGTGN------------------------------ATV------TI----L-----
A3TMH6          ----PGTGT------------------------------VGI------TV----L-----
A0A1H6WL79      ----GNASP--------------------------GTEPVTK------IV----P-----
A0A101LAM5      ----GNASP--------------------------GTEPVTK------IV----P-----
A0A4Y3NEG0      ----GNASP--------------------------GTEPVTK------IV----P-----
A0A6I2XCV4      ----NPSQATLLRAELDSVINQYRLAREQFQSIAVSDQTVAA------FT----V-----
A0A5R8VLL6      ----AAAAA--------------GQPAAPAGQPAPVVTPPIS------LV----P-----
A0A538JQF8      ----DAGTVAALQARRQPLQVRVDRAMNQVDIIQNRPDPLPA------LL----T-----
A0A1H6YPK1      ----------------------------TSRGISNPERTVIN------VM----V-----
A0A2R7MGI0      ----GGTGQ-----------------------------GAVR------LI----A-----
A0A2T7WQY4      ----GGSGQ-----------------------------GAVR------LI----A-----
A0A1G6GTN3      ----GAGGR-----------------------------SAVR------LV----A-----
A0A1N7DLV3      ----TGGGH-----------------------------GAVK------LV----A-----
A0A1V2NSB5      ----TGGAH-----------------------------SAVK------LV----A-----
A0A0Q5Q5L3      ----GGSGQ-----------------------------GAVR------LV----A-----
A0A0Q6DVM4      ----GGSGQ-----------------------------GAVR------LV----A-----
A0A1R3WWR6      ----GGNGE-----------------------------SAVR------LI----A-----
A0A0Q5JKD6      ----GGGGQ-----------------------------SAVR------LV----A-----
A0A0Q9TBP0      ----NPGGQALQGERRTLIASSAQVAAQIDALTDSLTTAAAG------GE----L-----
A0A5Q2FA83      ----SAGQG-------------------------------VK------AT----T-----
A0A346XTB0      ----DSSNVALPFLIQSLDARILDISGRIDATLLAVRLRGDG------VE----D-----
A0A0G3V3M7      ----SASEYDSLDIRREAVLRKLANADSDLSNLQEIGPQTSG------LT----T-----
A0A6I3DD56      ----SASEYDSLDIRREAVLRKLANADSGISNLEDAGPQTSG------LT----T-----
A0A2W6DK08      ----QLKQVTGFTGAVSTPVNPVLQARAAALSARYAAIYGLL------QE----T-----
A0A2S0LQ32      PAVAGAPQAAVGQAGVGQAGQAAPAAPATAAPTDETYNSQTR------LV----A-----
A0A2N6V1R5      PTVQPTTKTTTNPDGTQVTTTTQSVDGTTNVTTTDNSYRETR------VT----Q-----
G9PHS6          PTVQPTTKTTTNPDGTQVTTTTQSVDGTTNVTTTDNSYRETR------VT----Q-----
U1PLM7          PTVQPTTKTTTNPDGTQVTTTTQSVDGTTNVTTTDNSYRETR------VT----Q-----
A0A6I1G2U1      --------------------------ATP--------------------I----P-----
A0A351ETF8      DLLAETTDPDEYSRYLSQMVSIETLLQPQ-------------------LA----P-----
A0A542FTE6      ----PEGTI-----------------RTQ----------ATS------FV----P-----
A0A349B7N2      GDLVQAQRDALVREYGIVYEDFQVLSREPEATVGLRTLQPAV------AV----P-----
A0A2S5UYV0      ----QAGGG-----------------VSS-----------VT------VL----P-----
A0A2S5X9U6      ----QVGGG-----------------ASG-----------VT------VV----E-----
A0A2S5ULV5      ----QVGGG-----------------TSG-----------VT------VV----P-----
A0A653YMF0      ----QVGGG-----------------ASG-----------VT------VV----P-----
A0A346Y185      TDASARAER-----------------DAA----------VSQ------LI----M-----
A0A259S8H9      PEPKSATNA-----------------APG----------GIA------IV----P-----
A0A0Q5L115      ----ESTDT-----------------GGS----------ATS------FV----A-----
A0A2W1Z497      ----SGEAL-----------------ASA----------TTK------LV----P-----
A0A4V1VGV9      ----VGTEA-----------------KTS----------VYR------VF----P-----
A0A3Q9IY80      ----SGGVS-----------------LAT-----------VQ------LV----P-----
A0A0F0LP73      ----AAGAG-----------------ATPPPGSTVVPTEGIV------IV----P-----
A0A1F1X071      ----GGNEN-----------------AAV----------GVQ------LT----N-----
A0A3R8RWC7      ----GGNEN-----------------AAV----------GVQ------LT----N-----
A0A4U0RJZ4      ----LNGA------------------KST----------VYD------AY----P-----
A0A4R1FGL9      ----LNGA------------------KST----------VYD------AY----P-----
E3B8H1          ----LNGA------------------KST----------VYD------AY----P-----
A0A7D7WDT9      ----AAGAV-----------------NAG----------GFT------IV----P-----
A0A0Q5AWK6      ----QSTAD-----------------RTP----------QIT------VV----P-----
A0A6P1F176      ----QSTAD-----------------RTP----------GIT------VV----P-----
A0A3N1NLD3      ----QSTAD-----------------RTP----------QIT------VV----P-----
A0A3N2FVI8      ----QSTAD-----------------RTP----------QIT------VV----P-----
A0A2S5XDQ6      ----QSTAD-----------------RTP----------QIT------VV----P-----
A0A2S5XNN6      ----QSTAD-----------------RTP----------QIT------VV----P-----
A0A4Q4D4T1      ----DA----------------------------PDLPTLSP------IV----------
A0A261FE22      ----------------------------------SDGSSGIQ------LS----F-----
A0A5C8C085      ---------------------------------------PIR------LL----P-----
A0A1E4BP96      ---------------------------------------PVT------LI----P-----
A0A439DNZ6      ---------------------------------------DAR------VI----V-----
A0A0J6YE86      ---------------------------------------DSR------VV----V-----
A0A5Q5BFU2      ---------------------------------------DAR------VV----V-----
A0A151BT98      ----TST-----------------------------------------------A-----
A0A2Y8ZRF8      ----TST-----------------------------------------------A-----
A0A2R9UAT1      ---------------------------------------AVR------LV----P-----
A0A4Q5J5D7      ----------------------------------------LK------VV----P-----
A0A1Y4CKD6      ------------------------------------------------FVLGNIA-----
A0A3S0V9U6      ----------------------------------------VR------VI----P-----
A0A1S2N0P2      ---------------------------------------AVK------VT----P-----
A0A0Q3BEY5      ---------------------------------------AVK------VT----P-----
A0A4R6Q3C6      ---------------------------------------AVK------VT----P-----
A0A2X3GKL3      ---------------------------------------AVK------VT----P-----
A0A0Q7KBQ4      ----------------------------------GSPAFVAR------------I-----
A0A1F1IHY9      ---------------------------------------IIS------LE----T-----
A0A542HCT5      ---------------------------------------ALR------IV----P-----
A0A2S8WHZ8      ----------------------------------SDRATAVK------LQ----P-----
A0A537WNY9      --------------------------------SGEVGVPTLE------LK----E-----
A0A5B8M469      ----------------------------------ASDTPHLK------VI----P-----
A0A1Y4CTD2      ------------------------------------------------YVFSNAT-----
A0A0Q5M6Z7      ----------------------------------AIAEPAIS------FV----A-----
A0A3N3ZPU0      -------------YEPPSPSPSEDGGEEASPESSEDGTGLVQ------VV----P-----
A0A359IQX7      ----------------------------------TPGQSVVK------LQ----P-----
A0A433EDP2      ----ANSNGGNNATPNAENGNTAGANASANTAVSGNAANNIR------VI----P-----
A0A231VTW0      ----ANSNGGNNATPNTENGNTAGASASANTAVSGNAANNIR------VI----P-----
A0A433ECD0      ----ANSNGGNNATPNTENGNTAGASASANTAVSGNAANNIR------VI----P-----
U7V3Z1          ----ANSNGGNNATPNTENGNTAGASASANTAVSGNAANNIR------VI----P-----
A0A1F1J417      ----ATP------TPAGEENQESAQNKVSSTNPSDTTNTLIR------VI----P-----
A0A2A8D6P2      ----ATP------TPAGEENQESAQNKVSSTNPSDTTNTLIR------VI----P-----
A0A1F0THV9      ----ATP------TPAGEENQESAQNKVSSTNPSDTTNTLIR------VI----P-----
A0A5F0M6Y0      ----ATP------TPAGEENQESAQNKVSSTNPSDTTNTLIR------VI----P-----
D8USQ4          ----ATP------TPAGEENQESAQNKVSSTNPSDTTNTLIR------VI----P-----
E3H5W1          ----ATP------TPAGEENQESAQNKVSSTNPSDTTNTLIR------VI----P-----
A0A1F1QKB0      ----ATP------APAGEENQESAQNKVSSTNPSDTTNTLIR------VI----P-----
A0A509JY23      ----ATP------TPAGEENQESAQNKVSSTNPSDTTNTLIR------VI----P-----
A0A448USF4      ----ATP------TPAGEENQESAQNKVSSTNPSDTTNTLIR------VI----P-----
A0A0Q9LZR0      ---------------------------------------ALR------VV----P-----
A0A1N7E3F1      ----------------------------------PKSPPTIR------VT----V-----
A0A544ZKQ1      ----------------------------------PKSPPTIR------VT----V-----
A0A372P1T1      ----------------------------------PKSPPTIR------VT----V-----
A0A5D0Q2X0      ----------------------------------PKSPPTIR------VT----V-----
A0A5R8Z2E7      ----------------------------------PKSPPTIR------VT----V-----
A0A1L2ZMV4      ----S-----------------------------TSSVPVVQ------II----P-----
A0A6I3F378      ----IET-------------------LDHSIAASGNDDDSTREAQRRELL----AQQADF
A0A1E9T6I0      ----VNG-------------------DSNAAATPPANSNTVR------VI----P-----
A0A1S1CQC5      ----VNG-------------------DSNAAATPSASSNTVR------VI----P-----
A0A1S1CAD0      ----VNG-------------------DSTAAS--PTGGNTVR------VI----P-----
G5ET14          ----VNG-------------------DSTAAS--PTGGNTVR------VI----P-----
A0A1E9DXX2      ----VNG-------------------DNAVVS--PTGGNTVR------VI----P-----
A0A1E8S156      ----VNG-------------------ENTGAT--PTGGNTVR------VI----P-----
A0A1E8S5S2      ----VNG-------------------ENTGAT--PTGGNTVR------VI----P-----
A0A1S1DFA8      ----VNG-------------------ENTGAT--PTGGNTVR------VI----P-----
A0A2I1Z490      ----VNG-------------------ENTGAT--PTGGNTVR------VI----P-----
A0A1F0DAA9      ----VNG-------------------ENTGAS--PTGGNTVR------VI----P-----
A0A1F0PHK9      ----VNG-------------------ENTGAS--PTGGNTVR------VI----P-----
A0A1F0VZG6      ----VNG-------------------ENTGAS--PTGGNTVR------VI----P-----
A0A1E9G8X4      ----VNG-------------------ENTGAS--PTGGNTVR------VI----P-----
A0A1E9IAW2      ----VNG-------------------ENTGAS--PTGGNTVR------VI----P-----
A0A1E9ZBC9      ----VNG-------------------ENTGAS--PTGGNTVR------VI----P-----
A0A1E9ZDP4      ----VNG-------------------ENTGAS--PTGGNTVR------VI----P-----
A0A1F0R6B5      ----VNG-------------------ENTGAS--PTGGNTVR------VI----P-----
A0A1F0Z7N5      ----VNG-------------------ENTGAS--PTGGNTVR------VI----P-----
A0A1F1D897      ----VNG-------------------ENTGAS--PTGGNTVR------VI----P-----
D2NP38          ----VNG-------------------ENTGAS--PTGGNTVR------VI----P-----
A0A1F1FV74      ----VNG-------------------ENTAAS--PTTNNTVR------VI----P-----
A0A1E9M791      ----VNG-------------------ENTAAS--PTTNNTVR------VI----P-----
A0A291DEI8      ----VNG-------------------ENTAAS--PTTNNTVR------VI----P-----
A0A1S1D5T1      ----VNG-------------------ENTGAT--PTGGNTVR------VI----P-----
A0A1E8TRD6      ----VNG-------------------ENTGAS--PTTSNTVR------VI----P-----
A0A1F0XT88      ----VNG-------------------ENTGAS--PTTSNTVR------VI----P-----
A0A1F1EVP5      ----VNG-------------------ENTGAS--PTTSNTVR------VI----P-----
C6R548          ----VNG-------------------ENTGAS--PTTNNTVR------VI----P-----
A0A0K2RXS2      ----VNG-------------------ENTAAS--PTTNNTVR------VI----P-----
A0A1F0KX60      ----VNG-------------------ENAAAS--PTTNNTVR------VI----P-----
A0A542I3V2      ----------------------------------TPPALPVG------LV----P-----
A0A2T0UZ65      ----------------------------------PGTQALVR------II----P-----
A0A1R4JTI6      ----------------------------------QSEESSAQ------SIVKVLP-----
A0A4R7TM52      ---------------------------------------LVQ------LV----P-----
A0A542XE74      ----------------------------------ETSEEQMRGMTSINVL----A-----
A0A0G3V3F3      ----------------------------------RRAQPANR------VN----V-----
A0A0Q7QDF6      ----------------------------------EDAPDLPT------LSPI--V-----
A0A5R8L819      ----------------------------------E----VVR------LV----E-----
A0A261FQA1      ----------------------------------FN---GLQ------FS----V-----
A0A1Q2CJ92      ----------------------------------SSGQTVVR------IV----P-----
A0A2T0S3C8      ---------------------------------------PIK------VE----V-----
A0A4Y8WZJ3      ----------------------------------S----IIS------LE----T-----
A0A285VUW0      ---------------------------------------SVA------AQ----F-----
A0A2R7Z032      ----------------------------------NKAETLVQ------VV----P-----
A0A6J4MTQ2      ----------------------------------GQAVSLVR------VV----P-----
A0A1I0W453      ----------------------------------EP--ALTR------II----P-----
A0A1H4LCS9      ----------------------------------GD--SLAT------IV----P-----
A0A4Q2RZP8      ----------------------------------GD--PLAR------IV----P-----
A0A0Q6VV12      ----------------------------------RD--PLTR------VV----P-----
A0A495NTA9      ----------------------------------TD--PLTR------IV----P-----
A0A0Q9QB08      ----------------------------------GP--SLTR------II----P-----
A0A4Q2SA86      ----------------------------------EA--PLTR------IV----P-----
A0A4Z1C3Z0      ----------------------------------GD--PLTR------IV----A-----
A0A542J310      ----------------------------------A----PVK------VV----V-----
A0A4Q2JUT1      ----------------------------------A----PVQ------VV----T-----
A0A6L5R0V7      ----------------------------------A----PVQ------VV----T-----
A0A444BL03      ---------------------------------------NIV------TI----V-----
A0A4Y8X357      ---------------------------------------NVK------VT----A-----
R4LD52          ----------------------------------S----SVK------VE----V-----
A0A4T2CD79      ----------------------------------GN--TVVA------AVTFLEP-----
A0A6L6AM03      ----------------------------------EE--PLTR------II----P-----
A0A4Q2RU39      ---------------------------------------LAR------II----P-----
A0A4Q2SK58      ---------------------------------------LTR------II----P-----
A0A2N3YJR1      ----------------------------------A----ASV------TI----V-----
A0A6G8FYB9      ----------------------------------K----PIV------SI----V-----
A0A4Q4D742      ----------------------------------A----AVT------AR----I-----
A0A1C6T1J1      ----------------------------------G----PIK------IE----I-----
A0A2W2CFC8      ----------------------------------G----PIK------IE----V-----
A0A2W2A4B0      ---------------------------------------GVT------VT----Q-----
A0A4Y9MDA5      ----------------------------------P----SVR------AD----T-----
A0A1H7N9P7      ----------------------------------P----AVR------AT----T-----
A0A1M7V0F8      ----------------------------------R----AVR------AT----T-----
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------KKNRKR
A0A538BYZ4      ------------------------------------------------------AVVEPS
A0A348NU28      --------------------VDE-------------------------------AVVPNV
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      --------------------------------------------------------MPQE
A0A538AJI7      --------------------VAP-------------------------------AVKPTT
A0A538AM15      --------------------AEP-------------------------------LTLQQS
A0A022KX11      --------------------IQP-------------------------------ASAPAQ
A0A4Q5A868      --------------------VQP-------------------------------AAVPSS
A0A6N4VXX3      --------------------EQP-------------------------------ASVSSS
A0A1H4I042      --------------------EQP-------------------------------AAIASS
A0A4R7A6D9      --------------------EQP-------------------------------AAIASS
A0A345NSU7      --------------------VVP-------------------------------AAVPGR
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A4Y5YMQ6      --------------------IDP-------------------------------GAPAQF
A0A255G8R8      --------------------ISP-------------------------------ALPPPS
A0A6G7Y423      ------------------------------------------------------------
A0A4Q5APW3      --------------------VQP-------------------------------AAVPSS
A0A4Q5B0V3      --------------------VQP-------------------------------AAVPSS
A0A1Q2CRV2      --------------------IRQ-------------------------------PLVPTA
A0A222TG79      --------------------VTP-------------------------------AVEPSV
A0A6I3DFP2      --------------------AAG-------------------------------AHAHST
A0A2S5WZJ5      --------------------LED-------------------------------AVPPTT
K6WHS4          --------------------VSP-------------------------------ATVDDA
A0A1L2ZMQ6      --------------------MTE-------------------------------GTLPTS
A0A3L8NYD3      --------------------TQQ-------------------------------AGAPSA
A0A1M6K628      --------------------VEP-------------------------------ALTPSR
A0A561E8R3      --------------------FDN-------------------------------ATTPSL
A0A3E2DN22      --------------------YES-------------------------------AGLPSG
A0A3Q9ULZ9      --------------------YEP-------------------------------AGLPAT
A0A3S9JFL2      --------------------YEP-------------------------------AGLPAT
A0A3L7ADK2      --------------------VSK-------------------------------AATPNS
A0A1Q2CI19      --------------------QEA-------------------------------TPIPNE
A0A512T3M3      --------------------QRG-------------------------------IPVAEA
W6JTW4          --------------------QDA-------------------------------VAVPDA
A0A0A0JTY0      --------------------QTA-------------------------------TPIPTA
A0A0A0JXF2      --------------------QPA-------------------------------TPIPST
E6S8H2          --------------------QRA-------------------------------TPIPNV
A0A0A0JGH0      --------------------QEA-------------------------------TPIPDE
N0E4U7          --------------------QVA-------------------------------TPIPDQ
A0A0A0IYK2      --------------------QAA-------------------------------SPVPVA
A0A0Q9L0H3      --------------------QPA-------------------------------TPIPSA
A3TMK0          --------------------QPA-------------------------------TPIPSA
A0A543PXP1      --------------------QRA-------------------------------TPIPNV
A3TMH6          --------------------QSA-------------------------------SPIPNA
A0A1H6WL79      --------------------LAK-------------------------------ATLPSA
A0A101LAM5      --------------------LAK-------------------------------ASLPSA
A0A4Y3NEG0      --------------------LTK-------------------------------ASLPSA
A0A6I2XCV4      --------------------FQPAIAVQINGRAFAIRYDANLNSRGSISATQSVPKLTFS
A0A5R8VLL6      --------------------LDP-------------------------------ATVPTH
A0A538JQF8      --------------------LES-------------------------------GSIRGG
A0A1H6YPK1      --------------------LQQ-------------------------------ARLPSV
A0A2R7MGI0      --------------------GDS-------------------------------ARLPTS
A0A2T7WQY4      --------------------GDS-------------------------------ARLPTS
A0A1G6GTN3      --------------------GDS-------------------------------ARLPTA
A0A1N7DLV3      --------------------GDS-------------------------------ARLPTA
A0A1V2NSB5      --------------------GDS-------------------------------ARLPTS
A0A0Q5Q5L3      --------------------GDS-------------------------------ARLPTS
A0A0Q6DVM4      --------------------GDS-------------------------------ARLPTS
A0A1R3WWR6      --------------------GDS-------------------------------ARLPTS
A0A0Q5JKD6      --------------------GDS-------------------------------ARLPTA
A0A0Q9TBP0      --------------------LHS-------------------------------AEPADN
A0A5Q2FA83      --------------------ITP-------------------------------ATVPSQ
A0A346XTB0      --------------------FQD-------------------------------AIPPDF
A0A0G3V3M7      --------------------LEAATKGRAT------------------------IIVSRA
A0A6I3DD56      --------------------LEAATKARAT------------------------ILVTSA
A0A2W6DK08      --------------------ANQ-------------------------------ANNPTG
A0A2S0LQ32      --------------------LEP-------------------------------AQLPGA
A0A2N6V1R5      --------------------TLQ-------------------------------AVAPSA
G9PHS6          --------------------TLQ-------------------------------AVAPSA
U1PLM7          --------------------TLQ-------------------------------AVAPSA
A0A6I1G2U1      --------------------IIA-------------------------------SGGFSI
A0A351ETF8      --------------------LEAQISEYQRQITEFESVARFLDSPDVSAQVSQLAEVPTI
A0A542FTE6      --------------------LAA-------------------------------ATTPTA
A0A349B7N2      --------------------ISGDAFVAALQETLG-------------------ATDPSE
A0A2S5UYV0      --------------------LQD-------------------------------AVEPTS
A0A2S5X9U6      --------------------LQN-------------------------------AVEPTS
A0A2S5ULV5      --------------------LQN-------------------------------AVEPTS
A0A653YMF0      --------------------LQN-------------------------------AVEPTS
A0A346Y185      --------------------IDSRADQIAVDSTLFGSGVELFER----------ADVPES
A0A259S8H9      --------------------MDE-------------------------------AVAPTR
A0A0Q5L115      --------------------LSS-------------------------------ASVPTS
A0A2W1Z497      --------------------LAS-------------------------------ATVPTS
A0A4V1VGV9      --------------------LTA-------------------------------AARPSA
A0A3Q9IY80      --------------------GDT-------------------------------ARLPSS
A0A0F0LP73      --------------------LDQ-------------------------------AVAPRT
A0A1F1X071      --------------------YQN-------------------------------AVVPGA
A0A3R8RWC7      --------------------YQN-------------------------------AVVPGA
A0A4U0RJZ4      --------------------LSR-------------------------------AGLPAS
A0A4R1FGL9      --------------------LSR-------------------------------AGLPAS
E3B8H1          --------------------LSR-------------------------------AGLPAS
A0A7D7WDT9      --------------------MDN-------------------------------AAQPTS
A0A0Q5AWK6      --------------------LEN-------------------------------AEPAST
A0A6P1F176      --------------------LEN-------------------------------AEPASA
A0A3N1NLD3      --------------------LEN-------------------------------AEPAAA
A0A3N2FVI8      --------------------LEN-------------------------------AEPAAA
A0A2S5XDQ6      --------------------LEN-------------------------------AEPPAA
A0A2S5XNN6      --------------------LEN-------------------------------AEPPAA
A0A4Q4D4T1      --------------------IQE-------------------------------GTASSQ
A0A261FE22      --------------------IQK-------------------------------PYVPSS
A0A5C8C085      --------------------VES-------------------------------AALPSA
A0A1E4BP96      --------------------GDS-------------------------------ARLPTA
A0A439DNZ6      --------------------EQR-------------------------------ASIPKS
A0A0J6YE86      --------------------EQR-------------------------------ASIPSS
A0A5Q5BFU2      --------------------EQR-------------------------------ASIANK
A0A151BT98      --------------------VQP-------------------------------AEVPAS
A0A2Y8ZRF8      --------------------VQP-------------------------------ATVPSS
A0A2R9UAT1      --------------------ADT-------------------------------ARLPTA
A0A4Q5J5D7      --------------------IEA-------------------------------AALPSA
A0A1Y4CKD6      --------------------FNL-------------------------------IDEIST
A0A3S0V9U6      --------------------LDD-------------------------------AQKPGS
A0A1S2N0P2      --------------------LDD-------------------------------AQAPDG
A0A0Q3BEY5      --------------------LDD-------------------------------AQAPDG
A0A4R6Q3C6      --------------------LDD-------------------------------AQAPDG
A0A2X3GKL3      --------------------LDD-------------------------------AQAPDG
A0A0Q7KBQ4      --------------------VGP-------------------------------PSISQT
A0A1F1IHY9      --------------------LSD-------------------------------ASLPSA
A0A542HCT5      --------------------IES-------------------------------AALPAS
A0A2S8WHZ8      --------------------LGQ-------------------------------AVLPSS
A0A537WNY9      --------------------LDR-------------------------------PALPQA
A0A5B8M469      --------------------LDN-------------------------------ATAPST
A0A1Y4CTD2      --------------------LQL-------------------------------VQEPSV
A0A0Q5M6Z7      --------------------LAS-------------------------------ARPPYF
A0A3N3ZPU0      --------------------VSS-------------------------------ASVPES
A0A359IQX7      --------------------YIS-------------------------------AAESPN
A0A433EDP2      --------------------LDN-------------------------------ASINPP
A0A231VTW0      --------------------LDN-------------------------------ASINPP
A0A433ECD0      --------------------LDN-------------------------------ASINPP
U7V3Z1          --------------------LDN-------------------------------ASINPP
A0A1F1J417      --------------------LDN-------------------------------ASVNPP
A0A2A8D6P2      --------------------LDN-------------------------------ASVNPP
A0A1F0THV9      --------------------LDN-------------------------------ASVNPP
A0A5F0M6Y0      --------------------LDN-------------------------------ASVNPP
D8USQ4          --------------------LDN-------------------------------ASVNPP
E3H5W1          --------------------LDN-------------------------------ASVNPP
A0A1F1QKB0      --------------------LDN-------------------------------ASVNPP
A0A509JY23      --------------------LDN-------------------------------ASVNPP
A0A448USF4      --------------------LDN-------------------------------ASVNPP
A0A0Q9LZR0      --------------------IES-------------------------------AALPAS
A0A1N7E3F1      --------------------VDD-------------------------------AEVPED
A0A544ZKQ1      --------------------VDE-------------------------------AEVPKE
A0A372P1T1      --------------------IDE-------------------------------AEVPRE
A0A5D0Q2X0      --------------------IDE-------------------------------AEVPRE
A0A5R8Z2E7      --------------------IDE-------------------------------AEVPRE
A0A1L2ZMV4      --------------------ISS-------------------------------ALLPSA
A0A6I3F378      RHTLEQQQIDARLDTPGAKVVHP-------------------------------AETPGT
A0A1E9T6I0      --------------------LNN-------------------------------ASVNPP
A0A1S1CQC5      --------------------LNN-------------------------------ASVNPP
A0A1S1CAD0      --------------------LNN-------------------------------ASVNPP
G5ET14          --------------------LNN-------------------------------ASVNPP
A0A1E9DXX2      --------------------LNN-------------------------------ASVNPP
A0A1E8S156      --------------------LNN-------------------------------ASVNPP
A0A1E8S5S2      --------------------LNN-------------------------------ASVNPP
A0A1S1DFA8      --------------------LNN-------------------------------ASVNPP
A0A2I1Z490      --------------------LNN-------------------------------ASVNPP
A0A1F0DAA9      --------------------LNN-------------------------------ASVNPP
A0A1F0PHK9      --------------------LNN-------------------------------ASVNPP
A0A1F0VZG6      --------------------LNN-------------------------------ASVNPP
A0A1E9G8X4      --------------------LNN-------------------------------ASVNPP
A0A1E9IAW2      --------------------LNN-------------------------------ASVNPP
A0A1E9ZBC9      --------------------LNN-------------------------------ASVNPP
A0A1E9ZDP4      --------------------LNN-------------------------------ASVNPP
A0A1F0R6B5      --------------------LNN-------------------------------ASVNPP
A0A1F0Z7N5      --------------------LNN-------------------------------ASVNPP
A0A1F1D897      --------------------LNN-------------------------------ASVNPP
D2NP38          --------------------LNN-------------------------------ASVNPP
A0A1F1FV74      --------------------LNN-------------------------------ASVNPP
A0A1E9M791      --------------------LNN-------------------------------ASVNPP
A0A291DEI8      --------------------LNN-------------------------------ASVNPP
A0A1S1D5T1      --------------------LNN-------------------------------ASVNPP
A0A1E8TRD6      --------------------LNN-------------------------------ASVNPP
A0A1F0XT88      --------------------LNN-------------------------------ASVNPP
A0A1F1EVP5      --------------------LNN-------------------------------ASVNPP
C6R548          --------------------LNN-------------------------------ASVNPP
A0A0K2RXS2      --------------------LNN-------------------------------ASVNPP
A0A1F0KX60      --------------------LNN-------------------------------ASVNPP
A0A542I3V2      --------------------LDK-------------------------------AALPTT
A0A2T0UZ65      --------------------IET-------------------------------ALLPGA
A0A1R4JTI6      --------------------LVQ-------------------------------ATQPQT
A0A4R7TM52      --------------------GDS-------------------------------AQLPTS
A0A542XE74      --------------------YEP-------------------------------AALPSS
A0A0G3V3F3      --------------------AAS-------------------------------AHASST
A0A0Q7QDF6      --------------------IQE-------------------------------GTASSQ
A0A5R8L819      --------------------GDS-------------------------------ARLPSS
A0A261FQA1      --------------------IER-------------------------------AVAPSS
A0A1Q2CJ92      --------------------VEL-------------------------------AQTPTT
A0A2T0S3C8      --------------------VAG-------------------------------PTGGDT
A0A4Y8WZJ3      --------------------LSD-------------------------------ASLPSA
A0A285VUW0      --------------------VDQ-------------------------------PTQSSE
A0A2R7Z032      --------------------LEQ-------------------------------AQLPGA
A0A6J4MTQ2      --------------------YEQ-------------------------------AQLPTE
A0A1I0W453      --------------------LEE-------------------------------AQLPGA
A0A1H4LCS9      --------------------LEE-------------------------------AQLPGA
A0A4Q2RZP8      --------------------LEE-------------------------------AALPGA
A0A0Q6VV12      --------------------VQP-------------------------------AELPQA
A0A495NTA9      --------------------VTP-------------------------------AQLPGA
A0A0Q9QB08      --------------------VTP-------------------------------AELPGA
A0A4Q2SA86      --------------------VEQ-------------------------------AQLPTA
A0A4Z1C3Z0      --------------------VEP-------------------------------AQLPSA
A0A542J310      --------------------RES-------------------------------ASLPSS
A0A4Q2JUT1      --------------------RES-------------------------------ASLPTS
A0A6L5R0V7      --------------------RES-------------------------------ASLPSS
A0A444BL03      --------------------PIE-------------------------------SALPGR
A0A4Y8X357      --------------------MED-------------------------------ALPPQA
R4LD52          --------------------VAG-------------------------------PELADA
A0A4T2CD79      --------------------VES-------------------------------AVAPTQ
A0A6L6AM03      --------------------LEQ-------------------------------AQLPGA
A0A4Q2RU39      --------------------LEE-------------------------------AQLPGA
A0A4Q2SK58      --------------------LEE-------------------------------AQLPGA
A0A2N3YJR1      --------------------PIE-------------------------------SALPGT
A0A6G8FYB9      --------------------PIE-------------------------------SALPGG
A0A4Q4D742      --------------------AAD-------------------------------PSFRSS
A0A1C6T1J1      --------------------VSG-------------------------------PRVSAS
A0A2W2CFC8      --------------------ISG-------------------------------PGVTPS
A0A2W2A4B0      --------------------TSP-------------------------------AARPTT
A0A4Y9MDA5      --------------------VAP-------------------------------ASVPSA
A0A1H7N9P7      --------------------VAP-------------------------------AGVPGA
A0A1M7V0F8      --------------------VAS-------------------------------ADVPTA
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------ASREA-
A0A357ZCV8      ------------------------------------------------------KVGREQ
A0A4R5Z7B0      ------------------------------------------------------PARKLI
A0A6M8GFV5      ------------------------------------------------------LKRFLI
A0A4R1CW45      ------------------------------------------------------RDKRS-
A0A419GS64      ------------------------------------------------------GSKYLY
A0A2V2CXY5      ------------------------------------------------------KELVIR
A0A2S8MDM2      ------------------------------------------------------RKQPAI
A0A357ZDL3      ------------------------------------------------------MSKKNN
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------GGTSRS
A0A1I6IST1      ------------------------------------------------------GGTSRS
A0A412JBM5      ------------------------------------------------------DSPFA-
A0A6J4SUA1      ------------------------------------------------------EEASQ-
A0A1C2B334      ------------------------------------------------------AGGSV-
R7Y679          ------------------------------------------------------AGGSS-
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------EEIQR-
A0A510HHA8      ------------------------------------------------------SNPAS-
A0A6G8Q9J3      ------------------------------------------------------TGAAS-
A0A5Q2F9A3      ------------------------------------------------------TSPRA-
A0A4R1BMZ2      ------------------------------------------------------EGPAA-
A0A023X491      ------------------------------------------------------GGQAA-
A0A6G8QDQ0      ------------------------------------------------------GGMAA-
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------AAGVI-
A0A6D1QMN1      ------------------------------------------------------RSPVS-
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------ASFEA-
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------HSTRV-
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      PSQ---------------------------------------------------------
A0A538BYZ4      PAA-----------------------PVREPGPTPA--TGAVDGADEHLVSLL-------
A0A348NU28      QAL-----------------------PNKPRDAL----LGAVVGLLLGVLAALLWTLLDT
A0A2N4T4Q5      ---------------------------------------------------------MDR
A0A1M3LEY6      PIS-----------------------PNTRLYLS----LGLLIGLIVGLAVAILIEVLDT
A0A538AJI7      PAA-----------------------PPRRLLEL----ASLFIGSLLGIVASLLLERGRP
A0A538AM15      PA------------------------------------DSAVDDHLVSLVAPAAFE----
A0A022KX11      PVS-----------------------PNPTRNLA----LGLLAGLVLGLGLAFIRHALDT
A0A4Q5A868      PSS-----------------------PKWKLNIL----VGIVGGLILGVFAALLKDVLSK
A0A6N4VXX3      PAI-----------------------PNLFRNLA----LGLVAGVLLGIALAFGLDVVDS
A0A1H4I042      PAV-----------------------PNLMRNLA----LGLFAGILFGVACALGREMIDN
A0A4R7A6D9      PAV-----------------------PNLMRNLA----LGLFAGVLLGVACALGREVIDN
A0A345NSU7      PVE-----------------------PDPERNLA----LGALAGLLLGVAFALARQALDQ
A0A0W8I9Y2      ----------------------------------------------MGLLYAFARFKMDR
A0A7C6LSF9      ------------------------------------------------FGIALVLHQVDS
A0A4Y5YMQ6      QSS-----------------------PNKSQDAV----LGVVLGAFGALFALSAWALLDR
A0A255G8R8      PSS-----------------------PKVAQNLA----LGLLLGLALGFAAALVRERLDT
A0A6G7Y423      ------------------------------------------MGAAVGVGQALARHALDT
A0A4Q5APW3      PSS-----------------------PKWKLNIL----VGIVGGLILGVFAALLKDALSK
A0A4Q5B0V3      PSS-----------------------PKWKLNIL----VGIVGGLILGVFAALLKDVLSK
A0A1Q2CRV2      PTS-----------------------PKPLQNLA----IGGLVGLLLGAGQALLRDVLNT
A0A222TG79      PVS-----------------------PGIEKNTL----IGVAVGLLFGLLAVMFASRLTN
A0A6I3DFP2      PIS-----------------------PHPTRSAV----VAFLLTCILVGELIVASRAIGD
A0A2S5WZJ5      PVT-----------------------PNLQTNLL----LGAGIGIVLAYVFVFLRKALDV
K6WHS4          PVS-----------------------PRYGRTVL----IALTLGICMGIGIVVLVERADT
A0A1L2ZMQ6      PYA-----------------------PNVNQAVL----IGAVVGLVLGLIWAAIKHLLDR
A0A3L8NYD3      PSS-----------------------PDYRINLL----AGGIAGIVAGYLLALVRRQLDS
A0A1M6K628      PTS-----------------------PNWARNLA----LGLALGLLCGFGAVVLRRSLDR
A0A561E8R3      PFS-----------------------PDFKKATA----EGLLAGLVAGYLWAAFRRQLDS
A0A3E2DN22      DRG-----------------------KSVALYVV----AGLAAGFLIGAVVAVVRKQFDV
A0A3Q9ULZ9      PKQ-----------------------DNLLLYLA----LGLVAGLVVGSVIAVIRRMFDV
A0A3S9JFL2      PKT-----------------------ANLPLYLA----LGLLAGLVLGGVISVIKRMFDV
A0A3L7ADK2      PVS-----------------------PNVIIALV----LATITGTLLAIAYAVIRQHLDR
A0A1Q2CI19      -ST-----------------ANFVIPPDRWFRTL----LAAVLGLLFGIALALVLERLDS
A0A512T3M3      --H-----------------KGTLIPPGRPQRTG----LAAGLGLLLGLAIALVLNRLDS
W6JTW4          --N-----------------PGSILPPGRPTRTA----LAALIGLLFGMALAVFVDRIDS
A0A0A0JTY0      GSD-----------------GGFVIPPGRGPRTA----IATLLGVLVGLGLALLLDRLDS
A0A0A0JXF2      AND-----------------GGFVVPPGRGPRTA----IATLLGLLVGMGLALLLDRLDS
E6S8H2          -TG-----------------GGFVIPPDRTTRTA----LAAGLGLLLGLGLALVLDRVDS
A0A0A0JGH0      -IG-----------------GGFVVPPSRPLRAA----LAALVGLLLGFALALVLQRVDS
N0E4U7          -IG-----------------GGFVVPPSRPLRTA----MAAFIGLLLGFALALVIQRVDS
A0A0A0IYK2      NSD-----------------GGFVVPPGRGPRTA----IATVLGLLAGLALALLLDRLDS
A0A0Q9L0H3      ATD-----------------GGFVIPPGRGPRTA----IATLLGLLVGLGLALLLDRLDS
A3TMK0          TTD-----------------GGFVVPPGRGPRTA----MATLLGLLVGLGAALVMDRLDS
A0A543PXP1      -TG-----------------GGFVVPPGRAFRTA----LAAMLGLLAGLALALVLDRLDS
A3TMH6          -DG-----------------GGFVVPPSRPVRAA----LSAVLGLLLGLALALVLDRLDS
A0A1H6WL79      PVS-----------------------PLLTATIG----IGLAGGLLVGLGYALARNHFDR
A0A101LAM5      PVS-----------------------PLLTATLG----IGLAAGLLIGLGYALARNHLDR
A0A4Y3NEG0      PIS-----------------------PLLTATLG----IGLAAGLLIGLGYAIARNHFDR
A0A6I2XCV4      ETD-----------------LTVVSGSSRAVRIL----IGGLVGLILGIATAFVLEVWDD
A0A5R8VLL6      PVS-----------------------PGMGLTAL----YGAAVGLLLAYASALLRDRLDR
A0A538JQF8      RTD--------LSRFLAQRAAATFHPKPRRIRAV----IGLLIGLLVGAGVSFAIDFFDP
A0A1H6YPK1      PAS-----------------------PAIKQNTA----VGLMLGLALGVAYAFVRATLDR
A0A2R7MGI0      PSS-----------------------PNIKIDVA----VGGIAGGVLGVVFALVRRTFDR
A0A2T7WQY4      PSS-----------------------PNVKVDVA----VGAIAGGVLGVVFALVRRTFDR
A0A1G6GTN3      PSS-----------------------PNVRLDVT----LGALAGGVAGIIFALVRRAFDR
A0A1N7DLV3      PSS-----------------------PNEKLAIA----VGALAGAVAGVLFALVRRAFDR
A0A1V2NSB5      PSS-----------------------PNEKLAIA----VGALGGAVVGVLFALVRRTFDR
A0A0Q5Q5L3      PSS-----------------------PNVRLDVM----IGALLGLVAGVVFALVRRTFDR
A0A0Q6DVM4      PSS-----------------------PNVRLDVM----IGALLGLVAGVVFALVRRTFDR
A0A1R3WWR6      PSS-----------------------PNVRLDIA----IGALVGAMAGTVFALVRRAFDR
A0A0Q5JKD6      PSS-----------------------PNVRLDVT----LGALAGGVAGLIFAFVRRAFDR
A0A0Q9TBP0      PVS-----------------------PQIVLNLI----LGALVGLVLGVGAALLRDRLDD
A0A5Q2FA83      PVS-----------------------PNLLQNIA----LGVLAGLALGIGLALLRHFLDT
A0A346XTB0      PSR-----------------------PRPRLTAL----SFAFLGGVASAMWAYWYAFKSQ
A0A0G3V3M7      QGS-----------------------TSESQRLL----FGAAIGFIVGLGILLLLEILSA
A0A6I3DD56      KGS-----------------------TSESQRLL----FGAAIGFIIGLGILLLLEILSA
A0A2W6DK08      LDT-------LSPAAGATFNAGAFSLSSTTARTV----VGLVLGVVLGCALALALEHFDT
A0A2S0LQ32      PFS-----------------------PDTTKLAG----MGGAGGLALGLAVAFLRRALDN
A0A2N6V1R5      PSS-----------------------PDFYKLSG----MGALAGLVIGYLVVFMRRLMDN
G9PHS6          PSS-----------------------PDFYKLSG----MGALAGLVIGYLVVFMRRLMDN
U1PLM7          PSS-----------------------PDFYKLSG----MGALAGLVIGYLVVFMRRLMDN
A0A6I1G2U1      P-------------------------PSRTFRTT----MAALLGLLIGFGLALVLHQVDS
A0A351ETF8      PVS-----------------------PNVTRNLV----VAAAFGMALGIALTYLREVIND
A0A542FTE6      PSS-----------------------PNIFSALV----VGGVVGLVAAGIFMLVRNTLDR
A0A349B7N2      PTAIEDGDPDEEDPLLEAFDAGPSEPPSPARRGM----LGGGLGLVLSVGAVVLFDRFDD
A0A2S5UYV0      PES-----------------------PNLRNNLL----IGAGLGLVLAYVFVFLRKALDV
A0A2S5X9U6      PVS-----------------------PNLRNNLI----IGGAIGLLLAYAFALLRRSLDV
A0A2S5ULV5      PVS-----------------------PNLRNNLI----IGGAIGLVLAYAFALLRRSLDV
A0A653YMF0      PVS-----------------------PNLRNNLI----IGGAIGLVLAYAFALLRRSLDV
A0A346Y185      PSA-----------------------PTPVRNAV----LACFLGALAAAALAWWRADETA
A0A259S8H9      PSA-----------------------PNKPLIAG----IGGGAGLVLGLIALLLRRAMDV
A0A0Q5L115      PAS-----------------------PNVEVALL----LGGLSGLMLAGVYLLVRNTLDR
A0A2W1Z497      PSS-----------------------PDVRAAVT----LGVLVGLLLASVYVLVRQALDR
A0A4V1VGV9      PSS-----------------------PNWMRNLM----AGAAIGLLAGIVLVVLRKQLDS
A0A3Q9IY80      PSS-----------------------PNVRIALA----LGALAGLVLGIAYAVLRYTLDR
A0A0F0LP73      PSA-----------------------PDKRAMII----AGALIGLGVGLLLVLLRRALDV
A0A1F1X071      PVS-----------------------PDREKFLL----AGAAFGLLVALGLAWLRDRNDS
A0A3R8RWC7      PVS-----------------------PDREKFLL----AGAAFGLLVALGLAWLRDRNDS
A0A4U0RJZ4      QTS-----------------------PKWPVNLL----IGAFLGLVAGTILVVLRKQLDS
A0A4R1FGL9      QTS-----------------------PKWPVNLL----IGAFLGLVAGTVLVVLRKQLDS
E3B8H1          QTS-----------------------PKWPVNLL----IGAFLGLVAGTVLVVLRKQLDS
A0A7D7WDT9      PVS-----------------------PNLRLAVI----AGAAAGLVLAYLVLFLRRALDV
A0A0Q5AWK6      PTS-----------------------PNWLRNLL----LGAAGGLVLGFVVAFLRRALDI
A0A6P1F176      PTS-----------------------PDWLRNLL----LGAAGGLVLGFAVAILRRALDI
A0A3N1NLD3      PTS-----------------------PNWLRNLL----LGAAGGLVLGFVLAILRRALDI
A0A3N2FVI8      PTS-----------------------PNWLRNLL----LGAAGGLVLGFVLAILRRALDI
A0A2S5XDQ6      PTS-----------------------PDWVRNIL----LGALGGLVLGFGLAFLRRALDI
A0A2S5XNN6      PTS-----------------------PDWVRNIL----LGALGGLVLGFGLAFLRRALDI
A0A4Q4D4T1      PVE-----------------------PDARRTYV----LFGLAGLLLGLLLAALRNLATA
A0A261FE22      PSS-----------------------PNVKGNMM----MGAFAALIIAAAGAVIREMSDN
A0A5C8C085      PVS-----------------------PNITRNLA----IGFGAGLLLGFAYALVRSQLDR
A0A1E4BP96      PSS-----------------------PNTTLNLA----LGGLVGLALGIAYAVMRSVLDS
A0A439DNZ6      PVI-----------------------PKTARNIA----LGLALGLALGIGLAILRDLLDN
A0A0J6YE86      PVV-----------------------PKRARNIA----VGLVLGLVLGVGFALIRDLLDN
A0A5Q5BFU2      PVI-----------------------PKTARNIV----FGLGLGLLLGVGLAVLRDTLDN
A0A151BT98      PAS-----------------------PDLKKALE----LALAVGLLLGVAMALLRHFMDN
A0A2Y8ZRF8      PAS-----------------------PDIKRTLE----LAFAVGLLLGVAMALLRHFMDN
A0A2R9UAT1      PSS-----------------------PNVRLALA----IGGVAGLVVGLMIALLRFTLDR
A0A4Q5J5D7      PVS-----------------------PRVELNLL----IGGVVGVLLGLAYALLRNQLDR
A0A1Y4CKD6      PAT-----------------------PVNEPSQSRIWGFGVMGGICTAALVVGLIALFNN
A0A3S0V9U6      PVG-----------------------PNVKKYVL----FGAAAGLIIVYLVVFIRRFMDV
A0A1S2N0P2      PVS-----------------------PSYRNYLL----IGAAVGLVLAYLIAFLRKFADV
A0A0Q3BEY5      PVS-----------------------PSYRNYLL----IGAAVGLVLAYLIAFLRKFADV
A0A4R6Q3C6      PVS-----------------------PSYRNYLL----IGAAVGLVLAYLIAFLRKFADV
A0A2X3GKL3      PVS-----------------------PSYRNYLL----IGAAVGLVLAYLIAFLRKFADV
A0A0Q7KBQ4      PVA-----------------------PNVPLNIA----VGLLLSLFVAIAGAVLRDLLDR
A0A1F1IHY9      PSS-----------------------PNLPLALS----IGGALGLLAGLGVAVVRHVLDN
A0A542HCT5      PVS-----------------------PNTQRNLA----LGFVLGLILGMGYALLRSQLDR
A0A2S8WHZ8      PVS-----------------------PNTKLSLA----LGGVIGLALGLGYALTRNHLDR
A0A537WNY9      PVF-----------------------PRKRLTLI----VASLIAVLLGVAAALVRENLGT
A0A5B8M469      PVS-----------------------PKPKLVLP----IGALAGLVLGYIVILLRRALDV
A0A1Y4CTD2      PES-----------------------PSNTSPLIAYRYLGAAIAALGAVALIALIYLLRN
A0A0Q5M6Z7      PSS-----------------------PNVQTALV----LAILAGIALAVVYGLLRQHFDR
A0A3N3ZPU0      PVS-----------------------PDLRLNLL----VGVGVGLLLAALYVLARSLFDR
A0A359IQX7      PVS-----------------------PNWKANLP----IGAIAGLVIGYGIAFIRRSIDG
A0A433EDP2      LVS-----------------------PNYTRNTL----IGAVAGLVLVYVVIFLRRSVDQ
A0A231VTW0      LVS-----------------------PNYTRNTL----IGAVAGLVLVYVVIFLRRSVDQ
A0A433ECD0      LVS-----------------------PNYTRNTL----IGAVAGLVLVYVVIFLRRSVDQ
U7V3Z1          LVS-----------------------PNYTRNTL----IGAVAGLVLVYVVIFLRRSVDQ
A0A1F1J417      LVS-----------------------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQ
A0A2A8D6P2      LVS-----------------------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQ
A0A1F0THV9      LVS-----------------------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQ
A0A5F0M6Y0      LVS-----------------------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQ
D8USQ4          LVS-----------------------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQ
E3H5W1          LVS-----------------------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQ
A0A1F1QKB0      LVS-----------------------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQ
A0A509JY23      LVS-----------------------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQ
A0A448USF4      LVS-----------------------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQ
A0A0Q9LZR0      PVS-----------------------PNTRRNLA----LGFVLGLMLGLGYALLRSQLDR
A0A1N7E3F1      PVA-----------------------PQPLTNMA----LGVLIALFAAVTGLVLRDRLDT
A0A544ZKQ1      PVA-----------------------PQPLTNMA----LGALIALLAAVTVLVLRDRLDT
A0A372P1T1      PVA-----------------------PQPLTNMA----LGALIALFAAVSGLVLRDRLDT
A0A5D0Q2X0      PVA-----------------------PQPLTNMA----LGALIALFAAVSGLVLRDRLDT
A0A5R8Z2E7      PVA-----------------------PQPLTNMA----LGALIALFAAVSGLVLRDRLDT
A0A1L2ZMV4      PSA-----------------------PVLRTNLM----YGAIAGLILAALFVFIKHLFDV
A0A6I3F378      PVR-----------------------PTPIATTG----LGLAIGALLGVALALIRQRLAT
A0A1E9T6I0      LVS-----------------------PNYQQNTL----IGAVIGLVVVYTAIFLRRALDQ
A0A1S1CQC5      LVS-----------------------PNYQQNTL----IGAVIGLVVVYTAIFLRRALDQ
A0A1S1CAD0      LVA-----------------------PNYEQNTL----IGAGTGLVLVYAAIFLRRALDQ
G5ET14          LVA-----------------------PNYEQNTL----IGAGTGLVLVYAAIFLRRALDQ
A0A1E9DXX2      LVA-----------------------PNYKQNVL----IGAGTGLVLVYAAIFLRRALDQ
A0A1E8S156      LVA-----------------------PNYQQNVL----IGAGTGLVLVYAAIFLRRALDQ
A0A1E8S5S2      LVA-----------------------PNYQQNVL----IGAGTGLVLVYAAIFLRRALDQ
A0A1S1DFA8      LVA-----------------------PNYQQNVL----IGAGTGLVLVYAAIFLRRALDQ
A0A2I1Z490      LVA-----------------------PNYQQNVL----VGAATGLALVYLAIFLRRALDQ
A0A1F0DAA9      LVA-----------------------PNYQQNVL----VGAAAGLALVYLAIFLRRALDQ
A0A1F0PHK9      LVA-----------------------PNYQQNVL----VGAAAGLALVYLAIFLRRALDQ
A0A1F0VZG6      LVA-----------------------PNYQQNVL----VGAAAGLALVYLAIFLRRALDQ
A0A1E9G8X4      LVA-----------------------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQ
A0A1E9IAW2      LVA-----------------------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQ
A0A1E9ZBC9      LVA-----------------------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQ
A0A1E9ZDP4      LVA-----------------------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQ
A0A1F0R6B5      LVA-----------------------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQ
A0A1F0Z7N5      LVA-----------------------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQ
A0A1F1D897      LVA-----------------------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQ
D2NP38          LVA-----------------------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQ
A0A1F1FV74      LVA-----------------------PNYQQNVL----IGAVAGLGLVYLAIFLRRALDQ
A0A1E9M791      LVA-----------------------PNYQQNVL----IGAVAGLGLVYLAIFLRRALDQ
A0A291DEI8      LVA-----------------------PNYQQNVL----IGAVAGLGLVYLAIFLRRALDQ
A0A1S1D5T1      LVA-----------------------PNYQQNVL----VGAATGLALVYLAIFLRRALDQ
A0A1E8TRD6      LVA-----------------------PNYQQNVL----VGAAAGLALVYLAIFLRRALDQ
A0A1F0XT88      LVA-----------------------PNYQQNVL----VGAAAGLALVYLAIFLRRALDQ
A0A1F1EVP5      LVA-----------------------PNYQQNVL----VGAAAGLALVYLAIFLRRALDQ
C6R548          LVA-----------------------PNYQQNVL----VGAVAGLALVYLAIFLRRALDQ
A0A0K2RXS2      LVA-----------------------PNYQQNVL----IGAVAGLGLVYLAIFLRRALDQ
A0A1F0KX60      LVA-----------------------PNYQQNVL----IGAVAGLGLVYLAIFLRRALDQ
A0A542I3V2      PIS-----------------------PNIKLALL----FGAIGGLLLAYAAALLRHHLDR
A0A2T0UZ65      PIG-----------------------PNVTKYVL----AGAVAGAALAYAWIFIRRLSDT
A0A1R4JTI6      PHT-----------------------PNVRMALA----LGALVGLVVGLGVAALRSLNDR
A0A4R7TM52      PSS-----------------------PNWRIAVV----IGAVIGLAAGIGAAAIRYVVDR
A0A542XE74      PVR-----------------------PGVIRNLI----LGGLAGAILGGLIAFGRRALDA
A0A0G3V3F3      PIS-----------------------PHPTRSAV----VAFLLTCILVGELIVASRAIGD
A0A0Q7QDF6      PVE-----------------------PDARRTYV----LFGLAGLLLGLLLAALRNLATA
A0A5R8L819      PSY-----------------------PNDRLFAA----LGVVAGLALGIIYAVARHTLDR
A0A261FQA1      PVS-----------------------PNKPRLIF----MGTLAGLVLALVVIVVIDVSDK
A0A1Q2CJ92      PVS-----------------------PNYVRNLA----LGAALGLLLGLGIVVGRQSFDR
A0A2T0S3C8      PVS-----------------------PKPLRNLA----LAALLGLLAGGVAAVLRETLDT
A0A4Y8WZJ3      PSS-----------------------PNLPLALS----IGGALGLLAGLGVAVVRHVLDN
A0A285VUW0      PVS-----------------------PNPTRNLA----IATLAGLMLGLAYALGMQALDT
A0A2R7Z032      PFT-----------------------PNYRNGAI----KGAGGGLVLAYVILIARRLIDR
A0A6J4MTQ2      PFT-----------------------PDYRLAAL----QGAAGGLALAYALILLRRAVDR
A0A1I0W453      PFT-----------------------PNYESAAM----KGALGGLGLAYAFLIGRRLIDR
A0A1H4LCS9      PFT-----------------------PNYQKAAM----YGAAGGLGLCYAFLVGRRLIDR
A0A4Q2RZP8      PFT-----------------------PNYKKGAM----QGAAAGLGLCYAVLVGRRLIDR
A0A0Q6VV12      PFT-----------------------PDYAKAAM----KGAAGGLALAYAFLIARRLIDR
A0A495NTA9      PFT-----------------------PDYRKAAM----KGAAGGLGLAYAFLIARRLIDR
A0A0Q9QB08      PFT-----------------------PDYRAAAI----KGALGGLALAYAFLIARRLIDR
A0A4Q2SA86      PFS-----------------------PDYPSAAL----KGALGGLALAYAVLIGRRLIDR
A0A4Z1C3Z0      PFS-----------------------PDYRSAAL----KGALGGLALAYAVLIARRLLDR
A0A542J310      PAF-----------------------PDTQTALI----VGGVLGLGFGVAFAMIRTAADR
A0A4Q2JUT1      PAF-----------------------PDVQTALI----VGGVLGLGFGIAFAMIRTAADR
A0A6L5R0V7      PAF-----------------------PDVQTALI----VGGVLGLGFGVAFAMIRTAADR
A0A444BL03      RIA-----------------------PDPPRNVL----IGIGLGLLVAYLLVFVRRQLDT
A0A4Y8X357      PSS-----------------------PDHLRNAL----IGGSIGLLAALAAAFLRRLLDV
R4LD52          PVS-----------------------PRPVRNLV----LAALLGLLTGAAGAVLREVLDT
A0A4T2CD79      PIF-----------------------PNVRLSVI----IGALIGLVLAIVYAMVRNVLDR
A0A6L6AM03      PFT-----------------------PDYRNAAM----KGAIGGLALAYAFLVGRRLIDR
A0A4Q2RU39      PFT-----------------------PDYERAAM----KGAIGGLGLAYAFLIARRLIDR
A0A4Q2SK58      PFT-----------------------PNYERAAM----KGAIGGLGIAYAFLIARRLIDR
A0A2N3YJR1      KIA-----------------------PDPRRNTL----VGLVGGLFLAYALIFVRRQLDT
A0A6G8FYB9      KIA-----------------------PNPKRSGL----IGLVVGLGVAYALVFVRRQLDT
A0A4Q4D742      PVA-----------------------PNVPLNLA----AGLLLSLFLAIAGALVRDLLDR
A0A1C6T1J1      PVS-----------------------PQPLRNFT----IGGLLGLVAGVALAVLRGMADV
A0A2W2CFC8      PVS-----------------------PQPVRNVL----IGTLIGLLAGVGLAILRGIADL
A0A2W2A4B0      PVA-----------------------PRTRANAA----LGGAAGAGLGVLAAFLRWALDT
A0A4Y9MDA5      PVS-----------------------PRTSLNLA----VGQLAGLLAGCVAALLRDRLDN
A0A1H7N9P7      PVS-----------------------PRTSLNLA----VGVLAGLLLGCGLALARDRLDT
A0A1M7V0F8      PVS-----------------------PRTSLNLA----VGVLAGLLAGCAAALVRDLLDN
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ESP---------------------------------------------------------
A0A4R5Z7B0      ANL---------------------------------------------------------
A0A6M8GFV5      TLT---------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A419GS64      TKD---------------------------------------------------------
A0A2V2CXY5      NMP---------------------------------------------------------
A0A2S8MDM2      SFE---------------------------------------------------------
A0A357ZDL3      KSF---------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      SES---------------------------------------------------------
A0A1I6IST1      SES---------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      RVPNE----TVLSQVVPAPVLGSISRVRGNGERGLYVAR---------------------
A0A2N4T4Q5      RIRSV----EEVRETFGTPVLGIIPEDDRLAD----HREIIETGTSGG------------
A0A1M3LEY6      RIRGE----ANVRQITDAPILGGIAFDKLAPKRPLIVQS---------------------
A0A538AJI7      RLRSW----RDLARASGYPVVGRIPPSRALKQGPLAAFS---------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      KVRGE----EDIRAHSDAPMLAGLPLESRGSKRGLISVE----E----------------
A0A4Q5A868      RIQDD----DEISEYIDAPIIGRIPEEELLNSAKPVIV-----S----------------
A0A6N4VXX3      TVKKR----EDLESITGASVVGEIPVDKPRRTAPVISF-----A----------------
A0A1H4I042      TVKKH----EDLESITGVAVVGDIPMDKARRGTPAISF-----G----------------
A0A4R7A6D9      TVKKH----EDLESITGVAVVGDIPMDKARRGAPAISF-----G----------------
A0A345NSU7      RVRGT----ADVEAISDRPVLSTIPMRKADDAHSIYLE-----L----------------
A0A0W8I9Y2      RIKSV----EEIRDGFGVAVLGVIPTDDRLADHREIVETGFSAG----------------
A0A7C6LSF9      RLRTR----DEVYEALRMPVVAEIPKLGRSARENARI---LVAD----------------
A0A4Y5YMQ6      RVRSV----AALEGVTDLPVLGLVPRRRNPAQGAAFL------I----------------
A0A255G8R8      RVRNE----ADVAAVTTASQVGSIPYVAGTPEHPLEL------G----------------
A0A6G7Y423      RIRTA----RDLQQTTTLPLLASIGRRHPDPAQGGE-------G----------------
A0A4Q5APW3      RIQND----DEISEYIDAPIIGRIPEEELLNSTKPVIVS---------------------
A0A4Q5B0V3      RIQND----DEISEYIDAPIIGRIPEEELLNSTKPVIVS---------------------
A0A1Q2CRV2      VVRSR----RDIEQVSDQAILGAIPLDESGDVLVLNS-----------------------
A0A222TG79      RIQTP----ADVVEVTESPVLAVVPRFPSAADSPVSFG----------------------
A0A6I3DFP2      RIGRTGDDDADVARITGLPVLGRIPKGEGFET----------------------------
A0A2S5WZJ5      KVRTS----KDLATATRSGSLGRIPKSPQLMGKNRGAN----------------------
K6WHS4          RIRSE----DSVLEVTELPILGDLPDDPAVDRNVVNFG----------------------
A0A1L2ZMQ6      RVRSV----EAIQK-VGMSAVGTLPSDPRLSRGRQVL---PVVYSAETRTD---------
A0A3L8NYD3      RIRTV----DDMESLVGTSVLTILPES-----------DELDRVGDDGLVG---------
A0A1M6K628      RVRQA----DEVEELTSATALGVVPTA-----------VEL---ASGVSLV---------
A0A561E8R3      RVRHQ----DDVERHLEAPVVGVIPKV-----------PEL---AEDYRGD---------
A0A3E2DN22      KVRDQ----ATIEELTGSGILSVIPDD------------KKLAEQREKSIV---------
A0A3Q9ULZ9      KIRSQ----NDVEELTGRGVLAIIPED------------RQLSKQRKTGDL---------
A0A3S9JFL2      KIRSQ----KDVEDLTGHGVMAVIPED------------RQLTKQRKSGDL---------
A0A3L7ADK2      RIRSA----DVLEQRYGTSVLGTIPMNPFLRKGSQLL---SQLTETSTESR---------
A0A1Q2CI19      RLRTR----EEIAEALDMPIVGVVPKI----------TAAQRRNKEILTVT---------
A0A512T3M3      RMRSR----EEIQEALGLPIIAEVPKL----------ARGQRASAGTLVVT---------
W6JTW4          RLRSR----TEIQAALGLPIIAEVPKL----------PRAKRSDAYHMVLD---------
A0A0A0JTY0      RLRTR----SEIHNALQMPIIAEVPRL----------KRAQRSRASIAVAT---------
A0A0A0JXF2      RLRSR----SEIGDALSMPIIAEVPRL----------KRSQRNRNSIAVVE---------
E6S8H2          RLRTR----SEIAAALRLPIIAEVPKM----------SRSLRRRRSIGVAD---------
A0A0A0JGH0      RLRTR----DEVHAGLRLPIIAEVPRL----------KRSQKGERTITVAV---------
N0E4U7          RLRTR----DEVHAALRLPIIAEVPRL----------SQAQKRKASIMVAA---------
A0A0A0IYK2      RLRTR----QEIHGALRMPIIAEIPRL----------RRSERHQGAIAVAE---------
A0A0Q9L0H3      RLRTR----GEIASALRMPIIAEIPRL----------KRSQRNSASIAVAS---------
A3TMK0          RLRTR----ADIHSALRMPIIAEVPRL----------KRSQRNRATLGVLE---------
A0A543PXP1      RLRTR----EEIAAALRLPIIAEVPRL----------NRSQRSSPSIGVAE---------
A3TMH6          RLRTR----EEIAAALALPIVAEVPRL----------GRTKRRDKTIGVAE---------
A0A1H6WL79      RIRAA----SEIERLFGLAVVGTLPLDKRLSEKSS-----VLESTSVVHRV---------
A0A101LAM5      RIRGA----SEIERLFGLAVVGTLPLDKRLSEKSS-----VLESTTGMHRV---------
A0A4Y3NEG0      RIRGA----SEIERLFGLAVVGTLPLDKRLSEKSS-----VLE-TTGTHRV---------
A0A6I2XCV4      RIRRR----DGLEAVTGLPVIVEVPVF----------TRAERQELSVIALD---------
A0A5R8VLL6      RLRTA----AEVENLFSVPVVGTLPVDLRLTGENKVLGGLPAAPAPGSRPQ---------
A0A538JQF8      RLRTR----AKVEDLLGLPVVAEIPLL----------SRRARRVPGILAFN---------
A0A1H6YPK1      RLRSR----NDVEIQFGVPVVGTVPWD-------------GAIAKKGPLGA---------
A0A2R7MGI0      RVRTV----QDITDTVDASVVGVLPVDKELANGRAVFSFTDIRDGRGSFAH---------
A0A2T7WQY4      RVRTV----EDITAAVGASVVGVLPIDKELANGRAVFSFTDTHDGRGSFAH---------
A0A1G6GTN3      RVRST----HDITDAVDASVVGVLPVDKELASGRAVFSFDDIKDGRGSFAH---------
A0A1N7DLV3      RVRSA----HDISDSVDVSVVGILPVDKELAAGRAVFSFDDIRDGRGSFAH---------
A0A1V2NSB5      RVRST----QDISDSVDVSVVGILPVDKELAAGRAVFSFDDIRDGRGSFAH---------
A0A0Q5Q5L3      RLRSA----SDITDAVDASVVGVLPVDKELAAGRAVFSFDDIRDGRGSFAH---------
A0A0Q6DVM4      RLRSA----SDITDAVDASVVGVLPVDKELAAGRAVFSFDDIRDGRGSFAH---------
A0A1R3WWR6      RIRSA----ADITDTIAASVVGILPVDKELASGRAVFSFDDIRDGRGSFAH---------
A0A0Q5JKD6      RVRSA----HDITDAVDASVVGVLPVDKELAGGRAVFSFDDIKDGRGSFAH---------
A0A0Q9TBP0      VVHDE----EAVRQALDAVVLARVPQW-----------SERSHRDRLVTLV---------
A0A5Q2FA83      RVRSE----LDLRAVSDRPILGALRLL-------------PKGTSPTVMSS---------
A0A346XTB0      RVTSR----TDPEIVLGVPPLGEIPLY------------RMTSEDQLTGLL---------
A0A0G3V3M7      RIRDV----PGTEGAARMPVIAEIPVM----------NLDRSLRFQVTTAV---------
A0A6I3DD56      RIRDV----PGTEGAARMPVIAEIPVM----------NLDRTLRFQVITAV---------
A0A2W6DK08      RPRDR----AAAGRAYRLPVLAEIPQA----------RHSERRNFAVITAS---------
A0A2S0LQ32      KIRHN----SDIEDILQSSVLAVVPRS-------------TDLSAKGRRNV---------
A0A2N6V1R5      RVRHN----SDVEELLGSSVLAVVPKS-------------TELNAKGRQNV---------
G9PHS6          RVRHN----SDVEELLGSSVLAVVPKS-------------TELNAKGRQNV---------
U1PLM7          RVRHN----SDVEELLGSSVLAVVPKS-------------TELNAKGRQNV---------
A0A6I1G2U1      RLRTR----DEVYQALRMPVIAEIPKL----------SRSQREQRQILVAD---------
A0A351ETF8      KIEGA----RSVEQATGLAILGTIPGYQ------------LNSDQVVEVIE---------
A0A542FTE6      RVRSV----ETVEKTAGVAVIGTLIRYEPFDAGRRLATAVSPLSGPARR-----------
A0A349B7N2      RLRTK----EDAEEAFGLPVVAEIPLL----------RRRQRRNSEVVSAE---------
A0A2S5UYV0      KVRNS----KDLASAAGVGSLGRIPKS-------------PQLMGKNRASN---------
A0A2S5X9U6      KVRDS----KDLAAASGAGTLGRIPKS-------------PQLMGKNRGTN---------
A0A2S5ULV5      KVRDS----KDLATASGAGTLGRIPKS-------------PQLMGKNRGTN---------
A0A653YMF0      KVRDS----KDLATASGAGTLGRIPKS-------------PQLMGKNRGTN---------
A0A346Y185      TADGR----NDPSRMLKAPLLGTVPSFEEIGLTGSVPTVEAPKSPAG-------------
A0A259S8H9      RVRAH----TDVAALVGAGVLGRVPRM--------------RKSGQGRNAA---------
A0A0Q5L115      RIRSA----AEVESRFGVGVIGTIPQNDALAEHGGLVAALPNATADDRHVN---------
A0A2W1Z497      RIRSA----AAIEAAFGVPVLGTIPLNPALTDHRQLVDALPNRTPEERRVN---------
A0A4V1VGV9      RIRHT----SEVEKLTGSGVLGVIPKA-------------PTLQSRRRGGL---------
A0A3Q9IY80      RIRSA----DAVEKETGLSVVGTIPDE----KSFTADNRLLPVDGISSGSH---------
A0A0F0LP73      RVRAH----TDVAAIVGAGVLGRVPK--------------FDPDGRSKKDA---------
A0A1F1X071      RLRTA----DDVTDVVGLPTLGALPDA----KE-------LARGKDGVLPE---------
A0A3R8RWC7      RLRTA----DDVTDVVGLPTLGALPDA----KE-------LARGKDGVLPE---------
A0A4U0RJZ4      RIRHT----SDLEKVTGVGTLGVIPKA-------------KNLQTKSRGGL---------
A0A4R1FGL9      RIRHT----SDLEKVTGVGTLGVIPKA-------------KNLQTKSRGGL---------
E3B8H1          RIRHT----SDLEKVTGVGTLGVIPKA-------------KNLQTKSRGGL---------
A0A7D7WDT9      RVRAD----TDTRELMGAGVLARVPK--------------MGRKGTPQGDS---------
A0A0Q5AWK6      RVRTV----DQLTELFGVGVLGRIPK--------------AGRRAGRKGET---------
A0A6P1F176      RVRTV----DDLTALFGVGVLGRIPKI----GKGRGGRGQGGRDRGGRGRA---------
A0A3N1NLD3      RVRTV----DDLTQLFGVGVLGRIPKM----GKGR-----VGRRGDARA-----------
A0A3N2FVI8      RVRTV----DDLTQLFGVGVLGRIPKM----GKGR-----GGRRGDARA-----------
A0A2S5XDQ6      RVRTV----DDLTELFGVGVLGRIPK------AGR-----PGRTGGRRG-----------
A0A2S5XNN6      RVRTV----DDLTELFGVGVLGRIPK------AGR-----PGRTGGRRG-----------
A0A4Q4D4T1      TVTSS----DALTEQVKAPVIGAVAQDRHVAD----HPLISTL-----------------
A0A261FE22      SIHTK----AEIQSIVPAPILAAVPKSPTLAG----RTPAVIVKPRGH------------
A0A5C8C085      RLRTA----SAVEKKFGLSVVGSIPKAPLLAHDTNEAANLAVLEAAAR------------
A0A1E4BP96      RIREP----QDVERNTGASVVGVLPLDHDLDN----RREVLSFTGASGN-----------
A0A439DNZ6      TVKDR----QNLEEITGVGVVGSIPLDKERKR---SPAKSLD------------------
A0A0J6YE86      TVKDR----TTLEQIANVGLVGTVPLDKERRR---HAAIAFE------------------
A0A5Q5BFU2      TVKDR----QALEDVTGAGVVGNIPLSKDRRK---QAAIGFE------------------
A0A151BT98      RVRTV----EDLETLVQRPVLSIVPRVGGGHRVVDTSD----------------------
A0A2Y8ZRF8      RVRTV----EDLEALVQRPVLSIVPRVGSGQRVVDTSD----------------------
A0A2R9UAT1      RIRSA----ELVERETGVAVVGTVPVEKSFTA----ANRLIPVGGQRD------------
A0A4Q5J5D7      RLRSS----QAVERQFGVTVVGAIPTASDLASTDGAGPVAVQ-DRSGS------------
A0A1Y4CKD6      TIKTA----EDLESVSSMVCLGALPEVRAKARKRSAASRYVS------------------
A0A3S0V9U6      RVRTT----KDMEESTGLGVLGVLPKTNALDQ----NSFLED------------------
A0A1S2N0P2      RVRTT----DDLENATEAGTLGILPKSSALDE----NTFLSD------------------
A0A0Q3BEY5      RVRTT----DDLENATEAGTLGILPKSSALDE----NTFLSD------------------
A0A4R6Q3C6      RVRTT----DDLENATEAGTLGILPKSSALDE----NTFLSD------------------
A0A2X3GKL3      RVRTT----DDLENATEAGTLGILPKSSALDE----NTFLSD------------------
A0A0Q7KBQ4      TVKTR----QEAEELSGGAVLATLPFDRQLKK------QALTSEGHGA------------
A0A1F1IHY9      KIRSA----AALESRFGLTILGTVPESTRSAR----NRRRRD----GGDVINLAGRVDGE
A0A542HCT5      RVREP----EVIERDFGVTVAGAIPETSALVRKKGGLVPLVVTGPRKD------------
A0A2S8WHZ8      RIRSV-----EAIERLGVSVVGTIPEDQRLTE----GRSVVE----TGSIVHDD------
A0A537WNY9      RIETA----EDLARIAGVPSYGEVPHEPAVTRLATPEALALD------------------
A0A5B8M469      RVRAG----TDMIELLGTGVLGRVPRFKGKGG----VR--------GG------------
A0A1Y4CTD2      TVKTA----EQASDLLDGRVLGTVPF-----E----RKRVVR----GG------------
A0A0Q5M6Z7      RIRSV----EQIERLLGAPVIGTIPASPALED----RRRVTDSDSGDDA-----------
A0A3N3ZPU0      KVRSS----EAVANATGLAILGTIPLDKRLTA----KRGVIPTAPPRKD-----------
A0A359IQX7      RVRTQ----AEVEELTGAGVIGVIPKVAELEQ----QRVEEGQVSLGE------------
A0A433EDP2      RIRTR----DDAVKATGSSILGVLPTSDDLTE----EN-IVT----GS------------
A0A231VTW0      RIRTR----DDAVKATGSSILGVLPTSDDLTE----EN-IVT----GS------------
A0A433ECD0      RIRTR----DDAVKATGSSILGVLPTSDDLTE----EN-IVT----GS------------
U7V3Z1          RIRTR----DDAVKATGSSILGVLPTSDDLTE----EN-IVT----GS------------
A0A1F1J417      RIRTR----DDAIKATNSNILGVLPVSDDLAE----EN-IVH----AS------------
A0A2A8D6P2      RIRTR----DDAIKATNSNILGVLPVSDDLAE----EN-IVH----AS------------
A0A1F0THV9      RIRTR----DDAIKATNSNILGVLPVSDDLAE----EN-IVH----AS------------
A0A5F0M6Y0      RIRTR----DDAIKATNSNILGVLPVSDDLAE----EN-IVH----AS------------
D8USQ4          RIRTR----DDAIKATNSNILGVLPVSDDLAE----EN-IVH----AS------------
E3H5W1          RIRTR----DDAIKATNSNILGVLPVSDDLAE----EN-IVH----AS------------
A0A1F1QKB0      RIRTR----DDAIKATNSNILGVLPVSDDLAE----EN-IVR----AS------------
A0A509JY23      RIRTR----DDAIKATNSNILGVLPVSDDLAE----EN-IVR----AS------------
A0A448USF4      RIRTR----DDAIKATNSNILGVLPVSDDLAE----EN-IVR----AS------------
A0A0Q9LZR0      RVREP----EVVERDFGVTVAGAIPETSALVR----KKGGLVPLVVAGTSKE--------
A0A1N7E3F1      TIKTA----ETLRQVAKSSVLGLIGYERDARR----HPLVLRDQGRSV------------
A0A544ZKQ1      TVKTA----EALQQVARSSILGVIGYERDAKR----HPLILRDQGRSS------------
A0A372P1T1      TVKTA----ETLQKVARSSILGVIGYERDAKR----HPLILRDQGRSS------------
A0A5D0Q2X0      TVKTA----ETLQKVARSSILGVIGYERDAKR----HPLILRDQGRSS------------
A0A5R8Z2E7      TVKTA----ETLQKVARSSILGVIGYERDAKR----HPLILRDQGRSS------------
A0A1L2ZMV4      RIRST----EQVETTTGHPVLGTVPQDKRLDH----HRQVITVGEPGD------------
A0A6I3F378      TVDRP---EDLVTLGIAAPLLTVVPVTSSTGD----RPLATT----DP------------
A0A1E9T6I0      RIRTR----DDATKATGASILGVLPVSEDLNE----EN-IVN----GD------------
A0A1S1CQC5      RIRTR----DDATKATGASILGVLPVSEDLNE----EN-IVN----GD------------
A0A1S1CAD0      RIRTR----DDATKATGASILGVLPVSDDLNE----DN-IVK----GD------------
G5ET14          RIRTR----DDATKATGASILGVLPVSDDLNE----DN-IVK----GD------------
A0A1E9DXX2      RIRTR----DDATKATGASILGVLPISDDLNE----EN-IVN----GD------------
A0A1E8S156      RIRTR----DDATKATGASVLGVLPVSDDLNE----DN-IVK----GD------------
A0A1E8S5S2      RIRTR----DDATKATGASVLGVLPVSDDLNE----DN-IVK----GD------------
A0A1S1DFA8      RIRTR----DDATKATGASVLGVLPVSDDLNE----DN-IVK----GD------------
A0A2I1Z490      RIRTR----DDATKATGASVLGVLPVSDDLNE----DN-IVK----GD------------
A0A1F0DAA9      RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVK----GN------------
A0A1F0PHK9      RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVK----GN------------
A0A1F0VZG6      RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVK----GN------------
A0A1E9G8X4      RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVN----GN------------
A0A1E9IAW2      RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVN----GN------------
A0A1E9ZBC9      RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVN----GN------------
A0A1E9ZDP4      RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVN----GN------------
A0A1F0R6B5      RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVN----GN------------
A0A1F0Z7N5      RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVN----GN------------
A0A1F1D897      RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVN----GN------------
D2NP38          RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVN----GN------------
A0A1F1FV74      RIRTR----DDATKATGASILGVLPVSEDLNE----EN-IVK----GD------------
A0A1E9M791      RIRTR----DDATKATGASILGVLPVSEDLNE----EN-IVK----GD------------
A0A291DEI8      RIRTR----DDATKATGASILGVLPVSEDLNE----EN-IVK----GD------------
A0A1S1D5T1      RIRTR----DDATKATGASILGVLPVSDDLSE----EN-IVN----GG------------
A0A1E8TRD6      RIRTR----DDATKATGASILGVLPVSDDLSE----EN-IVN----GD------------
A0A1F0XT88      RIRTR----DDATKATGASILGVLPVSDDLSE----EN-IVN----GD------------
A0A1F1EVP5      RIRTR----DDATKATGASILGVLPVSDDLSE----EN-IVN----GD------------
C6R548          RIRTR----DDATKATGASILGVLPVSDDLSE----EN-IVN----GD------------
A0A0K2RXS2      RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVN----GN------------
A0A1F0KX60      RIRTR----DDATKATGASILGVLPVSDDLNE----EN-IVN----GN------------
A0A542I3V2      RLRSS----SEIERLFDVPVIGTLPYDPDISG----ALKVLG----TERHQLTQAGERNR
A0A2T0UZ65      RIRTS----KDVEDLTGSSSLGVIPLSNELRK----ARGGRS----SG-----------L
A0A1R4JTI6      RIRGV----KVLEETFGLTVLGTIPAMAGLGR----RAQRNR----TQSKDSNAEVESRS
A0A4R7TM52      RIRSA----DIVERETGHAVVGTIPFEKSFTS----AGRLIP----FGGGYDEGIRSKHF
A0A542XE74      RIRSQ----EQVELLTGKAVLGVVPETKSLKV----RKGQAS----KR----------VS
A0A0G3V3F3      RIGRTGDDDADVARITGLPVLGRIPKGEGF------------------------------
A0A0Q7QDF6      TVTSS----DALTEQVKAPVIGAVAQDRHVAD----HPLIST----LS----------NQ
A0A5R8L819      RVRSA----ETVEKETGRAVVGILPLERTFSS----ASRLLP----AG----GSHVPHEL
A0A261FQA1      RVRDT----ADIQRILYSPVISSVPKSDTFRG----TAPAVI----SD----------PS
A0A1Q2CJ92      RIRRA----HEAEEVAETSSLGIVPAAAELAG----ESALVT----GS------------
A0A2T0S3C8      TVKTA----DALHELAGAPVLAGVPFDADARS----GPLRLT----GS----------GH
A0A4Y8WZJ3      KIRSA----AALESRFGLTILGTVPESTRSAR----NRRRRD----GGDVINLAGRVDGE
A0A285VUW0      RLRST----ADVEALTGRPVLSTVPVLPTAGR----TSSMYI----EN---------DPF
A0A2R7Z032      RIRSV----KDVETATGSAVIGIIPKVDALNR----THRGVR----GD-----------L
A0A6J4MTQ2      KIRSV----NDVEDATGGSVIGIIPKVDSLAQ----SSRGIR----GD-----------L
A0A1I0W453      RIRTT----KHVEEATGASVLGIIPKEDSLGR----SHRGVR----GD-----------L
A0A1H4LCS9      RIRSA----KHVEEATGASVLGIIPKEDALGR----GHRGVR----GD-----------L
A0A4Q2RZP8      RIRSA----KHVEEATGSSVLGIIPKEDALGR----GHRGVR----GD-----------L
A0A0Q6VV12      RIRSV----KHVEDATGAAVLGIIPKEDALGR----THRGVR----GD-----------L
A0A495NTA9      RVRSV----KHVEDATGASVLGIIPKEDALDR----GHRGVR----GD-----------L
A0A0Q9QB08      RVRSA----KHVEDATGAAVLGVIPKEDALGR----VNRGVR----GD-----------L
A0A4Q2SA86      RIRSA----KHVEEATGAAVLGIIPKEDSLGR----THRGVR----GD-----------L
A0A4Z1C3Z0      RIRSA----AHVEEATGAAVLGVIPTEDSLGR----THRGVR----GD-----------L
A0A542J310      RIRSA----ADIEQKTDVAVVGTIPWVAAFND----DNRIVD----PA--AANSTGKNGT
A0A4Q2JUT1      RIRNA----EDTESKTGVAVVGTIPWVAGFDS----GERLVD----TS--AANRTGRTGT
A0A6L5R0V7      RIRSA----EDTESKTGVAVVGTIPWVAGFDS----GERLVD----TS--AANRTGRSGT
A0A444BL03      RLRSA----QDVEAATGASVLGVVPVTSELRV----QGGRGR----LD----------HL
A0A4Y8X357      NVRTT----TDATQASGAGLLGAIPQDKTMTA----ERTDRL----GD----------PS
R4LD52          TVKTV----EGLQALAAAPVLAAVPFDDDAKE----GPRALL----GT----------GH
A0A4T2CD79      RIRTA----ATIQQQFKLAVIGVLPKDAALTD----ENRIVS----ETGGIHAGSVTVQS
A0A6L6AM03      RIRSA----KHVEDATGASVLGIIPKEDALGR----VHRGVR----GD-----------L
A0A4Q2RU39      RVRSA----KHVEEATGAAVLGVIPKEEVLGR----THRGVR----GD-----------L
A0A4Q2SK58      RVRSA----KHVEEATGASVLGIIPKEEALGR----SHRGVR----GD-----------L
A0A2N3YJR1      RVRSA----EDVEKETGASVLGVVPVTPELRA----ARGRGR----LD----------AL
A0A6G8FYB9      RLRTV----GDVEELTAASVLGVVPQTKELGV----VRGRGR----VG----------QL
A0A4Q4D742      TVKSR----RDVETITSSAVLATLPFYPQVKK----EP--LS----AE----------TG
A0A1C6T1J1      RLRDA----AGLQRVTGSPLLGEIPLDTAART----APLIVG----EA----------AT
A0A2W2CFC8      RVRDG----ASLRRVTDSPLLGEIPLDNDART----APLIIG----VA----------AA
A0A2W2A4B0      KVRGR----DEVQELWDLPVLGDIGFDPEASK----QPLVLR----DA----------RA
A0A4Y9MDA5      RVRDT----GVVAELTSLPVVGSIPTRPAGST----PGAVVD----AD----------PS
A0A1H7N9P7      RVRDA----AVVAQLTGLPVVGSIPTRPSGST----AHPAVD----AD----------PH
A0A1M7V0F8      RVRDA----GVVAELTGVPVVGAIPARSPRSA----PGAVVE----TD----------SH
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ----------FQNPLLSNASKTLFANIRFVSI----------------------------
A0A538BYZ4      ----------TPTSFAAEQYRGLRHLVEQFHK----------------------------
A0A348NU28      ----------EPLGHTSEEFRRIRAALSYSGV----------------------------
A0A2N4T4Q5      ----------RGHHAFSEALRELRTNLSFVSV----------------------------
A0A1M3LEY6      ----------EPNSPRAEAFRSLRTNLQFLDV----------------------------
A0A538AJI7      ----------DLRT--ASAFRILRANLEPQLR----------------------------
A0A538AM15      ----------------AEQYRALRHTVEQLHK----------------------------
A0A022KX11      ----------DPHGRHAEAVRRLRTNLMFVDV----------------------------
A0A4Q5A868      ----------EPGSPVAEGFRRVRTNLSFMAP----------------------------
A0A6N4VXX3      ----------SDNSRIAESFRKLRTNLSFLAV----------------------------
A0A1H4I042      ----------TENSQIAESFRKLRTNLSFLSV----------------------------
A0A4R7A6D9      ----------TENSQIAESFRKMRTNLSFLSV----------------------------
A0A345NSU7      ----------DPFGPQAEAVRQLRTNMMFVDV----------------------------
A0A0W8I9Y2      ----------RGHHEFSEALRELRTNLSFVSV----------------------------
A0A7C6LSF9      ----------EPHGVYADGYRTARAAVMHTAS----------------------------
A0A4Y5YMQ6      ----------SPNGSAAEAFRQVRSALRFSA-----------------------------
A0A255G8R8      ----------AHTDQRFEAYRRLRTNVQFVA-----------------------------
A0A6G7Y423      ----------AHWATA-EAYRRLRTNVGFVAL----------------------------
A0A4Q5APW3      ----------EPGSPVAEGFRRVRTNLSFMAP----------------------------
A0A4Q5B0V3      ----------EPGSPVAEGFRRVRTNLSFMAP----------------------------
A0A1Q2CRV2      ----------DPHGLRAEAYRSMRTNLQFLAL----------------------------
A0A222TG79      ----------AGSSPASEAYRRLRTNLSFIGV----------------------------
A0A6I3DFP2      ----------------VEAFRVLRTNLMVLEA----------------------------
A0A2S5WZJ5      ----------DADAIAAESFRRLRTNLRFASV----------------------------
K6WHS4          ----------VGGSPAAEAFRHLRTNLSFMDV----------------------------
A0A1L2ZMQ6      ----------RSYHAYSEALRELRTNLAYMDV----------------------------
A0A3L8NYD3      ----------SQTGPAAEALRQLRTNLRFVDV----------------------------
A0A1M6K628      ----------NDSGTAAEALRQLRTNLRFVSV----------------------------
A0A561E8R3      ----------TGLGNAAEALRMLRTNLRFIDV----------------------------
A0A3E2DN22      ----------HISGVTGEAFRHLRTNLRFANV----------------------------
A0A3Q9ULZ9      ----------GLSGITAEAFRQLRTNLRFINV----------------------------
A0A3S9JFL2      ----------ELAGIAGEAFRQLRTNLRFINV----------------------------
A0A3L7ADK2      ----------HASFAMAESLRELRTNLSYVDV----------------------------
A0A1Q2CI19      ----------QPLSPYADGYRSVRAALAHGQA-----------------EAAPA------
A0A512T3M3      ----------EPLSPFADGYRAARTAISHTLG-----------------RSAKPSDMSPR
W6JTW4          ----------QPLSPFADAYRAARAATTHSVE-----------------TSRAAAPRGPR
A0A0A0JTY0      ----------DPLSIYSDGYRAARTALVHTTG-----------------QVMPGDYTPRR
A0A0A0JXF2      ----------DPLNLYSDAYRAARTALSHTAG-----------------QVMPSDYTPRR
E6S8H2          ----------EPLSPYADGYRGARTALVHTSS-----------------LLVQGD--DRR
A0A0A0JGH0      ----------DPLSPYSDAYRAARTALMHTVS-----------------RQAPGEYMGRR
N0E4U7          ----------DPLDPYSDAYRAARTALMHTVS-----------------RKMTGDYTGRR
A0A0A0IYK2      ----------DPLSNYSDGYRAARTALVHTTG-----------------QIMPGDYTPRR
A0A0Q9L0H3      ----------DPLSNYSDGYRAARTALVHTSG-----------------QIMPGDYTPRR
A3TMK0          ----------DPLSLYADGYRAARTALTHTAG-----------------QVMPGDYSPRR
A0A543PXP1      ----------QPLSPYSDSYRAARTALAHTAS-----------------QHAGASVSSTD
A3TMH6          ----------QPLSPYADAYRGARTAIVHTAS-----------------QRLSVGSAPRH
A0A1H6WL79      ----------PGGHAMAEALRELRTNLNFIDV----------------------------
A0A101LAM5      ----------PGGHAMAEALRELRTNLDFIDV----------------------------
A0A4Y3NEG0      ----------PGGHAMAEALRELRTNLDFIDV----------------------------
A0A6I2XCV4      ----------APRSRTAELYRTVRTSILFAIE----------------------AESLAA
A0A5R8VLL6      ----------SP--AFSEALRELRTNLTFLDV----------------------------
A0A538JQF8      ----------RPLSPLAEGYRVLRTSLLRMPTRVFTEAPPTPDASGGHPEVEAAAAVPSG
A0A1H6YPK1      ----------VPGFAFTEAMRQLRTNLQFMNV----------------------------
A0A2R7MGI0      ----------K------EAIRELRTNLQYVDV----------------------------
A0A2T7WQY4      ----------K------EAVRELRTNLQYVDV----------------------------
A0A1G6GTN3      ----------K------EAMRELRTNLQYVDV----------------------------
A0A1N7DLV3      ----------K------EAMRELRTNLQYVDV----------------------------
A0A1V2NSB5      ----------K------EAMRELRTNLQYVDV----------------------------
A0A0Q5Q5L3      ----------K------EAMRELRTNLQYVDV----------------------------
A0A0Q6DVM4      ----------K------EAMRELRTNLQYVDV----------------------------
A0A1R3WWR6      ----------K------EAMRELRTNLQYVDV----------------------------
A0A0Q5JKD6      ----------K------EAMRELRTNLQYVDV----------------------------
A0A0Q9TBP0      ----------DPHSPASEEYQRLGVNVRFMVAT------------------GA-------
A0A5Q2FA83      ----------DPHGVAAEEYRRLRTNLQFADVT---------------------------
A0A346XTB0      ----------RVDPSAAEAYEFVLSSIEFALA----------------------------
A0A0G3V3M7      ----------DPTSLMAEAYRSFRTSLVAMWQR------------------HPTNNRPVL
A0A6I3DD56      ----------DPTSLMAEAYRSFRTSLVAMWQR------------------HPTNNRAGL
A0A2W6DK08      ----------EPESSAAEAYRSLRSSIMFTENR------------------MNHFDREDM
A0A2S0LQ32      ----------DGLGQAAEAIRLLRTNLRFVDV----------------------------
A0A2N6V1R5      ----------DGLGQAAEALRHLRTNLRFVDV----------------------------
G9PHS6          ----------DGLGQAAEALRHLRTNLRFVDV----------------------------
U1PLM7          ----------DGLGQAAEALRHLRTNLRFVDV----------------------------
A0A6I1G2U1      ----------EPHGVYADGYRTARAAVMHTASL------------------EVGRSESAL
A0A351ETF8      ----------RPKSLAAERYEAVLTAIEFASI----------------------------
A0A542FTE6      -----------SHFAITEGIRELRTNLAYVSI----------------------------
A0A349B7N2      ----------RPRSRIAEAYRGLRTSVQYMGVV------------------TSRVGESPS
A0A2S5UYV0      ----------DADAIAAESFRRLRTNLRFASV----------------------------
A0A2S5X9U6      ----------DADAIAAESFRRLRTNLRFASV----------------------------
A0A2S5ULV5      ----------DADAIAAESFRRLRTNLRFASV----------------------------
A0A653YMF0      ----------DADAIAAESFRRLRTNLRFASV----------------------------
A0A346Y185      -----------------EAYQFLVGALAFALA----------------------------
A0A259S8H9      ----------LARAVAHEAYRQIRTGLRFASV----------------------------
A0A0Q5L115      ----------FAMS---EALRELRTNLAYVKV----------------------------
A0A2W1Z497      ----------FATS---EALRELRTNLSYVHV----------------------------
A0A4V1VGV9      ----------GELGTTAEAFRMLRTNLRYIST----------------------------
A0A3Q9IY80      ----------ADLFGVSEAMRELRTNLQFMDV----------------------------
A0A0F0LP73      ----------IARAVAHEAHRQIRTGLRFASV----------------------------
A0A1F1X071      ----------PTSFPSREALRKLRTNLRYIDV----------------------------
A0A3R8RWC7      ----------PASFPSREALRKLRTNLRYIDV----------------------------
A0A4U0RJZ4      ----------GALGSTSEAFRMLRTNLRYVLA----------------------------
A0A4R1FGL9      ----------GALGSTSEAFRMLRTNLRYVSA----------------------------
E3B8H1          ----------GALGSTSEAFRMLRTNLRYVSA----------------------------
A0A7D7WDT9      ----------LTETVANEAFRQLRTSLRFANV----------------------------
A0A0Q5AWK6      -----------VDRITAEAYRALRTGLRFSSV----------------------------
A0A6P1F176      -----------VDGITAEAFRALRTGLRFSSV----------------------------
A0A3N1NLD3      -----------VDGITAEAFRALRTGLRFSSV----------------------------
A0A3N2FVI8      -----------VDGITAEAFRALRTGLRFSSV----------------------------
A0A2S5XDQ6      -----------TDALTAEAFRSLRTGLRFSSV----------------------------
A0A2S5XNN6      -----------TDALTAEAFRSLRTGLRFSSV----------------------------
A0A4Q4D4T1      ----------SNQHPRAEAMRIIRTNLQFLDV----------------------------
A0A261FE22      ---------------AAEEFRRLITNLSFVKN----------------------------
A0A5C8C085      ----------GAGQSAAEAFRKLRTNLQFMNV----------------------------
A0A1E4BP96      ----------VVRGALTEAIRELRTNLQFMDV----------------------------
A0A439DNZ6      ----------NDNSAFAEAFRKLRTNLQFLAV----------------------------
A0A0J6YE86      ----------NDNSVIAEAFRKLRTNLQFLSV----------------------------
A0A5Q5BFU2      ----------SDNSGIAEAFRKLRTNLQFLAV----------------------------
A0A151BT98      ----------HPSGAMVEAMRRLRTNVKFVNV----------------------------
A0A2Y8ZRF8      ----------SPSGAMVEAMRRLRTNVKFVNV----------------------------
A0A2R9UAT1      ----------ERLFAVSEALRELRTNIQFMDV----------------------------
A0A4Q5J5D7      ----------QRRSESAEAFRKLRTNLQFMDV----------------------------
A0A1Y4CKD6      ----------ALDKRVSHGFRESARAMGARVR----------------------------
A0A3S0V9U6      ----------AADHQSAESLRQLRTNLRFVSV----------------------------
A0A1S2N0P2      ----------RADHQSEEALRQLRTNLRFVSV----------------------------
A0A0Q3BEY5      ----------RADHQSEEALRQLRTNLRFVSV----------------------------
A0A4R6Q3C6      ----------RADHQSEEALRQLRTNLRFVSV----------------------------
A0A2X3GKL3      ----------RADHQSEEALRQLRTNLRFVSV----------------------------
A0A0Q7KBQ4      ---------------LAEAFRVLRTNLQFANL----------------------------
A0A1F1IHY9      TSPKQH----QDSFRLTESFKELRTNLQFLRP----------------------------
A0A542HCT5      ----------KDPVHSAESFLKLRTNLQFMDI----------------------------
A0A2S8WHZ8      ----------RAAHAFSESLRELRTNLNYIDV----------------------------
A0A537WNY9      ----------NRLHVFAEALRDVRTNLLFTEG----------------------------
A0A5B8M469      ----------ELDRLSAESFRQVRTGLRFSSV----------------------------
A0A1Y4CTD2      ----------DERSVPALVLSSPLVSMGFAEA----------------------------
A0A0Q5M6Z7      ----------VELFTISESLRELRTNLSYIDV----------------------------
A0A3N3ZPU0      ----------REAWATSEAFRQLRTNLTFANV----------------------------
A0A359IQX7      ---------------ASEAFRHLRTNLRYVNV----------------------------
A0A433EDP2      ----------SNDHIAQESIRQLRTNLRFVNI----------------------------
A0A231VTW0      ----------SNDHIAQESIRQLRTNLRFVNI----------------------------
A0A433ECD0      ----------SNDHIAQESIRQLRTNLRFVNI----------------------------
U7V3Z1          ----------SNDHIAQESIRQLRTNLRFVNI----------------------------
A0A1F1J417      ----------NDDHIAHESIRQLRTNLRFVNI----------------------------
A0A2A8D6P2      ----------NDDHIAHESIRQLRTNLRFVNI----------------------------
A0A1F0THV9      ----------NDDHIAHESIRQLRTNLRFVNI----------------------------
A0A5F0M6Y0      ----------NDDHIAHESIRQLRTNLRFVNI----------------------------
D8USQ4          ----------NDDHIAHESIRQLRTNLRFVNI----------------------------
E3H5W1          ----------NDDHIAHESIRQLRTNLRFVNI----------------------------
A0A1F1QKB0      ----------NDDHIAHESIRQLRTNLRFVNI----------------------------
A0A509JY23      ----------NDDHIAHESIRQLRTNLRFVNI----------------------------
A0A448USF4      ----------NDDHIAHESIRQLRTNLRFVNI----------------------------
A0A0Q9LZR0      ----------KDPVHSAESFLKLRTNLQFMDI----------------------------
A0A1N7E3F1      ---------------RAEAFRSLRTNLQFIGV----------------------------
A0A544ZKQ1      ---------------RAEAFRSLRTNLQFIGV----------------------------
A0A372P1T1      ---------------RSEAFRSLRTNLQFIGV----------------------------
A0A5D0Q2X0      ---------------RSEAFRSLRTNLQFIGV----------------------------
A0A5R8Z2E7      ---------------RSEAFRSLRTNLQFIGV----------------------------
A0A1L2ZMV4      ----------KQGWATSEALRELRTNLTFSRV----------------------------
A0A6I3F378      ----------TND--AVEAYRWLRTSVQFAGT----------------------------
A0A1E9T6I0      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1S1CQC5      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1S1CAD0      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
G5ET14          ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1E9DXX2      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1E8S156      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1E8S5S2      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1S1DFA8      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A2I1Z490      ----------TEDHIAQESIRQLRTNLRFVNV----------------------------
A0A1F0DAA9      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1F0PHK9      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1F0VZG6      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1E9G8X4      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1E9IAW2      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1E9ZBC9      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1E9ZDP4      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1F0R6B5      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1F0Z7N5      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1F1D897      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
D2NP38          ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1F1FV74      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1E9M791      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A291DEI8      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1S1D5T1      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1E8TRD6      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1F0XT88      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1F1EVP5      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
C6R548          ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A0K2RXS2      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A1F0KX60      ----------TDDHIAQESIRQLRTNLRFVNV----------------------------
A0A542I3V2      A--------------FVEALRALRTNLRFVDV----------------------------
A0A2T0UZ65      G---------L----AGESFRQIRTNLRFVSP----------------------------
A0A1R4JTI6      ALLELTGHTGRDDFHVVEAFKELRTNLQFLRP----------------------------
A0A4R7TM52      ----------R----VAEAMRELRTNIQFMDV----------------------------
A0A542XE74      G---------A----AGEALRQLRTNLRFVSV----------------------------
A0A0G3V3F3      ----------E----TVEAFRVLRTNLMVLEA----------------------------
A0A0Q7QDF6      H---------P----RAEAMRIIRTNLQFLDV----------------------------
A0A5R8L819      F---------A----MSEAMRELRTNIQFMDV----------------------------
A0A261FQA1      S---------K----AAEDIRRLALNLDFIVP----------------------------
A0A1Q2CJ92      S---------A----AAEAIRQIRTNLRFVSV----------------------------
A0A2T0S3C8      S---------P----RSEALRQLRTNLQFVDV----------------------------
A0A4Y8WZJ3      TSPKQHQDSFR----LTESFKELRTNLQFLRP----------------------------
A0A285VUW0      G---------P----QAEAIRKLRTNLVFVDV----------------------------
A0A2R7Z032      G---------Q----AAEAFRQLRTNLRFLDV----------------------------
A0A6J4MTQ2      G---------Q----AAEAFRQLRTNLRFVDV----------------------------
A0A1I0W453      G---------K----AAESFRQLRTNLRFVDV----------------------------
A0A1H4LCS9      G---------R----AAESFRQLRTNLRFVDV----------------------------
A0A4Q2RZP8      G---------R----AAESFRQLRTNLRFVDV----------------------------
A0A0Q6VV12      G---------R----AAESFRQLRTNLRFVDV----------------------------
A0A495NTA9      G---------R----AAEAFRQLRTNLRFVDV----------------------------
A0A0Q9QB08      G---------R----AAEAFRVLRTNLRFVDV----------------------------
A0A4Q2SA86      G---------R----AAEAFRQLRTNLRFVDV----------------------------
A0A4Z1C3Z0      G---------R----AAEAFRLLRTNLRFVDV----------------------------
A0A542J310      F---------A----VSEALRSLRTNLQFMDV----------------------------
A0A4Q2JUT1      F---------A----VSEALRSLRTNLQFMDV----------------------------
A0A6L5R0V7      F---------A----VSESLRSLRTNLQFMDV----------------------------
A0A444BL03      G---------I----ASESFRQIRTNLRFVGV----------------------------
A0A4Y8X357      P---------R----AAEAVRQLRTNLRFAAV----------------------------
R4LD52          S---------A----RAEALRQLRTNLQYVDV----------------------------
A0A4T2CD79      R---------P----LAEAFRELRTNMRFMRV----------------------------
A0A6L6AM03      G---------R----AAEAFRQLRTNLRFVDV----------------------------
A0A4Q2RU39      G---------R----AAEAFRQLRTNLRFVDV----------------------------
A0A4Q2SK58      G---------K----AAEAFRQLRTNLRFVDV----------------------------
A0A2N3YJR1      G---------A----SAESFRQIRTNLRFVGV----------------------------
A0A6G8FYB9      G---------I----ATEAFRQIRTNLRFVGV----------------------------
A0A4Q4D742      G---------N----LAEAFRVLRTNLQFVKL----------------------------
A0A1C6T1J1      S---------A----RAEAVRKLRTNLRFVDV----------------------------
A0A2W2CFC8      S---------A----RAEAIRKLRTNLRFVDA----------------------------
A0A2W2A4B0      S---------A----RAEAFRSLRTNVQFLAS----------------------------
A0A4Y9MDA5      G---------V----VAEAFRQLRTNLQFVGV----------------------------
A0A1H7N9P7      G---------V----VAEAVRQFRTNLQFLGM----------------------------
A0A1M7V0F8      S---------V----AAEAFRHLRTNLQFVGV----------------------------
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      -----------------EEIRRLRTNVMFVLP----------------------------
A0A357ZCV8      ----------GSRSEVQNAAKTLYANIRFLSP----------------------------
A0A4R5Z7B0      ----------DPKSPISEQYRTIRTNIQYSSI----------------------------
A0A6M8GFV5      ----------NPKSPFAEQYRTVRTNIQFSSI----------------------------
A0A4R1CW45      -----------------RPFSLMRTQLAKRLV----------------------------
A0A419GS64      ----------FPASVLAESYRTLRANILLTNV----------------------------
A0A2V2CXY5      ----------KLPFDVTEALNQFRINLGFCGD----------------------------
A0A2S8MDM2      ----------TDNAATAEAFRKLRTNLQFLAI----------------------------
A0A357ZDL3      ----------SNNHEIQNAIKTLYANIRFLSP----------------------------
A0A4Y8ZIU8      ----------------------LRTNLRFAAV----------------------------
A0A1I6GVG4      ----------AHLFGIGEAMRELRTNLQYMDV----------------------------
A0A1I6IST1      ----------AHLFGIGEAMRELRTNLQYMDV----------------------------
A0A412JBM5      ---------------IREAYVRLRTNLMFCVN----------------------------
A0A6J4SUA1      ---------------MVEAFRSIRLALRHTFA----------------------------
A0A1C2B334      ---------------IAESYRRIRTNLAFAAV----------------------------
R7Y679          ---------------TAEQFRKIRTNLTFANV----------------------------
A0A0F0KYJ9      -------------------MRELRTNLVYMDV----------------------------
A0A538BBM6      -----------------EAVRVLRSNLQVALA----------------------------
A0A510HHA8      -----------------EAYRTLRTGLLYAVV----------------------------
A0A6G8Q9J3      -----------------EAYRGLRTNLLYAQV----------------------------
A0A5Q2F9A3      -----------------EAFRRLRTNLQYLGR----------------------------
A0A4R1BMZ2      -----------------EAYRTLRTNLLYALV----------------------------
A0A023X491      -----------------EAYRTLRTSLLYSVV----------------------------
A0A6G8QDQ0      -----------------EDYRTLRTSLLYTVV----------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      -----------------------RTNLSFLDV----------------------------
A0A1Q7WJN6      -----------------EALRGVRLNVAYAH-----------------------------
A0A6D1QMN1      -----------------EQFKTLRTNIQFSSI----------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      -----------------EQYRVLRHLVETLRK----------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      -----------------EAFRLLRTNLQFLDL----------------------------
                                                                            

A0A519GXS6      ---------------------------------------------------------GEG
A0A6N6NKS9      -----------DEK----V-------------K---------------TIVVTSTGMDEG
A0A538BYZ4      -----------SAR----L-------------S---------------VLAVSSPASGDG
A0A348NU28      -----------AEK----V-------------Q---------------RLMVTSVSPGEG
A0A2N4T4Q5      -----------DAP----P-------------R---------------VVVVTSSMPGEG
A0A1M3LEY6      -----------EGG----P-------------R---------------SFVVTSSVPSEG
A0A538AJI7      -----------EGS----I-------------D---------------LIVVSSPAPADG
A0A538AM15      -----------ARD----L-------------R---------------IVAVSSPGVGDG
A0A022KX11      -----------TTG----R-------------H---------------SFVITSAVPGEG
A0A4Q5A868      -----------MED----T-------------NCR-------------LIVVTSTGASEG
A0A6N4VXX3      -----------DNP----P-------------R---------------VIVVTSSVPNEG
A0A1H4I042      -----------DNP----P-------------R---------------VIVVTSSIPNEG
A0A4R7A6D9      -----------DNP----P-------------R---------------VIVVTSSIPNEG
A0A345NSU7      -----------TTG----K-------------H---------------SFVISSTLPGEG
A0A0W8I9Y2      -----------DSP----P-------------K---------------MIVVTSALPGEG
A0A7C6LSF9      -----------LGF----G-------------RGGTEAHELARSTGARVVLVTSAQAGEG
A0A4Y5YMQ6      -----------VEH----Q-------------IG--------------VLAVTSSIAGEG
A0A255G8R8      -----------APQ----G-------------RT--------------ALVVTSSVPGEG
A0A6G7Y423      -----------GGE----R-------------RR--------------SMVITSSVQGEG
A0A4Q5APW3      ---------VEDTN----C-------------R---------------LIVVTSIGASEG
A0A4Q5B0V3      ---------VEDTN----C-------------R---------------LIVVTSIGASEG
A0A1Q2CRV2      -----------DKG----G-------------R---------------SIVVTSSVPGEG
A0A222TG79      -----------DSP----H-------------R---------------RFAVTSALEGEG
A0A6I3DFP2      -----------AGR----P-------------R---------------TVAVVSNTQDAG
A0A2S5WZJ5      -----------DEE----I-------------R---------------SMVITSSNAGEG
K6WHS4          -----------DSP----A-------------R---------------MIAVTSPSPGDG
A0A1L2ZMQ6      -----------DNP----P-------------R---------------VIVVTSSVPGEG
A0A3L8NYD3      -----------DKP----P-------------Q---------------SIVITSANAGEG
A0A1M6K628      -----------DTP----V-------------R---------------SIVVTSPSQGEG
A0A561E8R3      -----------DRH----P-------------R---------------SIVVTSPNPGEG
A0A3E2DN22      -----------DNP----P-------------R---------------AVVVTSANPGEG
A0A3Q9ULZ9      -----------DHP----P-------------K---------------AVVITSANPGEG
A0A3S9JFL2      -----------DHP----P-------------K---------------AVVVTSANPGEG
A0A3L7ADK2      -----------DNP----P-------------Q---------------VFVVTSPNPGEG
A0A1Q2CI19      ----------RGHQ----S-------------L---------------VVLVSSAHVAEG
A0A512T3M3      -----ERRGTRTNH----T-------------P---------------WVLVTSANPGDG
W6JTW4          -----E--NDPEPQ----A-------------V---------------AVLVTSAQPSEG
A0A0A0JTY0      AASEVPEKQ-AATG----A-------------R---------------LIVVTSAHAAEG
A0A0A0JXF2      --STVEPRR-SASS----A-------------R---------------LVLITSAHAAEG
E6S8H2          --PTSPPEPVSAAS----A-------------S---------------LILVTSAHPREG
A0A0A0JGH0      --AARPEPRPVVEG----A-------------R---------------LILVTSGNAAEG
N0E4U7          --AATAERGGTATG----A-------------R---------------LILVTSANAAEG
A0A0A0IYK2      --SAAGARP-AAKG----A-------------R---------------LILVTSAHAAEG
A0A0Q9L0H3      --PGGEESR-SRQG----G-------------R---------------LVLITSAHAAEG
A3TMK0          --SAIEPRR-PANT----A-------------R---------------LVLITSAHASEG
A0A543PXP1      --VPRGYAA---AQ----G-------------R---------------LILVTSAYPGEG
A3TMH6          --LLDGPAT-QLEG----A-------------R---------------VVLVTSAHPAEG
A0A1H6WL79      -----------DNP----P-------------R---------------ILLITSSLPSEG
A0A101LAM5      -----------DNP----P-------------R---------------ILLITSSLPSEG
A0A4Y3NEG0      -----------DNP----P-------------R---------------ILLITSSLPSEG
A0A6I2XCV4      LANSDSPDSPRNDR----T-------------P---------------VILVTSPSPGEG
A0A5R8VLL6      -----------DNP----P-------------R---------------IIVVTSSVSGEG
A0A538JQF8      VGEWRPVGDSNGAT----P-------------K---------------VVLVCSPRPREG
A0A1H6YPK1      -----------DHP----P-------------R---------------VLVVTSPVPGDG
A0A2R7MGI0      -----------DRP----P-------------R---------------VIVVTSPLPGDG
A0A2T7WQY4      -----------DHP----P-------------R---------------VIVVTSPLPGDG
A0A1G6GTN3      -----------DRP----A-------------R---------------IVVVTSPLSGDG
A0A1N7DLV3      -----------DRP----P-------------R---------------VMVVTSPLPGDG
A0A1V2NSB5      -----------DRP----P-------------R---------------VMVVTSPLPGDG
A0A0Q5Q5L3      -----------DRP----A-------------R---------------IMVVTSPLPGDG
A0A0Q6DVM4      -----------DRP----A-------------R---------------IMVVTSPLPGDG
A0A1R3WWR6      -----------DRP----A-------------R---------------VMVITSPLPGDG
A0A0Q5JKD6      -----------DRP----A-------------R---------------VLVVTSPLPGDG
A0A0Q9TBP0      -----------QES----A-------------P---------------IVLLTSGQESEG
A0A5Q2FA83      -----------TGG----K-------------H---------------SFVISSVMPGEG
A0A346XTB0      -----------DLD----G-------------K---------------SLLITSTLPGDG
A0A0G3V3M7      AGASEPE----ATP----L-------------R---------------VLLVTSPGPAEG
A0A6I3DD56      SGSSEPE----ATP----L-------------R---------------VLLVTSPGPAEG
A0A2W6DK08      VLDRSAVDT--TQP----P-------------Q---------------VILVASACAAEG
A0A2S0LQ32      -----------DNP----P-------------R---------------AIVMTSANPGEG
A0A2N6V1R5      -----------DNP----P-------------R---------------AIVMTSANPGEG
G9PHS6          -----------DNP----P-------------R---------------AIVMTSANPGEG
U1PLM7          -----------DNP----P-------------R---------------AIVMTSANPGEG
A0A6I1G2U1      AERRRAR----QGH----A-------------K---------------VVMVTSAQAGEG
A0A351ETF8      -----------GEP----V-------------S---------------SVLFTSAVPGDG
A0A542FTE6      -----------DDP----P-------------S---------------VVVVVSASPGEG
A0A349B7N2      DLRRQQTKRRDRSD----G-------------T---------------VVLVTSPGPAEG
A0A2S5UYV0      -----------DEE----I-------------R---------------SMVITSSNAGEG
A0A2S5X9U6      -----------DEE----I-------------R---------------SIVVTSANAGEG
A0A2S5ULV5      -----------DEE----I-------------R---------------SIVVTSANAGEG
A0A653YMF0      -----------DEE----I-------------R---------------SIVVTSANAGEG
A0A346Y185      -----------ETG----G-------------Q---------------SVVLTSASPVDG
A0A259S8H9      -----------DQE----V-------------R---------------VVMVTSANLGEG
A0A0Q5L115      -----------DAQ----P-------------R---------------VIVMTSPQPGDG
A0A2W1Z497      -----------DER----P-------------K---------------VLVVTSPLPGDG
A0A4V1VGV9      -----------ERP----P-------------R---------------SLVITSAMQSEG
A0A3Q9IY80      -----------DNP----P-------------R---------------IIVVTSPLPGDG
A0A0F0LP73      -----------DQE----V-------------R---------------VVMVTSANLGEG
A0A1F1X071      -----------DNP----P-------------R---------------SIVVTSSAPGEG
A0A3R8RWC7      -----------DNP----P-------------R---------------SIVVTSSAPGEG
A0A4U0RJZ4      -----------EQP----P-------------R---------------SLVITSAVQSEG
A0A4R1FGL9      -----------EQP----P-------------R---------------SLVITSAVQSEG
E3B8H1          -----------EQP----P-------------R---------------SLVITSAVQSEG
A0A7D7WDT9      -----------DSE----V-------------R---------------VVMVTSANQGEG
A0A0Q5AWK6      -----------DDE----T-------------R---------------SVVITSANQAEG
A0A6P1F176      -----------DDE----T-------------R---------------SVVITSANQAEG
A0A3N1NLD3      -----------DDE----T-------------R---------------SVVITSANQAEG
A0A3N2FVI8      -----------DDE----T-------------R---------------SVVITSANQAEG
A0A2S5XDQ6      -----------DEE----T-------------R---------------SVVITSANQAEG
A0A2S5XNN6      -----------DEE----T-------------R---------------SVVITSANQAEG
A0A4Q4D4T1      -----------DRV----S-------------N---------------VYVVTSSVAGEG
A0A261FE22      -----------DRGNRG---------------N---------------VLVVTSAMLGEG
A0A5C8C085      -----------DNP----P-------------R---------------IIVVTSSKPGDG
A0A1E4BP96      -----------DDP----P-------------R---------------SIVVTSPLPGDG
A0A439DNZ6      -----------DNP----P-------------R---------------VIVVTSSMPGEG
A0A0J6YE86      -----------DNP----P-------------R---------------VIVITSSMPHEG
A0A5Q5BFU2      -----------DNP----P-------------R---------------VIVLTSSVPHEG
A0A151BT98      -----------TND----V-------------P---------------AVVVTSARPGDG
A0A2Y8ZRF8      -----------TND----V-------------P---------------AVVVTSARPGDG
A0A2R9UAT1      -----------DHP----P-------------R---------------VVVVTSPLPGDG
A0A4Q5J5D7      -----------DNP----P-------------R---------------VIIITSPQQGDG
A0A1Y4CKD6      -----------DALSERGA-------------K---------------VVLVTSSIAGEG
A0A3S0V9U6      -----------DQP----P-------------R---------------SIIVTSPNPGEG
A0A1S2N0P2      -----------DAP----P-------------R---------------SIIVSSPNPGEG
A0A0Q3BEY5      -----------DAP----P-------------R---------------SIIVSSPNPGEG
A0A4R6Q3C6      -----------DAP----P-------------R---------------SIIVSSPNPGEG
A0A2X3GKL3      -----------DAP----P-------------R---------------SIIVSSPNPGEG
A0A0Q7KBQ4      -----------DAK----V-------------E---------------SILVSSAVPNEG
A0A1F1IHY9      -----------DEA----V-------------S---------------IVTVTSAHPGEG
A0A542HCT5      -----------DNP----P-------------R---------------IIVVTSPLPGDG
A0A2S8WHZ8      -----------DNP----P-------------R---------------IIVVSSSVPGEG
A0A537WNY9      -----------GKL------------------R---------------SVLITSPEGSHG
A0A5B8M469      -----------DGE----V-------------R---------------CVVVTSPNQSEG
A0A1Y4CTD2      -----------NRR----TATRLEAHLRSGGFK---------------TVLVASVEENEG
A0A0Q5M6Z7      -----------DQP----P-------------K---------------VIVVTSSIPGEG
A0A3N3ZPU0      -----------DDP----P-------------R---------------TVVVTSSVAGEG
A0A359IQX7      -----------DSP----P-------------K---------------CIVVTSANASEG
A0A433EDP2      -----------DEP----P-------------R---------------SFLVTSAVPSEG
A0A231VTW0      -----------DEP----P-------------R---------------SFLVTSAVPSEG
A0A433ECD0      -----------DEP----P-------------R---------------SFLVTSAVPSEG
U7V3Z1          -----------DEP----P-------------R---------------SFLVTSAVPSEG
A0A1F1J417      -----------DNP----P-------------S---------------SFIVTSAVPGEG
A0A2A8D6P2      -----------DNP----P-------------S---------------SFIVTSAVPGEG
A0A1F0THV9      -----------DNP----P-------------S---------------SFIVTSAVPGEG
A0A5F0M6Y0      -----------DNP----P-------------S---------------SFIVTSAVPGEG
D8USQ4          -----------DNP----P-------------S---------------SFIVTSAVPGEG
E3H5W1          -----------DNP----P-------------S---------------SFIVTSAVPGEG
A0A1F1QKB0      -----------DNP----P-------------S---------------SFIVTSAVPGEG
A0A509JY23      -----------DNP----P-------------S---------------SFIVTSAVPGEG
A0A448USF4      -----------DNP----P-------------S---------------SFIVTSAVPGEG
A0A0Q9LZR0      -----------DNP----P-------------R---------------IIVITSPLPGDG
A0A1N7E3F1      -----------DRQ----P-------------K---------------SLVVTSCLPGEG
A0A544ZKQ1      -----------DRQ----P-------------K---------------SLVVTSCLPGEG
A0A372P1T1      -----------DRQ----P-------------K---------------SLVVTSCLPGEG
A0A5D0Q2X0      -----------DRQ----P-------------K---------------SLVVTSCLPGEG
A0A5R8Z2E7      -----------DRQ----P-------------K---------------SLVVTSCLPGEG
A0A1L2ZMV4      -----------DNP----P-------------R---------------IIVVTSALAGEG
A0A6I3F378      -----------DRN----L-------------K---------------VLQVTSAMPGEG
A0A1E9T6I0      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1S1CQC5      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1S1CAD0      -----------DTP----P-------------R---------------SFIVTSAVPGEG
G5ET14          -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1E9DXX2      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1E8S156      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1E8S5S2      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1S1DFA8      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A2I1Z490      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1F0DAA9      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1F0PHK9      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1F0VZG6      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1E9G8X4      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1E9IAW2      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1E9ZBC9      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1E9ZDP4      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1F0R6B5      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1F0Z7N5      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1F1D897      -----------DTP----P-------------R---------------SFIVTSAVPGEG
D2NP38          -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1F1FV74      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1E9M791      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A291DEI8      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1S1D5T1      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1E8TRD6      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1F0XT88      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1F1EVP5      -----------DTP----P-------------R---------------SFIVTSAVPGEG
C6R548          -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A0K2RXS2      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A1F0KX60      -----------DTP----P-------------R---------------SFIVTSAVPGEG
A0A542I3V2      -----------DHR----P-------------R---------------IILVTSPMTSDG
A0A2T0UZ65      -----------DAP----P-------------Q---------------SIVVTSASPSEG
A0A1R4JTI6      -----------DNP----P-------------R---------------IIVVTSAAPAEG
A0A4R7TM52      -----------DRP----P-------------R---------------IIVVTSPLPGDG
A0A542XE74      -----------DAP----P-------------R---------------SVVVTSPAPGDG
A0A0G3V3F3      -----------AGR----P-------------R---------------TVAVVSNTQDAG
A0A0Q7QDF6      -----------DRV----S-------------N---------------VYVVTSSVAGEG
A0A5R8L819      -----------DHP----P-------------R---------------ILVVTSPLPGDG
A0A261FQA1      -----------DKTDM--S-------------N---------------VIVVASSDASEG
A0A1Q2CJ92      -----------DNP----A-------------K---------------SIVITSSNEGEG
A0A2T0S3C8      -----------DRP----V-------------K---------------TLVITSAMPGEG
A0A4Y8WZJ3      -----------DEA----V-------------S---------------IVTVTSAHPGEG
A0A285VUW0      -----------ASD---AG-------------H---------------SFVVTSSLSAEG
A0A2R7Z032      -----------DNP----P-------------R---------------RIVITSALASEG
A0A6J4MTQ2      -----------DRP----P-------------R---------------RIVITSALAGEG
A0A1I0W453      -----------DNE----P-------------R---------------KIVVTSALAGEG
A0A1H4LCS9      -----------DNE----P-------------R---------------RIVVTSALAGEG
A0A4Q2RZP8      -----------DNE----P-------------R---------------RIVVTSALAGEG
A0A0Q6VV12      -----------DNE----P-------------R---------------KIVVTSALAGEG
A0A495NTA9      -----------DNE----P-------------R---------------KIVVTSALAGEG
A0A0Q9QB08      -----------DNE----P-------------R---------------RIVVTSALAGEG
A0A4Q2SA86      -----------DNE----P-------------R---------------RIVVTSALAGEG
A0A4Z1C3Z0      -----------DNE----P-------------R---------------RIVVTSALAGEG
A0A542J310      -----------DHP----P-------------K---------------TIVVTSPLPGDG
A0A4Q2JUT1      -----------DHP----P-------------K---------------TIVVTSPLPGDG
A0A6L5R0V7      -----------DHP----P-------------K---------------TIVVTSPLPGDG
A0A444BL03      -----------DDP----P-------------R---------------SIVVTSANAHEG
A0A4Y8X357      -----------DDP----P-------------R---------------VVMVTSSNPGEG
R4LD52          -----------DRP----V-------------K---------------TLVVTSAVPGEG
A0A4T2CD79      -----------DSP----P-------------R---------------IIVISSPSPNDG
A0A6L6AM03      -----------DNE----P-------------R---------------RIVVTSALAGEG
A0A4Q2RU39      -----------DNE----P-------------R---------------KIVVTSALPGEG
A0A4Q2SK58      -----------DNE----P-------------R---------------KIVVTSALPGEG
A0A2N3YJR1      -----------DDP----P-------------R---------------SIVVTSANAGEG
A0A6G8FYB9      -----------DDP----A-------------R---------------SIVVTSANAGEG
A0A4Q4D742      -----------DAE----R-------------Q---------------AILVSSALPNEG
A0A1C6T1J1      -----------HEP----A-------------R---------------VIAVTSALQGEG
A0A2W2CFC8      -----------DEP----A-------------R---------------VIAITSALQGEG
A0A2W2A4B0      -----------RPE---GA-------------R---------------TLAITSSRPSEG
A0A4Y9MDA5      -----------GDGDREGG-------------R---------------VTAITSSRPGEG
A0A1H7N9P7      -----------QDEERAGA-------------R---------------IVAVTSSRSGEG
A0A1M7V0F8      -----------QDEDQGGA-------------R---------------VLAVTSSRPGEG
A0A520EHH5      -----------DNP----P-------------R---------------ILLVTSCIAGEG
A0A1V8PLV6      ------------------------------------------------MIVISSVEPSEG
A0A4R0U4F1      -----------DEP--L-S-------------N---------------VIVVTSAGPSEG
A0A357ZCV8      -----------DKP----I-------------K---------------SIAITSSVPNEG
A0A4R5Z7B0      -----------DKE----L-------------K---------------VLMVTSSGPGEG
A0A6M8GFV5      -----------DKK----V-------------K---------------SILVTSSEPSEG
A0A4R1CW45      -----------EEK----I-------------R---------------LVGVTSASPAAG
A0A419GS64      -----------DSE----I-------------G---------------SVVVTSPDRGEG
A0A2V2CXY5      -----------E------V-------------K---------------TIMVTSSLPNEG
A0A2S8MDM2      -----------DSP----P-------------R---------------VLVVTSSVPSEG
A0A357ZDL3      -----------DNP----V-------------K---------------TIAITSSVPNEG
A0A4Y8ZIU8      -----------DDP----P-------------R---------------TIAFTSANPGEG
A0A1I6GVG4      -----------DNP----P-------------R---------------IIVVTSPLPGDG
A0A1I6IST1      -----------DNP----P-------------R---------------IIVVTSPLPGDG
A0A412JBM5      -----------GDG--DPC-------------T---------------TFLVTSGSPSEG
A0A6J4SUA1      -----------SDG----P-------------V---------------VLAVTSPGMGDG
A0A1C2B334      -----------DPA----S-------------R---------------RILVTSASVAEG
R7Y679          -----------DNS----V-------------R---------------KILISSPSQSEG
A0A0F0KYJ9      -----------DNP----P-------------R---------------IIVVTSPLPGDG
A0A538BBM6      -----------GLE----N-------------P---------------IVIVTSPNAGEG
A0A510HHA8      -----------DAP----P-------------R---------------VISLTSPGPTEG
A0A6G8Q9J3      -----------DAP----P-------------K---------------VILLTSPGSREG
A0A5Q2F9A3      -----------GQG----G-------------N---------------SFVITSSVPDEG
A0A4R1BMZ2      -----------DDP----L-------------K---------------VVTFTSPGPGEG
A0A023X491      -----------DEP----P-------------H---------------VVAVTSPGQQEG
A0A6G8QDQ0      -----------DNP----P-------------K---------------VVVVTSPGPKEG
A0A0K8Q3D9      --------------------------------------------------MVTSSMQAEG
A0A2R7RCA1      -----------DQP----P-------------R---------------IIVVTSSVQAEG
A0A1Q7WJN6      -----------GTG----P-------------L---------------LVSITSPGRSDG
A0A6D1QMN1      -----------DRK----L-------------K---------------TIMVTSSNPGEG
A0A1E2SNF6      -------------------------------------------------------MPSEG
Q6ADE8          -------------------------------------------------------MPSEG
A0A1Q7CZ24      -----------GAN----L-------------Q---------------VVAVTSPGVGDG
A0A2W6VLC6      ------------------P-------------T---------------TFVITSSVPGEG
A0A519G798      -----------DSR----P-------------R---------------ALVITSAVPSEG
                                                                           *

A0A519GXS6      KTTTAVNLALAYV-ESG-QRVVLVDADLRRPAVANLL---G--------------LENAV
A0A6N6NKS9      KTQVSTNLACAIA-SSG-KKVLIVDTDMRRRCIAGLL---G--------------IHTEC
A0A538BYZ4      KTTTAINLAGALA-QAPEARVLLVDLDLRRGSVREHL---G--------------LGGRQ
A0A348NU28      KSMFASNLGLTLA-GLR-NNVLIIDADLRRPRVADYF---G--------------LEGSV
A0A2N4T4Q5      KSSITANLAVAIA-STG-RDVVVVDGDLRRPVMTELF---G--------------LVPGV
A0A1M3LEY6      KSTTSANLAIVMA-QSG-ARVLLIDGDLRSPSVADLF---G--------------IEGGV
A0A538AJI7      KTTVTTLLGEALS-RLG-MRVLLIDGDLRRPGFARIM---R--------------VNPHP
A0A538AM15      KTTTAINLAGALA-QASEARVLLVDADLRRPSVARLL---A--------------IGGSD
A0A022KX11      KTTTAVNLALAMA-DSG-RRTLLVDADLRNPSVAKTL---G--------------MEGSV
A0A4Q5A868      KTTTSVNIAAALA-ENG-AKVLLIDADLRHPSVANKL---D--------------IDGSA
A0A6N4VXX3      KSTTAINLALALA-ETE-NNVVVVDGDMRRSMIQDYL---K--------------LDGSV
A0A1H4I042      KSTTAVNIALALV-EVE-NNVLLVDGDMRRSIAHKHL---N--------------VDGAV
A0A4R7A6D9      KSTTAVNIALALV-EVD-NNVLLVDGDMRRSIAHKHL---N--------------VDGAV
A0A345NSU7      KTTTAVNLALAMS-DAG-TKVLLIDADLRHPSVGTTL---G--------------LEGGV
A0A0W8I9Y2      KSSITANLAVAIA-STG-RNVVVVDGDLRRPVITDLF---G--------------LVPGV
A0A7C6LSF9      KTTSIANLAASFA-ETG-QSILVLDADLRSPDLHLLF---D--------------VPQGA
A0A4Y5YMQ6      KTTMSVNTALAFA-EMG-NRVLLVDADLRRPNVANVL---G--------------LENAV
A0A255G8R8      KSVTVANLALAMA-DAG-NRTLLIDADMRRPTVADNF---G--------------LVGTA
A0A6G7Y423      KTQTAVNLARVLA-SAG-ESVLLVDADLRAPQVAQRM---G--------------LDGAL
A0A4Q5APW3      KTTTSVNIAAALA-ENG-AKVLLIDADLRHPSVANKL---D--------------IDGSA
A0A4Q5B0V3      KTTTSVNIAAALA-ENG-AKVLLIDADLRHPSVANKL---D--------------IDGSA
A0A1Q2CRV2      KTSTAINLAATLA-AAG-EKVLLIDADLRRPRVAAQL---Q--------------LEGAV
A0A222TG79      KTTTAVNLAVCLS-EVG-YKVVVVDADLRRPMVAVRL---G--------------VNPDI
A0A6I3DFP2      KSFVSINLAQSAS-ALD-DKVVLIDADLRRPTIHERL---S--------------VPRTP
A0A2S5WZJ5      KSTIATSLAQVLA-QSN-TPTILIDADLRRPTVATVL---G--------------IDGKI
K6WHS4          KTTVALNLAASLA-EAG-HSVLLVDADLRNPSVAGRV---N--------------LTGSV
A0A1L2ZMQ6      KSSLSANLAVTIA-HTG-QKVIVVDGDLRRPVVSEMF---S--------------LPGDA
A0A3L8NYD3      KSVVTANLARVLA-AAG-QKTILLDGDLRRPMVSTIF---E--------------LDPVV
A0A1M6K628      KSTIAMQLAALLA-ESG-EPTVLIDADLRRPRVAQLF---G--------------IDGAV
A0A561E8R3      KSTVAANLARVLA-AAG-QPVVLIDADLRKPMVATIF---N--------------LEGSI
A0A3E2DN22      KSTVSTHLAVVMA-QAG-EKVVLIDADMRRPVQHKAF---G--------------AEAGV
A0A3Q9ULZ9      KSTVGSYLARAVA-RSG-QATVLVDADMRRPMQHTAF---G--------------IDSRV
A0A3S9JFL2      KSTVCSYLARSVA-RSG-QATVLVDADMRRPMQHTAF---S--------------IDSHV
A0A3L7ADK2      KSTLSANLAETLAVNSG-KNVVVIDCDLRRPTLSKIF---N--------------AVEGA
A0A1Q2CI19      KSTSTANLAASFA-ETG-KQVLVIDADLRSPDVHEKL---D--------------VPQGA
A0A512T3M3      KTTSVGNLAASFA-ESG-KSVLVLDADLRSPDTHNVF---D--------------VPQGA
W6JTW4          KTTSVANLAASFA-ESG-RRVLVLDADLRSPDAHNLF---D--------------VPQGA
A0A0A0JTY0      KTTSVANLAASFA-ETG-QRVLVLDADLRSPDVHNVF---D--------------VPQGA
A0A0A0JXF2      KTTSVANLAASFA-ETG-QKVLVVDADLRSPDVHNVF---D--------------VPQGA
E6S8H2          KTTSVANLAASFA-ETG-QRILVLDGDLRSPDTHNIF---D--------------VPQGA
A0A0A0JGH0      KTTTVANLAASFA-ETG-QRVLVLDADLRSPNTHTLF---D--------------VPQGA
N0E4U7          KTTTVANLAASFA-ETG-QRVLVLDADLRSPDTHSLF---D--------------VPQGA
A0A0A0IYK2      KTTSVANLAASFA-ETG-QRVLVLDADLRSPDAHNVF---D--------------VPQGA
A0A0Q9L0H3      KTTSVANLAASFA-ETG-QTVLVLDADLRSPDIHTAF---D--------------VPQGA
A3TMK0          KTTSVANLAASFA-ETG-QQVLVLDADLRSPDAHNAF---D--------------VPQGA
A0A543PXP1      KTTSVANLAASFA-ETG-LRVLVLDADLRSPDTHDLF---D--------------VPQGA
A3TMH6          KTTTVANLAVSFA-ESG-QRVLVLDADLRSPDTHTLF---D--------------VPQGA
A0A1H6WL79      KSTVTSNLAATIA-AAG-RDVIVVDADLRRPTVHQVF---D--------------VLPDV
A0A101LAM5      KSTVTSNLAATIA-AAG-RDVIVVDADLRRPTVHQVF---G--------------VLPDV
A0A4Y3NEG0      KSTVTSNLAATIA-AAG-RDVIVVDADLRRPTVHQVF---G--------------VLPDV
A0A6I2XCV4      KTTTTANVASVFA-AAG-TRTLIVDCDYRKPSIGKYL----------------------A
A0A5R8VLL6      KSTIAANLASAMA-AAG-DPVIVVDGDLRHPSVAKIF---D--------------VVPGI
A0A538JQF8      KTMTVANLAVCLA-ESG-HTVLVLDSDLRAPQAHRLF---G--------------VQVEP
A0A1H6YPK1      KSTMAVMLAAAIA-ESG-RDVVLVDADLRRPTLAKAL---G--------------VSPEA
A0A2R7MGI0      KSTTAANLAVSIA-ATG-QSVILIDADLRRPVMGGVF---G--------------FSDDV
A0A2T7WQY4      KSTTAANLAVSIA-ATG-QSVILIDADLRRPVMGGVF---G--------------FSDDV
A0A1G6GTN3      KSTTAANLAVSIA-ATG-QSVVLIDADLRRPVLGGMF---G--------------FSDDV
A0A1N7DLV3      KSTTAANLAVSIA-ATG-QSVILIDADLRRPVLGATF---G--------------FSDDV
A0A1V2NSB5      KSTTAANLAVSIA-ATG-QSVILIDADLRRPVLGATF---G--------------FSDDV
A0A0Q5Q5L3      KSTTAANLAVSIA-ATG-QSVILVDADLRRPVLGGMF---G--------------FSDDV
A0A0Q6DVM4      KSTTAANLAVSIA-ATG-QSVILVDADLRRPVLGGMF---G--------------FSDDV
A0A1R3WWR6      KSTTAANLAVSIA-ATG-QAVVLIDADLRRPVLGGVF---G--------------FSDDV
A0A0Q5JKD6      KSTIAANLAVSIA-ATG-QSVVLIDADMRRPVVGGMF---G--------------FSDDV
A0A0Q9TBP0      KTVTSCNLAVSAA-RLG-LNVVLIDADFRRASVAPRF---G--------------LGDPP
A0A5Q2FA83      KTTTAVNLAIALA-DSG-ANVVLVDGDLRNPSVAKAM---G--------------LEGNV
A0A346XTB0      KTTTTLQLAIAAS-RDR-RRVVLVDADIRARGLTRVL---G--------------ADDRV
A0A0G3V3M7      KSISVVNIAAAFA-ETG-ISVLLIDGDFRRPQMYKYF---S--------------GATTP
A0A6I3DD56      KSISVVNIAAAFA-ETG-MSVLLIDGDFRRPQMHKYF---S--------------GATSP
A0A2W6DK08      KTATVVNLAACFA-EVG-KRVLVLDCDFRGPDAHQYL---G--------------VSPGT
A0A2S0LQ32      KSTISAVLAQMLA-ASG-QRTILVDTDLRKPVVHRIF---D--------------IDGSV
A0A2N6V1R5      KSTMSAVLAQMLA-SSG-QRTVLIDTDLRKPVVHKIF---G--------------LDGSV
G9PHS6          KSTMSAVLAQMLA-SSG-QRTVLIDTDLRKPVVHKIF---G--------------LDGSV
U1PLM7          KSTMSAVLAQMLA-SSG-QRTVLIDTDLRKPVVHKIF---G--------------LDGSV
A0A6I1G2U1      KSTSVANLAASFA-ETG-KSVLVLDADLRSPNLHPMF---D--------------VPQGA
A0A351ETF8      KTTTAVNVAALAS--KY-MNVLLVDGDMRRPRVHRML---G--------------VSNSV
A0A542FTE6      KSTVAANLADAVA-ASG-RPVIVVDCDLRKPMIATIY---E--------------KEGAV
A0A349B7N2      KSTTVVNLAAAYA-ESG-SRVLIVDGDFRRPAVHEFLPEAD--------------VGRGN
A0A2S5UYV0      KSTIATSLAQVLA-QSN-TPTILIDADLRRPTVASVL---G--------------IDGSV
A0A2S5X9U6      KSTVSTSLAQVLA-QSN-TPTILIDADLRRPTVATVL---G--------------IDGKI
A0A2S5ULV5      KSTVATSLAQVLA-QSN-TPTILIDADLRRPTVATVL---G--------------IDGKI
A0A653YMF0      KSTVATSLAQVLA-QSN-TPTILIDADLRRPTVATVL---G--------------IDGKI
A0A346Y185      KTVTCLNLAVASA-QDG-RDVVLVDADTRVRGLTRRL---G--------------AKDTG
A0A259S8H9      KSETTRALARVLA-ESG-QRTLVIDGDLRRPTIAKGF---E--------------IDEAI
A0A0Q5L115      KSTLAANLAESLAVSSD-QRVVVIDCDLRRPTLSKVL---G--------------VSEGA
A0A2W1Z497      KSTIAANLARSLAVTST-GRVVLIDCDLRRPVLSAVF---G--------------VARGA
A0A4V1VGV9      KSTVAANLARVLS-AAG-QSVVLVDTDLRRPTVHETF---D--------------LENLV
A0A3Q9IY80      KSTTSANLAITLA-ANG-SKVVLIDGDLRRPMVATIF---R--------------LVDGV
A0A0F0LP73      KSSTTRTLARVLA-ESG-QRTLVIDGDLRRPTVAEGF---D--------------LDGTV
A0A1F1X071      KSTVAANLARVMA-RAG-QPTLLVDADLRRPMIAQQF---S--------------VDGEV
A0A3R8RWC7      KSTVAANLARVMA-RAG-QPTLLVDADLRRPMIAQQF---S--------------VDGEV
A0A4U0RJZ4      KSTVASNLARVLA-AAG-QHVVLVDTDLRRPVIHETF---D--------------VDNAV
A0A4R1FGL9      KSTVASNLARVLA-AAG-QHVVLVDTDLRRPVIHETF---D--------------VDNAV
E3B8H1          KSTVASNLARVLA-AAG-QHVVLVDTDLRRPVIHETF---D--------------VDNAV
A0A7D7WDT9      KSMTASSLARVIA-ESG-ERTLIIDGDLRRPKVARNF---G--------------LEGTV
A0A0Q5AWK6      KSTIASGLARVTA-DSG-QRTLLIDADLRRPTVAKML---G--------------IDGAV
A0A6P1F176      KSTIASGLARVMA-DSG-QRTLLIDADLRRPTVAKLL---G--------------IDGAV
A0A3N1NLD3      KSTIASGLARVTA-DSG-QRTLLIDADLRRPTVAKLL---G--------------IDGAV
A0A3N2FVI8      KSTIASGLARVMA-DSG-QRTLLIDADLRRPTVAKLL---G--------------IDGAV
A0A2S5XDQ6      KSTIAAGLARVTA-ESG-QRTLLVDADLRRPSVARML---D--------------IDGAI
A0A2S5XNN6      KSTIAAGLARVTA-ESG-QRTLLVDADLRRPSVARML---D--------------IDGAI
A0A4Q4D4T1      KTTTASNLAISLA-QSG-QNVVLVDGDLRRPRLHEVF---G--------------AEQNV
A0A261FE22      KTTVSVNIAATFV-EKG-ESVLLIDADVRHPSVAKAL---G--------------ISNGV
A0A5C8C085      KSTVTANLAAAIA-ASG-APVILVDGDLRRPTVASSF---G--------------LVEGV
A0A1E4BP96      KSTTAANLAMSLA-AAG-QRVVLIDGDLRQPVVASLF---D--------------LPEGA
A0A439DNZ6      KSTTAINLALVLA-EAE-HNVVLVDGDLRRPRLDKYL---G--------------LVGSV
A0A0J6YE86      KSTTAINIALALA-EAE-HNVVLVDGDMRRPTLSKYL---D--------------LMSKV
A0A5Q5BFU2      KSTTAINIALALA-EAE-HNVVLVDGDMRRPMLHKYL---G--------------LVGPV
A0A151BT98      KTTVAANLALAMA-RDG-YRTVLVDGDLRKPGVGSAI---G--------------IDGSV
A0A2Y8ZRF8      KTTVAANLALAMS-RDG-HRTLLVDGDLRKPGVASAV---G--------------IDGSV
A0A2R9UAT1      KSTMSANLALAMA-ASG-QQVVLIDGDLRRPMIAAIF---G--------------LVEGA
A0A4Q5J5D7      KSTVAANLAGALA-VSG-EPVILIDGDLRRPTVAEKF---G--------------LVEGA
A0A1Y4CKD6      KSTVAINLAEQLA-QDG-SRVLLVDMDLRSQGDGALL---G--------------CGASH
A0A3S0V9U6      KSTVTSSLAHAFA-KAG-QPTVLIDADLRRPTIAKIF---G--------------IDSGV
A0A1S2N0P2      KSTVSASLAHAFA-KAG-QPTILIDADLRRPTQAKIF---S--------------LDDAV
A0A0Q3BEY5      KSTVSASLAHAFA-KAG-QPTILIDADLRRPTQAKIF---G--------------LDDAV
A0A4R6Q3C6      KSTVSASLAHAFA-KAG-QPTILIDADLRRPTQAKIF---G--------------LDDAV
A0A2X3GKL3      KSTVSASLAHAFA-KAG-QPTILIDADLRRPTQAKIF---G--------------LDDAV
A0A0Q7KBQ4      KTLVATNLAMSMA-QSG-RSVLLIDADMRNPNVADLL---G--------------LENSV
A0A1F1IHY9      KSTVAANLAVPVA-ESG-QRVVLVDGDLRRPVVAENF---G--------------LISTV
A0A542HCT5      KSTVAMNLAAALS-MSD-RRVILIDGDLRRPVIADSF---G--------------LIEGL
A0A2S8WHZ8      KSSVTANLAVAIA-STG-RNVVLIDADLRRPVQTELF---D--------------MMDGA
A0A537WNY9      KTTISYGLAVTLA-RAG-TSTLLVDGDLRRGRISEMM---N--------------ITRSP
A0A5B8M469      KSTVAARLAAVIA-ESG-QPTLIIDADLRRPSVARQF---D--------------MDGTI
A0A1Y4CTD2      KSTVAANLAAALA-ERG-RRVLLIDGDFRKPAQRRIF---DEQNLERPSFSDYVLEDGVA
A0A0Q5M6Z7      KSTLTANLADAIA-SAN-SNVVVIDCDLRRPMQSTLF---S--------------LRSGV
A0A3N3ZPU0      KSSVAANLAVTLG-ALG-QPTVLVDADLRRPVQTELF---G--------------LTEGA
A0A359IQX7      KSTVAANLARVLA-ESG-QITLLVDADLRRPSQHRTF---D--------------LDGSV
A0A433EDP2      KSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N--------------VDAKV
A0A231VTW0      KSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N--------------VDAKV
A0A433ECD0      KSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N--------------VDAKV
U7V3Z1          KSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N--------------VDAKV
A0A1F1J417      KSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------INAKI
A0A2A8D6P2      KSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------INAKI
A0A1F0THV9      KSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------INAKI
A0A5F0M6Y0      KSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------INAKI
D8USQ4          KSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------INAKI
E3H5W1          KSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------INAKI
A0A1F1QKB0      KSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------INAKI
A0A509JY23      KSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------INAKI
A0A448USF4      KSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------INAKI
A0A0Q9LZR0      KSTVAMNLAAALS-MSD-RRVVLIDGDLRRPVVAESF---G--------------LIEGL
A0A1N7E3F1      KSSTSVNLAITMA-QAG-WRVVLVDADLRRPSVPRYL---G--------------IEGGT
A0A544ZKQ1      KSSTSANLAITMA-QAG-WRVVLVDADLRRPSVPRYL---G--------------IEGGT
A0A372P1T1      KSSTSANLAITMA-QAG-WRVVLVDADLRRPSVPRYL---G--------------IEGGT
A0A5D0Q2X0      KSSTSANLAITMA-QAG-WRVVLVDADLRRPSVPRYL---G--------------IEGGT
A0A5R8Z2E7      KSSTSANLAITMA-QAG-WRVVLVDADLRRPSVPRYL---G--------------IEGGT
A0A1L2ZMV4      KSSIAANLAVTIA-QSG-SKVILIDADLRRSVQTDIF---Q--------------LQSGA
A0A6I3F378      KTTTTANLAIVLA-NAG-ALVLIVDGDLRRPRIHTMF---G--------------LSGEA
A0A1E9T6I0      KSTVSLSLARSLA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1S1CQC5      KSTVSLSLARSLA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1S1CAD0      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
G5ET14          KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1E9DXX2      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1E8S156      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1E8S5S2      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1S1DFA8      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A2I1Z490      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1F0DAA9      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1F0PHK9      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1F0VZG6      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1E9G8X4      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1E9IAW2      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1E9ZBC9      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1E9ZDP4      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1F0R6B5      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1F0Z7N5      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1F1D897      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
D2NP38          KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1F1FV74      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1E9M791      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A291DEI8      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1S1D5T1      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1E8TRD6      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1F0XT88      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1F1EVP5      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
C6R548          KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A0K2RXS2      KSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A1F0KX60      KSTVSLALARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------LDAKV
A0A542I3V2      KSTVTGNLAVTMA-ATG-EPVVVVDGDLRRPRIAGAF---N--------------LVPGV
A0A2T0UZ65      KSTVSSTLASIIA-EDG-RPVVIIDADLRRPNIANIL---E--------------VSSTV
A0A1R4JTI6      KSTVAANAAITLA-QSD-VPTVLVDADLRRPTVAGSF---H--------------VEGSV
A0A4R7TM52      KSTTSANLAIILA-ASG-QRVVLVDGDLRRPMVASVF---G--------------LVEGV
A0A542XE74      KSTIAAQLARLMA-VAG-QPVVLIDCDLRRPTQGDQF---N--------------VDSGV
A0A0G3V3F3      KSFISINLAQSAS-ALD-DKVVLIDADLRRPTIHEQL---S--------------VPRTP
A0A0Q7QDF6      KTTTASNLAISLA-QSG-QNVVLVDGDLRRPRLHEVF---G--------------AEQNV
A0A5R8L819      KSTTSANLAVTLA-ASG-QPVVLVDADLRRPMLANIF---G--------------IVADV
A0A261FQA1      KTTIAVNLAAAIA-ERG-RTVLLIDTDLRKPSMAGVL---G--------------INGKV
A0A1Q2CJ92      KSTLAANIAAMFA-DAG-EPTVLIDADLRRPVQAERL---G--------------LDGAV
A0A2T0S3C8      KSSTACTLAGLFA-EAG-QRVLLIDADLRRPRIADYL---G--------------LEGAV
A0A4Y8WZJ3      KSTVAANLAVTVA-ESG-QRVVLVDGDLRRPVVAENF---G--------------LISTV
A0A285VUW0      KTTTVVNLGMAMA-ESG-RRVLVLDADLRHPSVASEL---G--------------LEGAV
A0A2R7Z032      KSTVSSNLARLVA-QAG-EKVVLIDADLRRPMLATTF---D--------------IDGEV
A0A6J4MTQ2      KSTVSANLARLVA-HAG-ESVVLVDADLRRPMLATTF---D--------------IDGEI
A0A1I0W453      KSTVSSNIARLVA-QAG-TPVLLIDADLRRPMIATTF---E--------------VDGAV
A0A1H4LCS9      KSTVSSNIGRLVA-QAG-TPVLLIDADLRRPQIASTF---E--------------IDGAV
A0A4Q2RZP8      KSTVSSNIARLVA-QAG-TPVLLIDADLRRPMIASTF---E--------------IDGAV
A0A0Q6VV12      KSTVSANIARLVA-QAG-TPVLLIDADLRRPQIATTF---E--------------IDGTV
A0A495NTA9      KSTVSSNIARLVA-QAG-TPVLLIDADLRRPMIASTF---E--------------IDGAV
A0A0Q9QB08      KSTVSSNVARLVA-QAG-TPVLLIDADLRRPMIATTF---E--------------IDGAV
A0A4Q2SA86      KSTVSANIARLVA-HAG-TPVLLIDADLRRPMLATTF---D--------------IDGAV
A0A4Z1C3Z0      KSTVSANIARLVA-QAG-TPVLLIDADLRRPMLATTF---E--------------VDGAV
A0A542J310      KSTVACNLALTLA-AAG-TTVVLVDGDLRRSMVAKTM---G--------------LPGGA
A0A4Q2JUT1      KSTIACNLALTLA-AAG-STVVLVDGDLRRSMVAKTM---G--------------LPSGA
A0A6L5R0V7      KSTIACNLALTLA-AAG-TTVVLVDGDLRRSMVAKTM---G--------------LPSGA
A0A444BL03      KSTVSSTLARVLG-EAG-QRVVIVDADLRRPTLAKVF---E--------------APGSI
A0A4Y8X357      KSTVIGSLAQAVA-ASG-QPVILIDADLRRPRQAGQF---G--------------VDGRV
R4LD52          KSSTACGIAMLFA-QAG-QRVLIVDADLRRPRIAEYL---G--------------LEGAA
A0A4T2CD79      KSTVTANLAVALS-AAG-QKVVVVDGDLRKPMVASTF---N--------------VVGGV
A0A6L6AM03      KSTVSSNIARLVA-QAG-TPVLLIDADLRRPMIATTF---E--------------VDGAV
A0A4Q2RU39      KSTVSANIARLVA-QAG-TKVLLIDADLRRPMIATTF---E--------------IDGAV
A0A4Q2SK58      KSTVSANIARLVA-QAG-TPVLLIDADLRRPMIATTF---E--------------IDGAV
A0A2N3YJR1      KSTVSATLARVLG-QSG-QSVVIVDADLRRPTLAKVF---D--------------RENTI
A0A6G8FYB9      KSTVAATLARVLG-ASG-QSVVIIDADLRRPTLAKVF---D--------------VVGTV
A0A4Q4D742      KTLTATNLAISMA-QSG-RSVLLIDADMRNPNVAELL---G--------------LENSV
A0A1C6T1J1      KTTMSCNLAIALA-EAG-WRVLLVDADLRRPKVADYL---G--------------LDGGV
A0A2W2CFC8      KTTLSCNLAITLA-EAG-WRVLLVDADLRRSKVGDYL---G--------------IDSAV
A0A2W2A4B0      KTTTAANLAVALA-ESG-LRTVVIDADLRRPNLANVF---G--------------IEGSA
A0A4Y9MDA5      KSTVAVDLAAALA-ETG-ARVLLVDADLRRPAIAERL---G--------------LEGAA
A0A1H7N9P7      KSTVAVELAAALA-ETG-TRVLLVDADLRRPTIADRL---G--------------LEAAA
A0A1M7V0F8      KSTVAVNLAAALA-ETG-ARVLLVDADLRRPAIADRL---G--------------LEAAA
A0A520EHH5      KSTTAVNLALSLA-ESG-NRVVLVDADLRRPHIADYL-GI----------------VGSV
A0A1V8PLV6      KTTVSVNVAAALA-ENG-AKVLLIDADLRHPSVADHI-GL----------------EGGA
A0A4R0U4F1      KTTLSVNLATAFA-ENG-SKVLLIDADVRNPSVSKAL-GI----------------EGAV
A0A357ZCV8      KSTIALSLAQAIA-TSG-QTVLVVDTDMRRRSLAHYM-RL----------------KPSV
A0A4R5Z7B0      KSTTAANLAVVFA-QLG-KKVLLVDADLRKPTVHRSF-GV----------------NNLF
A0A6M8GFV5      KTTTIANLAVTYA-QQG-KKVLLVDADLRKPQLHTDF-RL----------------ENFK
A0A4R1CW45      KSFLAVNLAASLS-RVLKVPTFLVDLDLRRGCVAEEL-GI----------------EFEA
A0A419GS64      KSTICANLAIVMA-QAE-KRVLLIDCDLRLPTQHELF-QI----------------TLDH
A0A2V2CXY5      KSFLVMQLWRMMA-EVG-TPTLLIDCDYRNSEMRTKY-GIG--------------STEKI
A0A2S8MDM2      KSTTAINLALALA-EAD-HKVLLVDGDMRRPSLHQYL-DL----------------LQPV
A0A357ZDL3      KSTIALNLAQAIA-GSG-KTVLLVDTDLRRRSLAMYL-NL----------------RAPS
A0A4Y8ZIU8      KSTVIGSLAVAVA-ASG-QPVILIDADLRRPRQALQF-GV----------------DGRV
A0A1I6GVG4      KSTISSNLAVTLA-SSG-QPVVLIDGDLRRPMVDTVF-GL----------------PKGA
A0A1I6IST1      KSTISSNLAVTLA-SSG-QPVVLIDGDLRRPMVDTVF-GL----------------PKGA
A0A412JBM5      KSLTAANTAISFA-MLG-KKTLLVDADVRKPSQQRLWAGR----------------NTST
A0A6J4SUA1      KSFVSSNLAMSFA-EAG-HRTLLIDGDIRRGEQHATF-NV----------------DQQP
A0A1C2B334      KTTTAINVAASLA-EYG-HRVVLVDADLRRPTVAKRL-SL----------------NNSI
R7Y679          KTTTSLNLAASLA-ELG-KSVVLVDADLRRPAVASRLQAV----------------SPDI
A0A0F0KYJ9      KSTISSNLAVTLA-SSG-QPVVLIDGDLRRPMIGTVF-GL----------------PKGA
A0A538BBM6      KTSTCVPLAQSLA-QAG-SRVVLVDLDLRHPDAHRLL-DR----------------PNSV
A0A510HHA8      KSTVCANLGVVLA-QAN-KSTLLIDGDLRRPSLHAIF-SL----------------RNIN
A0A6G8Q9J3      KSTICANLGVALA-QAD-RATLVIDCDLRGPTLHGIF-GL----------------RDSP
A0A5Q2F9A3      KTSTAINTALVLA-DAG-LRVLLIDADMRRPRVGQSL-RL----------------EDAA
A0A4R1BMZ2      KSTTCANLGVVLA-QAN-KNTLILDCDFRRPVMHRFF-GL----------------RNVW
A0A023X491      KSTTCANLAVTLA-QAE-KSVLLLDCDLRKPVVHSIF-EL----------------RNTR
A0A6G8QDQ0      KSTTCANLGVVLA-QAD-KSTLIIDCDFRRPAMHQVF-GL----------------RNFK
A0A0K8Q3D9      KSTVTANLAVTMA-AAG-ENVVVVDGDLRRPTLTDVF-NL----------------VPGA
A0A2R7RCA1      KSTVTANLAVTLA-AAG-ENVVVVDGDLRRPTLVDVF-NL----------------VPGV
A0A1Q7WJN6      KSFVASNLALAFA-SVG-YRTLLIDGDVRRGGLHRIL-TV----------------SRKP
A0A6D1QMN1      KSTTVANLAVVMA-QQH-NRVLLVDTDLRKPTVHFTF-QV----------------PNHV
A0A1E2SNF6      KSTLSANLAVTIA-RGG-QPVVVVDADMRHPTQGKTF-GI----------------PNGA
Q6ADE8          KSTLSANLAVTIA-RGG-QPVVVVDADMRHPTQGKTF-GI----------------PNGA
A0A1Q7CZ24      KTTTAINLAGSLA-QAADARVLLVDMDLRRPAVAGQL-GL----------------SGGK
A0A2W6VLC6      KTSSGINIARALA-DVG-THTLLVDADLRRPKTDVYL-GI----------------EGGL
A0A519G798      KTSTATNLAIALA-QTG-LRVLLVDGDLRRPKVASVL-GL----------------ERSV
                *:                   .::* * *                               

A0A519GXS6      -G---LTSVLVES-I--A---VEDAIIA-----TATGLDV--LTAGEEAPNPAELLASQR
A0A6N6NKS9      -G---LYSVLVGQ-A--P---LKSAIYPTD---RPN-LYF--MDSEPNIPSPPDVLSTKR
A0A538BYZ4      -SPGLVDAILKPA-L--A---LEDVTQLCP---SFN-LSV--VLAGRSPATHYELLKSPR
A0A348NU28      -G---LTTVLLGD-V--S---IEDARMTRP---GST-LDV--LPSGSIPPNPAEMLTSDA
A0A2N4T4Q5      -G---ITDVLVGE-A--E---VDDVLQVYD---KFPNLQV--LGAGRTPPNPTELLASQA
A0A1M3LEY6      -G---LTDVLIGR-A--R---LSDVTQAWG---LRN-LSL--LPAGAMPPNPSELLGSQA
A0A538AJI7      -G---LAEVLRGE-T--P---IMEAAQKGW---AEN-VWI--LPTAHDPEA--GDLLARR
A0A538AM15      -GPGLVNAILDPR-L--P---LERVARPLP---PFN-LSV--IPAGQAPPSPYEVLKSPR
A0A022KX11      -G---LTTLLLGD-A--D---LDDVIQT-W---GSAGMDV--LPAGPIPPNPSELLGSAP
A0A4Q5A868      -G---LTHVLSGQ-A--S---VKDVVQR-Y---WKPNLHV--MPAGPKPPNASALLNSPI
A0A6N4VXX3      -G---LSTVLSGA-V--P---LSEALQQ-T---RFSGLTV--LAAGTTPPNPSELLASQA
A0A1H4I042      -G---LSTVLSGA-V--S---LSDALQE-T---QFSGLTV--LAAGATPPNPSELLASHA
A0A4R7A6D9      -G---LSTVLSGA-V--S---LSDALQE-T---QFSGLTV--LAAGATPPNPSELLASHA
A0A345NSU7      -G---LTTVLLGD-A--D---VHDVVQP-W---GGNNLHV--LTAGEVPPNPSELLGSSK
A0A0W8I9Y2      -G---VTDVLTGQ-V--Q---VDEVLQTYD---KFPNLQV--LGAGRTAPNPTELLSSKA
A0A7C6LSF9      -G---ISDFLYDP-S--S-TQLAALARP-T---SVPGVKI--ITAGTQLAHPASL--ATR
A0A4Y5YMQ6      -G---LASVLVDA-V--T---FDDAVIS------TAGVDV--LTAGEHVPNPAQLLASQK
A0A255G8R8      -G---LSTILAGQ-A--T---LSDLVQPFS---GHPDLYV--LTSGVVPPNPTELLDSAQ
A0A6G7Y423      -G---LSHILTGR-G--T---LDGLAIR-T---EPAGLAV--LPAGAVPPNPSELLGSDA
A0A4Q5APW3      -G---LTHVLSGQ-A--S---VKDVVQRYW---KPN-LHV--MPAGPKPPNASALLNSPI
A0A4Q5B0V3      -G---LTHVLSGQ-A--S---VKDVVQRYW---KPN-LHV--MPAGPKPPNASALLNSPI
A0A1Q2CRV2      -G---LTTVLIGD-A--R---LGDVVQPYG---RTP-LDV--LTAGRVPPNPAELLGHTR
A0A222TG79      -G---FTDFLSGR-A--A---LEDVLQSTS---FSG-VDA--LAGGQIPPNPAELLTSQK
A0A6I3DFP2      -G---LTSVLLGS----D---LSEALRKVA---ESPFLRV--LSSGPPVEDPSAILGARA
A0A2S5WZJ5      -G---LSEVLSGQ-V--S---LEDALVASK---IPG-LYV--LPSGRIPPNPSEMLGSAA
K6WHS4          -G---LTTILSTG-A--T---LTDCIQHSS---VAG-LDV--LPSGPIAPNPAELLGSRK
A0A1L2ZMQ6      -G---LTDVLAGQ-A--E---LDDVLQDFE---PVPNLQV--LAAGRIPPNPSELLASKT
A0A3L8NYD3      -G---LTQVLAGD-I--D---LRATIQDPG---LPN-LDV--IAAGRIPPNPSELLGSQR
A0A1M6K628      -G---LTQVVAGS-L--T---VADALVSTS---QPN-LSV--LPAGRIPPNPSEIVGSKR
A0A561E8R3      -G---LTQALAGD-I--T---LHDVMQPTT---TPD-LVV--IPAGRIPPNPSELVGSRR
A0A3E2DN22      -G---LSQVLAGD-V--T---LDDALMRTE---TKR-LQM--LAAGRIPPNPSELLGSQR
A0A3Q9ULZ9      -G---LSQVLAGD-V--S---LSDALTPTD---VPG-LRV--LVAGRIPPNPSELLGSVR
A0A3S9JFL2      -G---LSQVLAGD-V--S---LEDALNPTD---VPG-MRV--LVAGRIPPNPSELLGSVR
A0A3L7ADK2      -G---LTDVLSGR-A--E---LQQVIQPCG---DSEKLWI--LGAGRIPPNPSELLGSRA
A0A1Q2CI19      -G---VSDLLVDG-Q--G--SLNSVIRPTN---IPG-VRV--VTAGTRLAHPTAL--ASR
A0A512T3M3      -G---ISDYLTDP-D--FG-PLSNLVRPTN---LPG-VKI--ITAGTQLEHPTSL--ASR
W6JTW4          -G---ISDYLVDS-A--LE-HLQQLVRPTN---MPG-VSI--IVAGTQLDHPTSL--ASR
A0A0A0JTY0      -G---ISDYLSDV-S--GDASLASLMRPTS---VPG-VRI--MSAGSSLAHPAAL--ASR
A0A0A0JXF2      -G---ISDYLSD--P--GGTSLETVVRPTS---VPG-VRI--ITAGTVLTHPASL--ASR
E6S8H2          -G---ISDYLTGP-D--DT-PLGSLIRPTN---VPG-VRI--ITAGTRLEHPASL--ASR
A0A0A0JGH0      -G---ISDYISDN-E--DT-PLEALIRPTN---VPA-VRI--ITAGTRLTHPASL--ASR
N0E4U7          -G---ISDFITDP-G--DV-PLEALVRPTS---VPG-VRI--ITAGTRLTHPASL--ASR
A0A0A0IYK2      -G---ISDFLSDP-S--DDASLGSVVRPTS---VPG-VRI--ITAGTSLAHPASL--ASR
A0A0Q9L0H3      -G---ISDYLSDP-S--DGAALDAVVRPTS---VPN-VRI--ITAGTSLAHPAAL--ASR
A3TMK0          -G---ISDYLTDP-G--EG-SLSAVVRPTS---VPG-VRI--ITAGTSLAHPASL--ASR
A0A543PXP1      -G---LSDYLSRP-E--DA-SLEALIRPTS---IPD-VRI--ITAGTRLSHPASL--ASR
A3TMH6          -G---ISDYLSRH-N--ES-SLEALIRPTS---IDG-VRI--MTAGTRLSHPASL--ASL
A0A1H6WL79      -G---VTDILSGR-A--S---IDDVLQEWG---PNPRLRI--LTAGRIPPNPSELLGSRA
A0A101LAM5      -G---VTDVLSGR-A--S---IDDVLQEWG---PNPHLRI--LTAGRIPPNPSELLGSRA
A0A4Y3NEG0      -G---VTDILSAR-A--S---IDEVLQEWG---PNPHLRI--LTAGRIPPNPSELLGSRA
A0A6I2XCV4      -P---IPDLEHPT-N--P--------QPTR---VEN-LWF--IPAPRTSASPAIVI--EE
A0A5R8VLL6      -G---ITDVLTGK-A--E---VDDVLQQRG---DLPNLSI--LGAGRTPPNPSELLSSHA
A0A538JQF8      -G---LSDVLSGS-P--DAPSLADVAQDTK---VPG-VQV--IAAGSRVANPGRLL--AR
A0A1H6YPK1      -G---LTSVLASQ-A--S---IEEVTQQVG---DSGRFSV--VTAGVIPPNPSELVGSDT
A0A2R7MGI0      -G---LSDVLAAR-A--Q---IEQVAHQVD---EEGRLFV--VAAGRTPPNPTEMVGSQR
A0A2T7WQY4      -G---LSDVLASR-A--Q---IEQVAHQVD---DHGRLFV--VAAGRTPPNPTEMVGSQR
A0A1G6GTN3      -G---LSDVLAGR-A--Q---IEQVARQVD---QNGRLFV--VAAGRTPPNPSEMVGSQR
A0A1N7DLV3      -G---LSDVLAGR-A--R---IEQVAHQVD---ENGRLFV--VAAGRTPPNPSEMVGSQR
A0A1V2NSB5      -G---LSDVLAGR-A--R---IEQVAHQVD---EHGRLFV--VAAGRTPPNPSEMVGSQR
A0A0Q5Q5L3      -G---LSDVLAGR-A--Q---IEQVAHQVD---EHGRLFV--VAAGRTPPNPSEMVGSKR
A0A0Q6DVM4      -G---LSDVLAGR-A--Q---IEQVAHQVD---EHGRLFV--VAAGRTPPNPSEMVGSKR
A0A1R3WWR6      -G---LSDVLAGR-A--Q---IEQVAHQVD---ENGRLFV--VAAGRTPPNPSEMVGSQR
A0A0Q5JKD6      -G---LSDVLAGR-A--Q---IEQVAHQVD---EHGRLFV--VAAGRTPPNPSEMVGSQR
A0A0Q9TBP0      -G---LSDLLVSE-E--D---PSSYLIDIG---VDN-LTL--LPAGTLPPNPAALLASGQ
A0A5Q2FA83      -G---LTTVLLGR-A--T---VAEAAQKWG---DSS-LHV--LPSGAIPPNPSELLGSTA
A0A346XTB0      -G---LSDLAAMD-M--E---PNEVLRRYK---FSEQSQIPVVTAGQRRGDPAALLRTHA
A0A0G3V3M7      -N---LTDIPHQG-T--AA-DVLAVAQETG---IPN-IRF--IASAPTRTDPGTAIEMVK
A0A6I3DD56      -N---LTDIPYQG-T--AA-DVSAVAQETG---VPN-IRF--IASAPTRTDPGTAIELVK
A0A2W6DK08      -G---LSNLLRST-T--TV-DLSLHVRQSD---IPR-VDV--VTAGTQLERPSTL--PAR
A0A2S0LQ32      -G---LTQVLAGD-V--P---VSDVAQFVK---GHPHLRV--IPAGRIPPNPSELLGSQR
A0A2N6V1R5      -G---LTQILAGD-M--Q---LSDVAQKIE---GQPNLRV--VPAGRIPPNPSELLGSQR
G9PHS6          -G---LTQILAGD-M--Q---LSDVAQKIE---GQPNLRV--VPAGRIPPNPSELLGSQR
U1PLM7          -G---LTQILAGD-M--Q---LSDVAQKIE---GQPNLRV--VPAGRIPPNPSELLGSQR
A0A6I1G2U1      -G---ISDFLYDP-A--ST-RLEALARPTS---VPG-VKI--ITAGTQLAHPASL--ATR
A0A351ETF8      -G---LSDVLAGE-A--T---RRDARQVFE---RDG-IRFDVITSGSKVQDPALLLRGDR
A0A542FTE6      -G---LTDVLAGR-A--T---PADVAQRVP---GNLDLTV--FTSGPTPPNPSELLGSNA
A0A349B7N2      -G---LAPV--DA-P--D---VSGLIGRSH---IPGVSAITHLDERLESVQPADLL--SW
A0A2S5UYV0      -G---LSEVLSGQ-V--S---LEDALTATK---TPG-LYA--LPSGRIPPNPSEMLGSEA
A0A2S5X9U6      -G---LSEVLSGQ-V--S---LEDALVGSK---IPG-LYV--LPSGRIPPNPSEMLGSEA
A0A2S5ULV5      -G---LSEVLSGQ-V--S---LEDALVGSK---IPG-LYV--LPSGRIPPNPSEMLGSEA
A0A653YMF0      -G---LSEVLSGQ-V--S---LEDALVGSK---IPG-LYV--LPSGRIPPNPSEMLGSEA
A0A346Y185      -G---LPALADPR-N--N---LSEIIVPLT---ADEGQYVPFIPAKSLGDDTAAFFRTPG
A0A259S8H9      -G---LSEVLSGQ-V--P---IGSAIRRTE---EA-NLFV--LPAGGIPPNPSEMLGSAA
A0A0Q5L115      -G---LTDVLSGR-A--Q---LHQVMQQTE---AASNLWV--VGAGRIPPNPSELLGSQT
A0A2W1Z497      -G---LTDVLSGR-A--D---LADVMQQTD---DVGNLWI--VGSGRVPPNPSELLGSRM
A0A4V1VGV9      -G---LTEVLTGQ-A--P---LASAIQQGD---HKN-LAV--ITSGRVPPNPSELLGSRR
A0A3Q9IY80      -G---VTDVLAGR-A--T---VEDVAQRVG---RKGNLLV--LGAGKLPPNPSEVLGSER
A0A0F0LP73      -G---LSEVLSGQ-M--P---IGPAIRQTS---DPN-LFV--LPAGGIPPNPSEMLGSTA
A0A1F1X071      -G---LSQLLAAS-V--S---LEDVAEPTT---VPL-LTL--LPAGQIPPNPSELLGSRR
A0A3R8RWC7      -G---LSQLLAAS-V--S---LEDVAEPTT---VPL-LTL--LPAGQIPPNPSELLGSRR
A0A4U0RJZ4      -G---LTEVLTGQ-A--S---LRQAIQPGD---HKN-LSI--ITSGRIPPNPSELLGSRR
A0A4R1FGL9      -G---LTEVLTGQ-A--S---LRQAIQPGD---HKN-LSI--ITSGRIPPNPSELLGSRR
E3B8H1          -G---LTEVLTGQ-A--S---LRQAIQPGD---HKN-LSI--ITSGRIPPNPSELLGSRR
A0A7D7WDT9      -G---LSEVLSGQ-I--T---VRDAVQSTD---AAG-LFA--LAAGGTPPNPSEMLGSSA
A0A0Q5AWK6      -G---LSEVLSHQ-I--P---VEDAIRPTG---TEG-LFA--LPSGHIPPNPSEMLGSAA
A0A6P1F176      -G---LSEVLSHQ-I--P---VEDAIRPTA---TEG-LFA--LPAGHIPPNPSEMLGSSA
A0A3N1NLD3      -G---LSEVLSHQ-I--P---VEDAIRPTA---TEG-LFA--LPAGHIPPNPSEMLGSSA
A0A3N2FVI8      -G---LSEVLSHQ-I--P---VEDAIRPTA---TEG-LFA--LPAGHIPPNPSEMLGSSA
A0A2S5XDQ6      -G---LSEVLSHQ-I--P---VDDAIRPTG---TAG-LYA--LPAGHIPPNPSEMLGSEA
A0A2S5XNN6      -G---LSEVLSHQ-I--P---VDDAIRPTG---TAG-LYA--LPAGHIPPNPSEMLGSEA
A0A4Q4D4T1      -G---LTSVLVGK-V--P---LDSAVQGTD---VPG-LDV--LTSGTRPPNPSEIIQTAA
A0A261FE22      -G---LMQMLTNQ-V--D---AQTAVQQYW---KPE-FQV--LPVEDNQGTAAVMLSSAV
A0A5C8C085      -G---LTDVLVGR-A--S---IDDVLQQHH---ELENLSV--LAAGGIPPNPSELLGSQA
A0A1E4BP96      -G---LTDILAGR-A--T---TGDVVQPVQ---GSQNLYI--LASGRVPPNPSEVLGSRR
A0A439DNZ6      -G---LSTVLAGR-A--S---LEDVLQETA---FPG-VTV--VTSGAVPPNPSELLGSLA
A0A0J6YE86      -G---FSTVLSGA-V--S---IDDSLQKTR---FPG-LSV--LTSGAVPPNPSELLGSQS
A0A5Q5BFU2      -G---FSTVLSGG-A--S---LSEALQNTR---FPG-LTV--LTSGAIPPNPSELLGSQS
A0A151BT98      -G---LTNVLVHE-V--G---LKDVLVEPE---PSLPLFV--LPAGPVPPNASELLGSSA
A0A2Y8ZRF8      -G---LTNVLVHE-L--A---LKDVLVEPE---PSLPLFV--LPAGPVPPNASELLGSAA
A0A2R9UAT1      -G---VTDILAGR-A--E---VDDVAQTFG---HLDTLRI--VAAGRTPPNPSEVLGSER
A0A4Q5J5D7      -G---LTDVLIGR-V--D---FEDVAQEHP---DYPNLLL--LAAGGVPPNPSELLGSQT
A0A1Y4CKD6      -G---PAEVLEDSGL--G---VDDCIVLLE---ESG-IGF--WGGAGPVQNPVEVLSDER
A0A3S0V9U6      -G---LSQVLSGQ-V--G---IEEAIQRFH---ESE-LYV--VPAGRIPPNPSELLGSAK
A0A1S2N0P2      -G---LSQVLSGQ-V--G---PEEAIQRIG---DTE-LYV--LPAGRIPPNPSELLGSSK
A0A0Q3BEY5      -G---LSQVLSGQ-I--G---PEEAIQRIG---DTE-LYV--LPAGRIPPNPSELLGSSK
A0A4R6Q3C6      -G---LSQVLSGQ-I--G---PEEAIQRIG---DTE-LYV--LPAGRIPPNPSELLGSSK
A0A2X3GKL3      -G---LSQVLSGQ-V--G---PEEAIQRIG---DTE-LYV--LPAGRIPPNPSELLGSSK
A0A0Q7KBQ4      -G---LMTVLIGR-T--S---LDEATQVHD---SG--ISF--LGTGPKPPNPAEVLDTQA
A0A1F1IHY9      -G---LTDVVLGR-V--E---LADALQTVG---NRPSLQV--LASGPIPPNPSEILASDR
A0A542HCT5      -G---LTDVLIGT-V--Q---FDEVAQQVG---GLPNLRV--LAAGRVPPNPSEMLGSKA
A0A2S8WHZ8      -G---LTDVLSHS-A--D---LEDVLQPYG---HLPNLQV--LCSGRIPPNPSELLGSKA
A0A537WNY9      -G---LTEVLIGD-S--S---LDDAIRKTS---NPS-LNV--LTGGRRLADPGEML-TIS
A0A5B8M469      -G---LSEVLSGQ-V--P---VQEAVRTVG---REN-LMV--LPAGGTPPNPSEMLGAHA
A0A1Y4CTD2      -G---VGPVLNGR-S--G---VYELFQYKA---LRD---------------PMAVFSGER
A0A0Q5M6Z7      -G---LTDVLSGR-V--D---LNDALQAPS---DSPHLRV--LGAGRVPPNPSELLGSRT
A0A3N3ZPU0      -G---LTDVLAGA-A--E---LEDVLQDWE---PGSNVHL--LGAGRTPPNPSELLGSKT
A0A359IQX7      -G---LTQVLAGD-V--S---IDDAIQNSE---LAN-LKV--LSAGRIPPNPSELVGSQR
A0A433EDP2      -G---LTQVLAGQ-V--D---IAEAVYQLE---ESN-LFV--LTAGRIPPNPSELLGSDK
A0A231VTW0      -G---LTQVLAGQ-V--D---IAEAVYQLE---ESN-LFV--LTAGRIPPNPSELLGSDK
A0A433ECD0      -G---LTQVLAGQ-V--D---IAEAVYQLE---ESN-LFV--LTAGRIPPNPSELLGSDK
U7V3Z1          -G---LTQVLAGQ-V--D---IAEAVYQLE---ESN-LFV--LTAGRIPPNPSELLGSDK
A0A1F1J417      -G---LTQVLAGQ-V--D---IAEAVHQVE---DSK-LFV--LPAGRIPPNPSELLGSDK
A0A2A8D6P2      -G---LTQVLAGQ-V--D---IAEAVHQVE---DSK-LFV--LPAGRIPPNPSELLGSDK
A0A1F0THV9      -G---LTQVLAGQ-V--D---IAEAVHQVE---DSK-LFV--LPAGRIPPNPSELLGSDK
A0A5F0M6Y0      -G---LTQVLAGQ-V--D---IAEAVHQVE---DSK-LFV--LPAGRIPPNPSELLGSDK
D8USQ4          -G---LTQVLAGQ-V--D---IAEAVHQVE---DSK-LFV--LPAGRIPPNPSELLGSDK
E3H5W1          -G---LTQVLAGQ-V--D---IAEAVHQVE---DSK-LFV--LPAGRIPPNPSELLGSDK
A0A1F1QKB0      -G---LTQVLAGQ-V--D---IAEAVHQVE---DSK-LFV--LPAGRIPPNPSELLGSDK
A0A509JY23      -G---LTQVLAGQ-V--D---IAEAVHQVE---DSK-LFV--LPAGRIPPNPSELLGSDK
A0A448USF4      -G---LTQVLAGQ-V--D---IAEAVHQVE---DSK-LFV--LPAGRIPPNPSELLGSDK
A0A0Q9LZR0      -G---LTDVLIGS-V--E---FEEVVQQVG---GLPNLSV--LAAGRVPPNPSEMLGSKA
A0A1N7E3F1      -G---LTDVLIER-A--R---LHEVIQTWG---QPG-LSV--LPSGRIPPNPSELLGSRV
A0A544ZKQ1      -G---LTDVLIER-A--R---LHDVIQTWG---QPG-LSV--LPSGRIPPNPSELLGSRG
A0A372P1T1      -G---LTDVLIER-A--R---LHDVIQTWG---QQG-LSV--LPSGRIPPNPSELLGSRG
A0A5D0Q2X0      -G---LTDVLIER-A--R---LHDVIQTWG---QQG-LSV--LPSGRIPPNPSELLGSRG
A0A5R8Z2E7      -G---LTDVLIER-A--R---LHDVIQTWG---QQG-LSV--LPSGRIPPNPSELLGSRG
A0A1L2ZMV4      -G---LTDLLSGA-V--D---LDDVLQEWS---GDPRLQV--LGAGRVPPNPSELLGSRA
A0A6I3F378      -G---LVDALVGR-N--P---LELVRHTLD---GPD---V--LPAGRSPYNSSELLSSRR
A0A1E9T6I0      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1S1CQC5      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1S1CAD0      -G---LTQVLAGQ-V--E---IANAVHQLG---ESN-LFV--LPAGRIPPNPSELLGSDK
G5ET14          -G---LTQVLAGQ-V--E---IANAVHQVG---ESN-LFV--LPAGRIPPNPSELLGSDK
A0A1E9DXX2      -G---LTQVLAGQ-V--E---IANAVHQLG---ESN-LFV--LPAGRIPPNPSELLGSDK
A0A1E8S156      -G---LTQVLAGQ-V--E---IANAVHQLG---ESN-LFV--LPAGRIPPNPSELLGSDK
A0A1E8S5S2      -G---LTQVLAGQ-V--E---IANAVHQLG---ESN-LFV--LPAGRIPPNPSELLGSDK
A0A1S1DFA8      -G---LTQVLAGQ-V--E---IANAVHQLG---ESN-LFV--LPAGRIPPNPSELLGSDK
A0A2I1Z490      -G---LTQVLAGQ-V--E---IANAVHQVD---ESN-LFV--LPAGRIPPNPSELLGSDK
A0A1F0DAA9      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1F0PHK9      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1F0VZG6      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1E9G8X4      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1E9IAW2      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1E9ZBC9      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1E9ZDP4      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1F0R6B5      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1F0Z7N5      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1F1D897      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
D2NP38          -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1F1FV74      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1E9M791      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A291DEI8      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1S1D5T1      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1E8TRD6      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1F0XT88      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1F1EVP5      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
C6R548          -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A0K2RXS2      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A1F0KX60      -G---LTQVLAGQ-V--E---IANAVHQLG---DSN-LFV--LPAGRIPPNPSELLGSDK
A0A542I3V2      -G---VTNVLSGQ-A--Q---LVDVIQAPT---VLSNLSV--LGSGPTPPNPSELLGTNA
A0A2T0UZ65      -G---LSEVLSGQ-M--D---YTDAMQATR---HQD-VFV--IAGGQVPPNPSELLGSAR
A0A1R4JTI6      -G---LTNAVVGN-A--Q---VDDVLQPVS---EVENLTV--LASGPVPPNPSEILGSDR
A0A4R7TM52      -G---LTDVLAGR-A--D---FEDVAQPVG---QGGNLSV--LGAGLLPPNPSEVLGSAR
A0A542XE74      -G---VTQVLAGD-V--P---LEEALVESG---TRG-LQI--LPAGRIPPNPSELVGSNA
A0A0G3V3F3      -G---LTSVLLGS----D---LSEALRKVA---ESPFLRV--LSSGPPVEDPSAILGARA
A0A0Q7QDF6      -G---LTSVLVGK-V--P---LDSAVQGTD---VPG-LDV--LTSGTRPPNPSEIIQTAA
A0A5R8L819      -G---LTDVLARR-S--T---WREVSQPAH---TPN-LTV--LAAGRIPPNPSELVGSER
A0A261FQA1      -G---LAHVLARQ-A--K---LDEAIQQYW---KPT-FHV--MPAGEQQANPSILINSKA
A0A1Q2CJ92      -G---LSQVLAGT-I--K---LSDAMQATD---HKH-LQV--LPAGRIPPNPAEMVGSSR
A0A2T0S3C8      -G---LTTVLAGR-A--S---IADVVQPWS---EG--MWA--LPSGSLPPNPSELLGSQH
A0A4Y8WZJ3      -G---LTDVVLGR-V--E---LADALQTVG---NRPSLQV--LASGPIPPNPSEILASDR
A0A285VUW0      -G---LTSVLAGD-A--R---AEDVIQRWR---DTE-MYV--LAGGEIPPNPSELLGSRA
A0A2R7Z032      -G---LTQVLAGD-L--R---AGEAMVSSG---IDN-LWL--LPAGRIPPNPSELLGSLR
A0A6J4MTQ2      -G---LTQVLAGD-V--E---LADALIDPG---MPN-LLL--LPAGRIPPNPSELLGSKR
A0A1I0W453      -G---LTQALAGD-V--E---IRDVIIDSG---MPN-LSL--LPAGRIPPNPSELLGSLR
A0A1H4LCS9      -G---LTQALAGD-V--D---IRDVIVDSG---LTN-LSV--LPAGRIPPNPSELLGSLR
A0A4Q2RZP8      -G---LTQALAGD-V--D---IRDVIVGSG---LSN-LSL--LPAGRIPPNPSELLGSLR
A0A0Q6VV12      -G---LTQALAGD-V--D---VRDVIVGSG---MAN-LSV--LPAGRIPPNPSELLGSLR
A0A495NTA9      -G---LTQALAGD-V--E---VRDVIVGSG---LAN-LSL--LPAGRIPPNPSELLGSLR
A0A0Q9QB08      -G---LTQALAGD-V--D---VRDVIVESG---VAN-LSL--LPAGRIPPNPSELLGSLR
A0A4Q2SA86      -G---LTQALAGD-V--E---VRDVIVESG---MAN-LSL--LPAGRIPPNPSELLGSLR
A0A4Z1C3Z0      -G---LTQALAGD-V--D---VRDVIVQSG---MAN-LSL--LPAGRIPPNPSELLGSLR
A0A542J310      -G---LSDVLAGR-A--A---LTEVLQRTP---KSNNLLV--LAAGSVPPNPSEVLGSER
A0A4Q2JUT1      -G---LSDVLAGR-A--A---LSEVLQRTP---KSNNLLV--LAAGSVPPNPSEVLGSER
A0A6L5R0V7      -G---LSDVLAGR-A--A---LSEVLQRTP---KSNNLLV--LAAGSVPPNPSEVLGSER
A0A444BL03      -G---LSHVLTDQ-V--D---LEDAFQPTD---QEN-VRL--ITSGRTPPNPSELLGSAR
A0A4Y8X357      -G---LSEVLSGD-V--F---LADALITLE---DG--LVL--LPAGRTPPNPSEQLGSSR
R4LD52          -G---LTTVLAGK-A--A---VDDVLQRYG---DH--LWV--LPSGFLPPNPSELLGSQH
A0A4T2CD79      -G---VTDLLIGS-A--E---LDDVLQPWG---ERGNLRV--LGAGSIPPNPSELLGSHG
A0A6L6AM03      -G---LTQALAGD-V--D---VREVIIESG---MPN-LSL--LPAGRIPPNPSELLGSLR
A0A4Q2RU39      -G---LTQALAGD-V--E---VKDVIVDSG---MTN-LSL--LPAGRIPPNPSELLGSLR
A0A4Q2SK58      -G---LTQALAGD-V--E---VKDVIIDSG---MTN-LSL--LPAGRIPPNPSELLGSLR
A0A2N3YJR1      -G---LSHVLTDQ-V--S---LVDALQATD---QPN-VRL--ITSGRTPPNPSELLGSAR
A0A6G8FYB9      -G---LSHVLTGQ-V--P---VEDVLLETD---EPN-VRL--VTSGRTPPNPSELLGSVR
A0A4Q4D742      -G---LLSVLVGR-T--T---IEQAIQPH----VSG-ISF--MGTGPAAPNPAEVLESRA
A0A1C6T1J1      -G---LTDVLVGD-V--Q---VGDVVQRWG---DKS-LLV--LPSGSTPPNPSELLGSKA
A0A2W2CFC8      -G---LTDVLVGD-V--P---VGDVVQRWG---DKS-LLV--LPAGSAPPNPSELLGSKA
A0A2W2A4B0      -G---LSDILVGR-V--E---LADVLQPWG---RAG-LSV--IPSGTVPPNPSELVGSPA
A0A4Y9MDA5      -G---LTTVLLGR-A--G---LPDLVQEWG---TSG-LHV--LTAGPVPPNPSELLGSPA
A0A1H7N9P7      -G---LTTALLGR-A--S---VADLVQEWG---TAG-LHV--LPSGPVPPNPSGLLGSPV
A0A1M7V0F8      -G---LTTVLLGR-A--T---VADLVQDWG---TEG-LHV--LASGPVPPNPSELLGSPA
A0A520EHH5      -G---VSSVLAHD-A--G---LDEVVQTTG---HTD-LWA--LGSGPAPPNPSELLGSST
A0A1V8PLV6      -G---LTHVLSDQ-A--A---VKDAVQRYW---KPN-LHI--LPAGPKPLNASMLLNSKT
A0A4R0U4F1      -G---LTHLITNR-V--S---SHDAIQRYW---KPN-FHV--LPAGKQTMNPSILLNSRA
A0A357ZCV8      -G---SYAVLTGL-A--K---LSDAVVSTP---IPN-LFF--LDTEPNIPSPTDVLSSKS
A0A4R5Z7B0      -G---FTTVLTKQ-A--T---LGSTVLETE---EKD-LYI--LTSGPVPPNPAELLSSKS
A0A6M8GFV5      -G---LTTAIAQD-K--Q---LKDFVQKSQ---IEN-LSI--LTSGPIPPNPSELLSSEK
A0A4R1CW45      -G---VSDYLLGE-ME-S---LHEVGLHID---GTK-LAV--FPTHTVSMDSAEAIASGR
A0A419GS64      -G---LTRMISTY----D---EGDDPFAFGDQVMDG-LTV--IGSGPPPPNPSEIISSRR
A0A2V2CXY5      IG---GAHYLAGK-A--D---MADVIYQTN---IPN-GYM--IPTTSAIANPTILLEGTR
A0A2S8MDM2      -G---FSTVLSGR-A--L---LGEALQKTR---FPG-LTV--LTSGSIPPNPSELLGSQS
A0A357ZDL3      -G---LYAVLAKQ-V--A---LNDAVMTTQ---AGN-LFF--LDAEAGIPNPVDILSSNR
A0A4Y8ZIU8      -G---LSEVLNGD-V--A---LQDVLVPVG---DHG-LLL--LPAGRTPPNPSEQLGSAR
A0A1I6GVG4      -G---ISDVLAGR-A--T---IAEVAQRFG---NGQ-LLV--VTAGKVPPNPSEVLGSAR
A0A1I6IST1      -G---ISDVLAGR-A--T---IAEVAQRFG---NGQ-LLV--VTAGKVPPNPSEVLGSAR
A0A412JBM5      -G---LCKYLVGL-G--E---LG--LASIE---GIP-LDI--AFCGVIPPNPSELLSSTR
A0A6J4SUA1      -G---LMEFLSGE-A--G---LDEIVVPTE---YDR-LSL--IPCGTRRRRGPELLASAN
A0A1C2B334      -G---LTDFLIGQ-G--D---LPDLLQQGG---LDR-LDV--LATGQLPPNPAELLGSSR
R7Y679          -G---LTDYLRGS-A--P---VGDVLQRSG---VGG-FDV--LAAGALPPNPAELLGSRR
A0A0F0KYJ9      -G---ISDVLAGC-A--T---IAEVAQRFG---NGQ-LLV--VAAGKVPPNPSEVLGSAR
A0A538BBM6      -G---VVDVLRGN-T--V---VEDALQYVPVTRETG-MYF--LSTGSSVSNPTELLGAGR
A0A510HHA8      -G---LVNAITGE-R--G---LQEVLSEP----LPN-LKV--CPSGPVPPNPAELLSSNR
A0A6G8Q9J3      -N---LLDVLARE-D--G---LGEAWQEA----APR-LKV--VAGGPTPPNPAELLGSRR
A0A5Q2F9A3      -G---LSTILIGR-A--S---LREVVQVAG---MGT-LQV--LTSGPVPPNPAELLGSIS
A0A4R1BMZ2      -G---VVDVLVGK-R--S---LPDTMQEV----LVG-LNV--LTCGPIPPNPAELLSSQR
A0A023X491      -G---VVDALVGS-E--N---VEELWQTP----LDN-LSV--LTSGPVPPNPAELLGSER
A0A6G8QDQ0      -G---VVNVLANE-L--E---LQETWHEP----VPF-LKV--ATVGPLPSRPAELLGSKR
A0A0K8Q3D9      -G---VTDVLSGT-A--D---LDDVLQPWGA--LPN-LSV--LGSGRIPPNPSELLGSRA
A0A2R7RCA1      -G---VTDVLTGT-A--E---LADVLQPWGA--LPN-LSV--LGSGRIPPNPSELLGSQA
A0A1Q7WJN6      -G---LTDVLAGD-V--T---AEAALQRTP---YSG-LSF--IGCGSRRHRGPELLSSAA
A0A6D1QMN1      -G---LSNVVTGQ-S--T---LDEAALETS---IPR-LDV--LPSGPVPPNPSELLASKA
A0A1E2SNF6      -G---LSDVLAGR-V--S---LREVLQDPDVSLHTH-IRV--LTAGRTPPNPSELLGSRT
Q6ADE8          -G---LSDVLAGR-V--S---LREVLQDPDVSLHTH-IRV--LTAGRTPPNPSELLGSRT
A0A1Q7CZ24      RG---LAEALLAD-SGLS---LEDTVETLA---HFN-LSV--LPAGRATVAPYELLKSPR
A0A2W6VLC6      -G---LTDVLIGR-A--R---VEDVVIDMA---PRG-FSV--LPAGRIPPNPSELLSSPR
A0A519G798      -G---LTTVLVGR-S--E---LQDSIQKHT---DSG-IYF--LASGPIPPNPTEVLQSRA
                                                                            

A0A519GXS6      MRVLLEGLREEY--DLVVVDTAPVLSVSDATVISQYVDATVIVVNTRRTGKAKIEQAVAA
A0A6N6NKS9      FAALVDTLREMF--DYVIFDSPPIGLFVDAAIISNLVDGTLYVIRERAAKRDAVVAGVQQ
A0A538BYZ4      LGELLGEARHRY--DYVLLDTPPVVVVPDCRVIEKWVDGFLLVVAARKTPRKLLEEALTV
A0A348NU28      MKRLLEEATARY--DYVIIDSPPVMSVADANLLAPFVDGVIVVVDAGKTRRNQLIQAAAS
A0A2N4T4Q5      MRTMLAELAEDA---FVLVDAPPLLPVTDAALLTASADGALVVATAQGTTVDELGKALGN
A0A1M3LEY6      MVNLLRHVEKEY--DVVLIDGPPLLPVTDSALLSKQVRGALLIVAAGRTHRGQVHGSVEA
A0A538AJI7      LTDVLDEARENF--DLVVIDTPPLLSTDDARTIATMAKGILLVVTRGTLAR-SVNEAVVA
A0A538AM15      LGELLEEARLRY--DYVVLDTPPLCPVQDCRVIAHWIDGFLLVVAAHHTPR-RLVEEALN
A0A022KX11      MEALLTRLMQEY--DFVLIDSPPVVPVIDAVVIERLTGGLLMVVGVDRTKKRDLAAALKQ
A0A4Q5A868      MVELLNNAIAQY--DYVLIDTAPMVVANDAVIFVRRGGSLVMVCRRDQTLKRDLREISEE
A0A6N4VXX3      AKKLLAELRGQF--DYVIVDSSPLLAVTDASLLAADADGALLLARYGKTRRDQLTHASEA
A0A1H4I042      AKNLLEELRGKF--DYVIVDSCPLLAVTDAALLAANADGALLLGRYGQTRRDQLKNATDA
A0A4R7A6D9      AKNLLEELRGKF--DYVIVDSCPLLAVTDAALLAANADGALLLGRYGQTRRDQLKNATDA
A0A345NSU7      MHELFERLSEQY--DFILVDTPPVLPVTDAMVIEKLTGGMLMVVASGETRKRHVSEAMRV
A0A0W8I9Y2      MHAMLETLAED---ALVLVDAPPLLPVTDAALLTASADGAIIVATAQKTTTDELSKALEN
A0A7C6LSF9      MGVLVDEARKVA--DIILIDTAPLLAASDVFDLLPIVDTVLFVVRNGRITEGAAQRVSEL
A0A4Y5YMQ6      MTELVEGLRPRY--DFVVIDTAPLLSVADATIISQYVDSTIVVVNTRKTTRAQLERCLAA
A0A255G8R8      MRALLDEALAEY--DVVLIDSPPLLPVSDGLVLGKLVGGALLVTGIERVKKPQLAESLAA
A0A6G7Y423      MAHLITAAERSY--DYVLFDAPPLLPVTDAVVLASQTGGAILVARSGVVRRPQFEGAVDL
A0A4Q5APW3      MVELLNNAIERY--DYVLVDTAPMVVANDAVIFVRRGGSLIMVCRRDQTLKRDLREISEE
A0A4Q5B0V3      MVELLNNAIERY--DYVLVDTAPMVVANDAVIFVRRGGSLIMVCRRDQTLKRDLREISEE
A0A1Q2CRV2      MRALLEDASKLY--DTVIIDSPPLLPVTDAAVLAGETAGVLVVVGSGIVRRPELTASLEV
A0A222TG79      ASEGINSLSSLY--DYVIVDTPPVLPVTDAVIASRLVDGVIVVVRSGASRRPDLESMLSH
A0A6I3DFP2      FRVVLDTLRAVR---LVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEE
A0A2S5WZJ5      MKSIISLLSTDY---IVVIDAPPLLPVTDAAVLSTRVDGVVLVATAGRTRREDASAARDM
K6WHS4          ASDVFGSLRDSF--EYVVVDTPPCLPVTDAQVVSRLVDGVLVVVRIDKSAKHELSDTTRQ
A0A1L2ZMQ6      MGKLLEDLSERA---FVIIDAPPLLPVTDGAVLAKASDGALIVVKAGKPTIDELAKATEN
A0A3L8NYD3      MQSVIEELVAAD--YMVLIDAPPLLPVTDAGLLSGIVDGSILVLAVGKTYKEQARLAAKV
A0A1M6K628      MADLIAHL-SET--HLVIIDAAPLLPVADAGLVSAVSDGVLLVVQHGKTLREQIALATRN
A0A561E8R3      METAITEL-SKD--HLVIIDAPPLLPVTDAGLLARSADGALLVMHVGRTRAEHIRLCARI
A0A3E2DN22      MKDLLTELRKRG--YFVVIDAPPLLAITDAGLLGAIADGTIYVAVVGKTHRDQVSLVAKR
A0A3Q9ULZ9      MHNLISRLTKAG--YFVVLDAPPLLAVTDAGLLATSTDGVIMVHVVGGTHKEQVTLCTKR
A0A3S9JFL2      MHNLIARLTKAG--YFVILDAPPLLAVTDAGLLATSTDGVIMVNVVGGTHKEQVTLCTKR
A0A3L7ADK2      MKELLAALGEQS---IVILDAPPILPVTDAVVLANSADGVVLVASARNTTYEQFGRAQQL
A0A1Q2CI19      MGPLVASARKRA--DVVIIDSAPLLEAAEVFDILPHVDDVVLVARSGRLSAASAQRTKEM
A0A512T3M3      MVALQEGTRQLA--DVVIVDSAPLLAASEVFDLLPLVDTIMLVVRSGRLSETSGNRVSEL
W6JTW4          MGPLLEEARGLA--DVVLVDTAPLLAASDVFDILPLVDTVLVVVRSGRITHAAGSRLAEL
A0A0A0JTY0      MSHLLDEARGMA--DVVLIDTAPLLEASDVFDILPMVDTLLLVVRSGRLTEVAGNRVAEL
A0A0A0JXF2      MGGLLEEAREMA--DVVLIDTAPLLEASDVFDILPMVDTILLVVRSGRLTEPDGNRVAEL
E6S8H2          MGGLLTEARGLA--DVVLVDSAPLLAASDVFDVLPLVDTVLLVVRSGRLTEVAGHRVSEL
A0A0A0JGH0      MGHLLAEVRELA--DVVIIDSAPLLAASDVFDILPIVDTVVLVVRSGRLTDVAARRVAEL
N0E4U7          MGHLLEEVRGMA--DVVIIDSAPLLAASDVFDVLPIVDTVLLVVRSGRLTDVAAHRVAEL
A0A0A0IYK2      LGSLLEEVRGMA--DVVLIDTAPLLEASDVFDILPMVDTLLLVVRSGRLTELAGNRVAEL
A0A0Q9L0H3      MGQMLEQARDLA--DVILIDSAPLLEASDVFDVLPTVDTLLLVVRSGRLTEVSGNRVAEL
A3TMK0          MGHLLEEARDMA--DVVLIDTAPLLEASDVFDILPMVDTLLLVVRHGRLTEVAGNRVAEL
A0A543PXP1      MGGLLSETRGLA--DIVLIDTAPLLAASDVFDLLPLVDTVLMVVRNGRITEVAGRRVSEL
A3TMH6          MGGLIAELRDLA--DVVLIDTAPLLAASDVFDVLPVVDTVVVVVRHGRITDVAGRRVAEL
A0A1H6WL79      MEHLLKDLAQRA---IVLIDAPPLLPVTDAAVLSRVADGTLVVARARKTTRDTLYRALSN
A0A101LAM5      MEHLLRDLSQRA---MVLIDAPPLLPVTDAAVLSRVADGTLVVARARKTTRDTLYRALGN
A0A4Y3NEG0      MEHLLNELSQRA---MVLIDAPPLLPVTDAAVLSRVADGTLVVARARKTTRDTLFRALGN
A0A6I2XCV4      LGRVIDSWRDDF--DIVFLDTPPMLTTNDATDLLASADLTMLVIRSGQTRTVAAERVSGL
A0A5R8VLL6      MKQLLNSLAERG---IVIIDAPPLLPVTDAVLLAKIADGAIVVVRAGQTTKEQLTKSLGN
A0A538JQF8      AADLVREARNLA--DFVLIDTAPTLIVNDAIDFMPEVDCVIPVLKCGSTTNDAAFRMGEL
A0A1H6YPK1      MRSLLYSFPEDT---MVIVDSPPLVPVSDAAVLAARTDGALVVARAGATSADMLEEALRI
A0A2R7MGI0      LQSLARKLAEEM---VVIVDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLTRAIEN
A0A2T7WQY4      MQALARKLAEDM---VVIVDSPPTLAVADAAVIGSWADGVVLVVTAGRTTDDMLTRAVDN
A0A1G6GTN3      MQALARKLADDM---VVIVDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLTRATEN
A0A1N7DLV3      MQQLARTLADDM---VVIIDSPPTLAVADAAVIANWADGAVLVVTAGRTTDDMLQRAVGN
A0A1V2NSB5      MQQLARTLADDM---VVIIDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLQRAVGN
A0A0Q5Q5L3      MQALSRKLAEDL---VVIVDSPPTLAVADAAVIASWADGTVLVVTAGRTTDDMLTRATAN
A0A0Q6DVM4      MQALSRKLAEDL---VVIVDSPPTLAVADAAVIASWADGTVLVVTAGRTTDDMLTRATAN
A0A1R3WWR6      MQALTRKLAEEL---VVIIDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLSRATEN
A0A0Q5JKD6      MQSLARKLADDM---VVIIDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLTRATDN
A0A0Q9TBP0      MHLVLEELAAKA--DMIVVDSPPVLTGADTLELAALADMVVVVTRERVSRRRQLVAVRET
A0A5Q2FA83      METLFAELLQAY--DYVLVDSPPVLPVIDPILIDRLVGGMLMVISVNTTLKRDLAQAVKQ
A0A346XTB0      FRKGMERIVDSA--ELLIVDSSPLLAVADATIVAGSVDGIVIVVSHG-TPFSELQKVKER
A0A0G3V3M7      VAARLGRDIAD----LVIVDSPPILLANDAAELSTFCDATVLMVRAGWTRRGGVVAASDL
A0A6I3DD56      VAARLGREIAD----LVIVDSPPILLANDAAELSTFCDATVLMVRAGWTRRGGVVAASDL
A0A2W6DK08      MGNLVMQARELA--DIVLIDSAPMLLANDATDLMPYVDTVLVVSYASRTTSEEARRASEL
A0A2S0LQ32      MKALLDRLSQEA---VVLLDAPPLLPVTDAALLSALADGAILTFEVGGTYKEQARLTGKI
A0A2N6V1R5      MKALMDYLKDDA---MVIMDAPPLLPVTDAGLLSALADGAILVMEVGGTYKEQARLCGKI
G9PHS6          MKALMDYLKDDA---MVIMDAPPLLPVTDAGLLSALADGAILVMEVGGTYKEQARLCGKI
U1PLM7          MKALMDYLKDDA---MVIMDAPPLLPVTDAGLLSALADGAILVMEVGGTYKEQARLCGKI
A0A6I1G2U1      MGTLIDEARPLA--DIVIVDTAPILAASDGFDILPIVDTVLFVVRSGRLTEAAGLRVSEL
A0A351ETF8      WTSLADELFLYD---LVIIDAPPVLAVTDAVLIGRAVNGQILLTRLGATKRSDLAEAAKL
A0A542FTE6      MREFLDSLRRTG--AFVVLDAPPLLAVTDGAVLSTIADGVIMTVDAASSTQDQLQRAVGA
A0A349B7N2      IRSTVQQARPTS--DVVLIDTAPFLTVNDARDLLDVADQVVVVARSGKTSRQSADRMSEL
A0A2S5UYV0      MRSIIRLLSQDY---IVVIDAPPLLPVTDAAILSTRVDGVVLVATAGRTRREDVGAARDM
A0A2S5X9U6      MKSIVSLLSKDY---IVVIDAPPLLPVTDAAVLSTRVDGVVLVASAGRTRREDVSAARDM
A0A2S5ULV5      MKSIVSLLSKDY---IVVIDAPPLLPVTDAAVLSTRVDGVVLVASAGRTRREDVMAARDM
A0A653YMF0      MKSIVSLLSKDY---IVVIDAPPLLPVTDAAVLSTRVDGVVLVASAGRTRREDVAAARDM
A0A346Y185      FRQAITRLREVA--DLIIVDSPPLLLASDASAIATNVDGIVVVVS-RGTSMKLLEEMRER
A0A259S8H9      FQQLLTRLRQDF---FIVVDAPPVLAVTDASVLSSVVDGLVFVVAMGRTRRVEIVEARTQ
A0A0Q5L115      FQDLVSTLAEHA---TVILDAPPVLAVTDAVVLAAKADGVLMTASAARTTFDQLDRALQL
A0A2W1Z497      FRDILASLGEHA---TVVLDAPPILAVTDAVVLAAGADGLVVTVSAQGTTIDQLGRALQL
A0A4V1VGV9      MSAVIEALGEEY---FVVLDAPPLLPVTDAGLLAVAADGAAVVYQHGRTHREQVGLCAKI
A0A3Q9IY80      MKNLLRTLAKDY---TVIVDAPPLIPVTDAAVLSHSADGAIIITSVGKTTFEALTKALQN
A0A0F0LP73      FQRLLGELRRDF---FIVIDAPPVLPVTDASVMSAFVDGVVFVIAMGRTRKTEVVEARTQ
A0A1F1X071      MQELIEELSRQY---FVIIDAPPVLAVTDAQLLTRHSDGAILVAVPGQTRTAAMQKAVEA
A0A3R8RWC7      MQELIEELSRQY---FVIIDAPPVLAVTDAQLLTRHSDGAILVAVPGQTRTAAMQKAVEA
A0A4U0RJZ4      MSAVIDALEEEY---FVVLDAPPLLPVTDAGLLSVAASGAAVVYHHGTTHKEQIALCTKI
A0A4R1FGL9      MSAVIDALEEEY---FVVLDAPPLLPVTDAGLLSVAASGAAVVYHHGTTHKEQIALCTKI
E3B8H1          MSAVIDALEEEY---FVVLDAPPLLPVTDAGLLSVAASGAAVVYHHGTTHKEQIALCTKI
A0A7D7WDT9      FGNLIKELRKDF---FIVIDAPPVLPVTDATVVSTMVDGVVFVLAVGQTRKTAGAVARAQ
A0A0Q5AWK6      MRTLVERLSKDY---FVIIDAPPILPVTDASIVATVVDGVVFVVASNRTRRPEVTAARRI
A0A6P1F176      MRALIERLAEDY---FVIVDAPPILPVTDASIVATVVDGIVFVVASNRTRRPEVTAARRI
A0A3N1NLD3      MRALIERLAEDY---FVIIDAPPILPVTDASIVATVVDGVVFVVASNRTRRPEVTAARRI
A0A3N2FVI8      MRALIERLAEDY---FVIIDAPPILPVTDASIVATVVDGVVFVVASNRTRRPEVTAARRI
A0A2S5XDQ6      MRALVARLSKDY---FVIIDAPPVLPVTDASIVATVVDGVVFVVASNQTHRPEVVAARRI
A0A2S5XNN6      MRALVARLSKDY---FVIIDAPPVLPVTDASIVATVVDGVVFVVASNQTRRPEVVAARRI
A0A4Q4D4T1      METVLIELGRRY--DIVLVDAPPLLPVADAALLSVISDGAILVVRHGRTGHDQVRAASER
A0A261FE22      MENMIDQAAKHY--DHVIIDTAPMQVSNDASLFAREGATLLLVVAQTVGRKKVLRDVAHE
A0A5C8C085      MRRLLTLLSQRA---IVLVDAPPLLPVTDGAVLTTMADGAFIVVSAGRTLDNELEASLEH
A0A1E4BP96      MRDLVTSLTEHA---LVIVDSPPTLLVADAAVLSRVTDGALLVTSAGRTTHEMLQRSLEN
A0A439DNZ6      AKKILDELRTGF--DYVVVDSSPLLAVTDAAILAAASDGVLIVARYGETKREQLAHAVGN
A0A0J6YE86      ARKVLAELRSRF--DYVIIDSTPLLAVTDAAILAAGADGVLIMARFGQTKREQLAHAVGS
A0A5Q5BFU2      ARRLLNELRAQF--DYVIVDSTPLLAVTDAAILAAGADGVLIMARFGHTTHEQLTHAVGS
A0A151BT98      MQGLFQELVAEF--DFVVFDSPPMLPVVDALELEKLTGNLILVARGGQVSRRELQITLKA
A0A2Y8ZRF8      MRNLFQELVAEF--DFVVFDSPPMLPVVDALELEKLAGNLILVARGGQVSRRELQVTLKA
A0A2R9UAT1      MKDLLRELSREA---MVIVDAPPLLPVTDAAVLTHSADGAIVVVGAGRTTIDVLKKAMNN
A0A4Q5J5D7      MRQLLTELAKTA---LVIVDAPPLLPVTDAAVLTAVADGAFVVISSGRTVDTELRDALAN
A0A1Y4CKD6      LPSLFDGLRGQW--DYIVLDASPCGMFQDAAMLANWVDEVLFVVRFDKVGRHNVQDALSM
A0A3S0V9U6      MRKLIEELAREY---LVLIDAPPLLPVTDGSLLSTSVDGAILVTKVGSTRRDQAEGAKAM
A0A1S2N0P2      MQRLIQEMSQEY---LVIIDVPPLLPVTDGSLLSANVDGAILVSVCGRTRKDQAQAAAQA
A0A0Q3BEY5      MQRLIQEMSQEY---LVIIDVPPLLPVTDGSLLSANVDGAILVNVCGRTRKDQAQAAAQA
A0A4R6Q3C6      MQRLIQEMSQEY---LVIIDVPPLLPVTDGSLLSANVDGAILVNVCGRTRKDQAQAAAQA
A0A2X3GKL3      MQRLIQEMSQEY---LVIIDVPPLLPVTDGSLLSANVDGAILVSVCGRTRKDQAQAAAQA
A0A0Q7KBQ4      MRDLLHGLRSEY--DVVVIDAPPMLPVADASILMREVDGALMLVRHGSTTREQLRLAVAR
A0A1F1IHY9      FNDLINALAEDA---LVIIDAPPLLPVTDAAILARRFDGCLLVVSAGRTTYDEFSKAVSS
A0A542HCT5      MRRLLERLGETC---TVIVDAPPLLPVTDAAVLTASADGALVVVSAGQTLDTQLRDALAN
A0A2S8WHZ8      MKSLLSELALDA---VVLVDAPPLLPVTDAAILSTSADGILVVVRAGSTTGDELGKAIEN
A0A537WNY9      FGSVLSQLAEMY--ETIVIDGTPLAPISDARVIARFADASVIVVSAGSATRRQLRTAIER
A0A5B8M469      FEALLRELRERF---FVVVDAPPVLPVTDALLVGAVADGTLFVVAVGQTRKAEVTAARRL
A0A1Y4CTD2      LADVMAELSERF--DYIFVDCSPVAAAADAELWMRQVDTVVLVVRQDMTDVRVINDTVDV
A0A0Q5M6Z7      MRELVSALADVA---IVILDAPPLLSVTDAAIMGTIADGVVITVGAKQVTGEQLEKAYRS
A0A3N3ZPU0      MRNLLARMGQDY---MVVIDSPPLLPVTDPSVLAKGADGVVIVTQANKTNLDDLTKAVAR
A0A359IQX7      MHNLLIALSENR---TVIVDAPPLLPVTDGGLLTAAADGAILVMATGRTYKEQLRVCARI
A0A433EDP2      MRQLVRELSEEF---VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNN
A0A231VTW0      MRQLVRELSEEF---VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNN
A0A433ECD0      MRQLVRELSEEF---VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNN
U7V3Z1          MRQLVRELSEEF---VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNN
A0A1F1J417      MRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAV
A0A2A8D6P2      MRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAV
A0A1F0THV9      MRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAV
A0A5F0M6Y0      MRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAV
D8USQ4          MRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAV
E3H5W1          MRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAV
A0A1F1QKB0      MRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAV
A0A509JY23      MRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAV
A0A448USF4      MRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAV
A0A0Q9LZR0      MRRLLEGLGETY---TVIVDAPPLLPVTDAAVLTASADGALVVVSAGHTLDTQLRDALAN
A0A1N7E3F1      MRSVLAQLTEEY--DMVIVDAPPLLPVTDAAALGAICDGALLVVRHGKTRNEQVLRAGEL
A0A544ZKQ1      MRSVLAQLTEEY--DMVIIDAPPLLPVTDAAALGAICDGALLVVRHGKTRREQVLRAGEL
A0A372P1T1      MRTVLAQLTEEY--DMVIIDAPPLLPVTDAAALGAICDGALLVVRHGKTRREQVLRAAEL
A0A5D0Q2X0      MRTVLAQLTEEY--DMVIIDAPPLLPVTDAAALGAICDGALLVVRHGKTRREQVLRAGEL
A0A5R8Z2E7      MRTVLAQLTEEY--DMVIIDAPPLLPVTDAAALGAICDGALLVVRHGKTRREQVLRAGEL
A0A1L2ZMV4      MKRLLTDLAQES---VVIVDSPPLLPVTDASVLSTSADGVLVVARAGSTSIEALKKATDR
A0A6I3F378      MGEVLHELAAIY--DFVIIDTPPVLPVSESLAVSRHADGTILVVRSGRTRSQQLQRTLGE
A0A1E9T6I0      MRQLIKELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASSI
A0A1S1CQC5      MRQLIKELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASSI
A0A1S1CAD0      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNI
G5ET14          MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNI
A0A1E9DXX2      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNI
A0A1E8S156      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNI
A0A1E8S5S2      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNI
A0A1S1DFA8      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNI
A0A2I1Z490      MRQLINELSEEF---IVVIDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASSI
A0A1F0DAA9      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASI
A0A1F0PHK9      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASI
A0A1F0VZG6      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASI
A0A1E9G8X4      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANI
A0A1E9IAW2      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANI
A0A1E9ZBC9      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANI
A0A1E9ZDP4      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANI
A0A1F0R6B5      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANI
A0A1F0Z7N5      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANI
A0A1F1D897      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANI
D2NP38          MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANI
A0A1F1FV74      MRQLIKELSEEF---IVVVDVPPLLPVTDASLLSNSVDGVILVGSIGRSHREQMTEASSI
A0A1E9M791      MRQLIKELSEEF---IVVVDVPPLLPVTDASLLSNSVDGVILVGSIGRSHREQMTEASSI
A0A291DEI8      MRQLIKELSEEF---IVVVDVPPLLPVTDASLLSNSVDGVILVGSIGRSHREQMTEASSI
A0A1S1D5T1      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAAST
A0A1E8TRD6      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAAST
A0A1F0XT88      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAAST
A0A1F1EVP5      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAAST
C6R548          MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAAST
A0A0K2RXS2      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASI
A0A1F0KX60      MRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASI
A0A542I3V2      MKQLLNTLAAGA---TVLIDAPPLLPVTDAAVLSRAADGVIVVAKAGRTTRDEFERSLRA
A0A2T0UZ65      MRQLLQELTRDH---FVILDAPPLLPVTDAALLSGAADGTILVFAVGKTHKDQVEACAKM
A0A1R4JTI6      LEAILRSLAQDH---MVIVDAPPLLPVTDAAILAAKYDGCVLVVTAGRTTRDELAKSLGN
A0A4R7TM52      MRDLLQRLAVDS---TVIIDAPPLLPVTDAAVLAHNADGAMIVASVGKTTVERLQKAIQN
A0A542XE74      MHRLIERLAADH---MVIIDAPPVLAVTDGALLSAAADGTILVTRLGRTHRAALEQSTKL
A0A0G3V3F3      FRVVLDTLRAVR---LVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEE
A0A0Q7QDF6      METVLIELGRRY--DIVLVDAPPLLPVADAALLSVISDGAILVVRHGRTGHDQVRAASER
A0A5R8L819      MNLLLHELAAEA---IVILDAPPLLPVTDAAVLSRQADGAIIVVTAGKTTYDLLKRALAN
A0A261FQA1      MNMLLHAAAKQY--DNVIVDSTPMSVANDSAVFAKEGGTLLMVVGQGVAQKKTLKASAEE
A0A1Q2CJ92      MRSLIEHLSKAH---MVIIDAPPLLPVTDATLLSASADGAVVVVQSGTTRREQLEVAAHK
A0A2T0S3C8      MADLLEQFREQY--DMVIVDCPPLLPVTDGAVVAARADGALLLARSHKTTSSQIQTAARA
A0A4Y8WZJ3      FNDLINALAEDA---LVIIDAPPLLPVTDAAILARRFDGCLLVVSAGRTTYDEFSKAVSS
A0A285VUW0      MERLFKQFLRDF--DFVLVDSPPILPVTDALVMSRLTGGLLMVVSAASTRRRHLQEALRT
A0A2R7Z032      MSQLIDELARTH---LVLLDAPPLLPVTDAGLLSAFCDGALLVQATGQTYIEQSEHCRRI
A0A6J4MTQ2      MDQLVAELARDH---LVLLDAPPLLPVTDAGLLTAFCDGALLVQTTGKTQIEQSQHCRRI
A0A1I0W453      MKQFIDDLAHDY---LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQSCRRI
A0A1H4LCS9      MKQFIEDLSHDY---FVILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRI
A0A4Q2RZP8      MKQFIEDLSHDY---LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRI
A0A0Q6VV12      MKQFIDDLSQDH---LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGRTQIEQSQQCRRI
A0A495NTA9      MKQFIDDLAQDH---LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGRTQIEQSQHCRRI
A0A0Q9QB08      MKQFIDDLSADH---LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQQCRRI
A0A4Q2SA86      MKQFIDELSHDY---FVILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRI
A0A4Z1C3Z0      MKQFIDELSHDY---FVILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRI
A0A542J310      MHTLISDLTKHA---TVIIDAPPLLPVTDGAVLAHQADGALIVVTLGKTTYDLLDKALDT
A0A4Q2JUT1      MHTLIADLTKHA---TVIIDAPPLLPVTDGAVLAHQADGALVVVTLGKTTYDLLEKALDT
A0A6L5R0V7      MHTLIADLTKHA---TVIIDAPPLLPVTDGAVLAHQADGALVVVTLGKTTYDLLDKALDT
A0A444BL03      MHELVRELTVDN---IVILDAPPLLPVTDAGVLSASCDGSLLVFAVGRTHKEQAELAARM
A0A4Y8X357      MRELLEALSETH---MILVDAPPVLPVTDSTLLANAVDGTILVVRHGTTRKEHVEVARDM
R4LD52          MALLMDELRTAF--DTIIVDCPPLLPVTDAAVVAARADGALLLARSHKTTTAQVSNAVTA
A0A4T2CD79      MTTLLRELALDA---IVLVDAPPLLPVTDAAILAAISDGAIIVVSAGRTTTDELERALAG
A0A6L6AM03      MKQFVDELSVDY---LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQQCRRI
A0A4Q2RU39      MKQLIDELAEEY---LVILDAPPLLPVTDAGLLSAFCDGALLVQASGKTHIEQSQHCRRI
A0A4Q2SK58      MKQMIDDLALDY---LVILDAPPLLPVTDAGLLSAFCDGALLVQASGKTQIEQSQHCRRI
A0A2N3YJR1      MHDLVRELSVD---NIVILDAPPLLPVTDAGVLSASCDGALFVFAVGKTHREQARLAARM
A0A6G8FYB9      MHELVARLTED---HVVILDAPPLLPVTDAGVLAGFCDGTLLVFAVGRTHKEQARLAARM
A0A4Q4D742      MRDLLARVRNEF--DTVIIDAPPMLPVADASILLTEVDGALLLVRHGSTTREQLRLAVER
A0A1C6T1J1      MADLLLGLRESA--DIVIIDTAPLLAVTDGVVVAVQSDGALLVSQQGRTSRTQVAAAARA
A0A2W2CFC8      MADLLLALRESA--DIVIIDTAPLLAVTDGVVVAVQADGALLISQHGRTARTQVAAAARA
A0A2W2A4B0      FTALIEDVAALF--DVVIVDTPPLGSVTDAALVSRAVQNMLLVVASGRVRRAEVSSSIES
A0A4Y9MDA5      MRRLLEAAREEY--DHVVVDTAPVLPVADAAILSRSVDGVLLLANVTRVRRAQLTEALRS
A0A1H7N9P7      MRRLLERLRDDY--DHVVLDTAPVLPVSDAAVLSRSVDGLVVLADVTRVRRAQLSQSLHS
A0A1M7V0F8      MRRLLERLRDEY--DHVVLDTAPVLPVADAAILSRSVDGLLVLANATRVRRPQLTETLRS
A0A520EHH5      AQSLLRDLGRAF--DYVVVDSPPLLPVTDAATLATQCDGTILVTRYGDTRREELTRAAAN
A0A1V8PLV6      MSKLLDTALHTY--DYVIVDTAPMVVANDAAVFGAKSNGIVLVSGRDMTMKRDLKEIAVQ
A0A4R0U4F1      MKALVEQVSGAY--DYVIIDTAPMQVANDAAVFAKEGPELLLVAGLGVTEKKLLRQTGRE
A0A357ZCV8      FAKLVEVLESNF--EYVIFDTPPVGTFVDAAIIGTLVDGVIFVVRPKHTKRKEMAFAYDQ
A0A4R5Z7B0      MEQFIEEAKEQF--DYVLFDTPPLLAVADPQILANKVDASVFVVFSGKTEIDQAKKAKEL
A0A6M8GFV5      MKNLITLMYEQY--DMVLFDAPPLLAVTDAQIISQICEGTILVVRRGYTSKEKIKKAKEL
A0A4R1CW45      FDTLVETMRKHTGEAVVIFDLPPVFANDDAVLSTRALDGYIMVVDSGRTSRRQLADAMEM
A0A419GS64      FRKFIKNASAAY--DTVIIDTPPVGIVSDAAIISTMVDGTILVLDLKGGHRNMSVRAKKT
A0A2V2CXY5      FSHMIESCAKTF--SYVLVDTPPLGSVADALNVAPHCDGTVLVVRSGATPRKLVDNSVQL
A0A2S8MDM2      ARRLLSELRSQY--DYVVVDSTPLLAVTDAAIMAAGADGVLVIARHGSTKKDQLTHAVSS
A0A357ZDL3      FKALVKTLREGF--DYVVFDSPPLGPFVDAAIVGALVDGVVMVVRPRHTKRKDLLFAYDQ
A0A4Y8ZIU8      MRDLLTALAE-T--HMVLVDAPPVLPVTDSTLLSTAVDGTVLVVRHGKARKEHVEVARDM
A0A1I6GVG4      MRELLKSIARE---AIVIIDAPPLIPVTDAAVLAHSADGAIIVGTVGKTTFEVLGKAIGN
A0A1I6IST1      MRELLKSIARE---AIVIIDAPPLIPVTDAAVLAHSADGAIIVGTVGKTTFEVLGKAIGN
A0A412JBM5      MKRFLEASRKAY--DYVIVDTAPINTVADAQILSPLVDGVILVALSQKSTRGELNAAIDS
A0A6J4SUA1      MASLVDLLRTRY--DAILIDSAPLGAGTDAYALGVAAGSVVLVFREGKTDRRMAQAKLGV
A0A1C2B334      ARELFDTLAASY--DYVIVDTPPILPVSDGAVVSQWVPNAILVVRADSTKRPELAAAWQQ
R7Y679          TGQLLDELCELY--DYVLVDSPPVLPVTDAVVVSQWVDGGIIVVRAGGTTRQELVASLAQ
A0A0F0KYJ9      MRELLKSIAR-E--AIVIVDAPPLVPVTDAAVLAHSADGAIIVGTVGKTTYEVLGKAIGN
A0A538BBM6      TARLLGALAEQA--DLVLVDTAPVLPVADTLVVGRFAAGALLVIEARATPVPSISRAKDA
A0A510HHA8      FSALVEEARETF--DYVLIDSPPVEPVADPLILATQADGVLVVLDGQRTRKGSLRKALHD
A0A6G8Q9J3      FSELLGRASREF--DYVLLDAPPLELVSDAAILATQADGVLLAMDAQKTRKIALRRAVRG
A0A5Q2F9A3      MVRLLECATHEY--DAVVIDAPPLLPVTDAAILSGMTTGALLVVGSGEVRAPQLAAALES
A0A4R1BMZ2      FAEFVARVRAEF--DYVLIDAPPVGLVSDPVVISTQGDGVMLVLDAHSTGKGALRKSLHS
A0A023X491      FGALLGDLARRF--EYVLIDVPPVQVVSDAAIVAAQADGVILVFDAQSTRKLSVRRSIRT
A0A6G8QDQ0      FSELLEKAREQF--DYVLLDAPPTAPVSDPAILATQGDGVLLVLDAQKTRKASLRKAKRT
A0A0K8Q3D9      MKNMLQALAQ-N--ATVLIDAPPLLPVTDAAVLSRIADGAIVVIRAGKTTQVELENSLGN
A0A2R7RCA1      MKNMLNALAE-N--AIVLIDAPPLLPVTDAAVLSRAADGAIVVIRTGRTTQEQLAQSLGN
A0A1Q7WJN6      MPRLVASLRPHY--EAIIVDTPPLVAGVDAFVLGTVTGALVLVLRAGMSDRDVATAKLDV
A0A6D1QMN1      FERFVKSVSDAY--DYVIFDAPPVNAVTDPQIIASLTDGTVLVIRSGVTEIEDAQHAVAN
A0A1E2SNF6      MRELLAALSE-L--AVVIVDAPPLLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRT
Q6ADE8          MRELLAALSE-L--AVVIVDAPPLLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRT
A0A1Q7CZ24      LEALLDEARQRY--DYIVLDTPPFVPVPDCRVITKSVDGFLVVVTVHRTPWGVLTEALDL
A0A2W6VLC6      MKQLIAQLSLAY--DVVIIDAPPLLPVSDAAVLAKQTRGALVLVGAGRVTRNQLQESLEG
A0A519G798      AQELFDRVSQMF--DMVIIDGPPLLPVSDAAIMARDVDGAILVVRHGKTTKEQLKQATMR
                                :..*  *     :                               

A0A519GXS6      LQSVRANLAGIVLNNVAVS----RR---------------DSYYYTSDR-----------
A0A6N6NKS9      LKAANARILGSVITFSREE---------------------ANNDYYYVYYNSEGKRVSHK
A0A538BYZ4      MDP--AKILGLVFNGEDRP---------------------LSLYYGG-------------
A0A348NU28      LESAGGRIVGLVLNKVRRK-----------------------------------------
A0A2N4T4Q5      IEHVRGRVLGVVLNHVPTT----GA---------------DAGFYGYY------------
A0A1M3LEY6      LQNVGAHVAGVVLTMLPTR---------------------GPDAYGYG------------
A0A538AJI7      IEALQAPLMGIVANRFKES---------------------SVPYYY--------------
A0A538AM15      VVE-RGKMLGLVFNGGDHA---------------------PASFYGYY------------
A0A022KX11      LETVGAHVSGFARNFVASK---------------------GSDYRYGYH-----------
A0A4Q5A868      LATLDLSANGVIFNCARES---------------------KKSLEYSNY-----------
A0A6N4VXX3      LASVGAAMLGTVFTMMPPR---------------------NHSSYAGSY-----------
A0A1H4I042      LQNVGAALLGSVFVMTPPR---------------------SRSAYGGAY-----------
A0A4R7A6D9      LQNVGAALLGSVFVMTPPR---------------------SRSAYGGAY-----------
A0A345NSU7      LETTGTHVAGFVLTKAPAQ---------------------PS----AYY-----------
A0A0W8I9Y2      LHQVHGNVLGVVLNRVPTT---------------------GADA--GYY-----------
A0A7C6LSF9      LGRFHVPVTGAILVGIQTG---------------------KG----YGY-----------
A0A4Y5YMQ6      LRGVGANLAGLVLNNVREQ---------------------KK----EKY-----------
A0A255G8R8      LGTVDVKVQGVVLNMVRRK---------------------ERGDAYGYY-----------
A0A6G7Y423      LKAGDVATLGVVLNDVTSP---------------------EKGQE-AYY-----------
A0A4Q5APW3      LTTLDLSANGVIFNCARESKKSLEH-----------------------------------
A0A4Q5B0V3      LTTLDLSANGVIFNCARESKKSLEH-----------------------------------
A0A1Q2CRV2      LERVEARVLGLVFNRVKRS---------------------EGEAYGYRH-----------
A0A222TG79      LGRANAAVVGVVLGDAQSR---------------------AGYY----------------
A0A6I3DFP2      LQRAGANVVGVVVNRTEVV---------------------NRSAYYEA------------
A0A2S5WZJ5      IDQVNGRLLGTVLNMVPPR----------------------DTADGYEYRRNRSYYVTAD
K6WHS4          MDTAGVHAMGVVINGTPVR----------------------QSPYRFRY-----------
A0A1L2ZMQ6      LDRVGANKLGVILNQVPTR----G----------------AE-ASRYGY-----------
A0A3L8NYD3      LQQVGGHVLGSVLNRAPLG----GI---------------GGVVYGYG------------
A0A1M6K628      LDNVDAALLGFVMNQVPKK----DL---------------GAAAFGYG------------
A0A561E8R3      LTQVGGRLFGGVMNLTPPK----NM---------------GSAVYGYG------------
A0A3E2DN22      LEQVGAPLLGSVLTRVPRK----KM---------------GDVLYGYGA-----------
A0A3Q9ULZ9      LEQVGAVLLGSVLTRAPRK----AM---------------GDVLYGYGA-----------
A0A3S9JFL2      LEQVGAVLLGSVLTRAPKK----AM---------------GDVLYGYGA-----------
A0A3L7ADK2      IKRGGAHLLGTVLNRVPTS----GQD--------------AH-QYGYYG-----------
A0A1Q2CI19      LARFNIPVVGAVIVGAPLR----K----------------GDIGYGSG------------
A0A512T3M3      LGRFRVPVSGVLLIGTSRS----R----------------GH-GYGYG------------
W6JTW4          LGRFKVPVSGVLLIGSKAS----R----------------SR-SYGYG------------
A0A0A0JTY0      VGRFQVPVSGVLIVGAPTK----R----------------AD-AYGYG------------
A0A0A0JXF2      VGRFQVPVSGVILVGAKAR----R----------------GD-AYGYG------------
E6S8H2          LGRFQVPVAGVVVVGAQSK----R----------------SA-GYGYG------------
A0A0A0JGH0      LGRFQVPISGVVLVGARGR----R----------------AD-GYGHS------------
N0E4U7          LGRFQVPISGVVLVGARGR----R----------------AD-GYGYG------------
A0A0A0IYK2      VGRFQVPVSGVILLGAPEK----R----------------AD-AYGYG------------
A0A0Q9L0H3      VGRFQVPVSGVIIVGAQTM----R----------------AD-AYGYG------------
A3TMK0          VGRFQVPVSGVIIVGAKAK----L----------------GD-TYGYG------------
A0A543PXP1      LGRFNVPVSGVLIVGVRTE------------------------RSTYG------------
A3TMH6          LGRFHVPVTGVVIVGAPTR----G----------------AG-RYGYG------------
A0A1H6WL79      LTRVQGRVLGVILNCVATK----G----------------QG-DLNYGY-----------
A0A101LAM5      LTRVRGRVLGVILNCVATK----G----------------PG-DLNYGY-----------
A0A4Y3NEG0      LTRVRGRVLGVILNCVATN----G----------------PG-DVNYGY-----------
A0A6I2XCV4      LARFGAPVIGTIFNGCSAA----DM---------------EG-YYGYYG-----------
A0A5R8VLL6      IRKVNATILGTLLNCVPAK----EFEG---------------------------------
A0A538JQF8      LVRMGARVLGVVLVGVPTS----R----------------RV-RSPYGR-----------
A0A1H6YPK1      LDRVQGRALGVILDGVAPV----GPRVKH-------------------------------
A0A2R7MGI0      ISKTRGRLLGIVLNRVPLR----GPD--------------SS-YYGARY-----------
A0A2T7WQY4      LSKTRGRLLGIVLNRAPLR----GPD--------------SS-YYGARY-----------
A0A1G6GTN3      IAKTRGHLLGVVLNRMPVR----GVD--------------SG-YYGAQY-----------
A0A1N7DLV3      IAKTRGRLLGVVLNRVPLR----GAD--------------SN-YYGSQY-----------
A0A1V2NSB5      IAKTRGRLLGVVLNRVPLR----GAD--------------SN-YYGSQY-----------
A0A0Q5Q5L3      IAKTRGHLLGVVLNRAPLR----GAD--------------SG-YYGMQY-----------
A0A0Q6DVM4      IAKTRGHLLGVVLNRAPLR----GAD--------------SG-YYGMQY-----------
A0A1R3WWR6      ISKTRGHLLGVVLNRAPLR----GVD--------------ST-YYGGRY-----------
A0A0Q5JKD6      IAKTRGHLLGVVLNRMPLR---------------------GA-DSGYYG-----------
A0A0Q9TBP0      LRQVSVESVGIVYNGVGDS----A----------------RA-TYSYT------------
A0A5Q2FA83      LRTVDAKVAGFALNRMPND---------------------DS-ASRYGG-----------
A0A346XTB0      LKFVSTPLLGYVFNRSDSS----T----------------AG-AYGYG------------
A0A0G3V3M7      LRRLEATTVGVVLVGAEHG----AR---------------AG-YYGY-------------
A0A6I3DD56      LRRLEATTVGIVLVGAEHG----AR---------------AG-YYGY-------------
A0A2W6DK08      LARTRAPAIGVALVGVKGR--------------------------SYRN-----------
A0A2S0LQ32      LGQVDARLLGVVLNRASRR----SMG--------------SV-YYGYG------------
A0A2N6V1R5      FKQVDGRLLGVVLNRASRR----NLG--------------SV-YYGYG------------
G9PHS6          FKQVDGRLLGVVLNRASRR----NLG--------------SV-YYGYG------------
U1PLM7          FKQVDGRLLGVVLNRASRR----NLG--------------SV-YYGYG------------
A0A6I1G2U1      LGRFHVPVTGAILVGTPSR----R----------------SD-GYGYG------------
A0A351ETF8      LATNGSRSLGVVVNRDQES---------------------PD-KYSY-------------
A0A542FTE6      VHRVGGKILGVVLNRVPER---------------------GA-DAQY-------------
A0A349B7N2      LARLSAKVVGVVL---------------------------VG-SGDTPA-----------
A0A2S5UYV0      LSQVHGRLLGTVLNMVPPR---------------------DT-ADG--------------
A0A2S5X9U6      LKQVHSRMLGTVLNMVPPR---------------------DT-ADG--------------
A0A2S5ULV5      LKQVHSRMLGTVLNMVPPR---------------------DS-ADG--------------
A0A653YMF0      LKQVHSRMLGTVLNMVPPR---------------------DS-ADG--------------
A0A346Y185      LDRIGTPVLGYIYTKAKLD----G----------------AG-YGDYA------------
A0A259S8H9      LEQVRARVLGVVLNLVSLR----G----------------GD--NGYG------------
A0A0Q5L115      VTRGGGDVLGVVLNRVPTK----G----------------RD-AREYG------------
A0A2W1Z497      VARGGGTVLGAVLNRVPTR----G----------------QD-ARDYG------------
A0A4V1VGV9      LEQVGAHYYGSILNMTPPK----QMGSTIYGYGAGNYG--GA-TYG--------------
A0A3Q9IY80      LERAGSRALGVVLNRVPRK---------------------GR-G-GY-------------
A0A0F0LP73      LAQIRARILGVVLNFVAMR---------------------NS-ANG--------------
A0A1F1X071      IRAVNGTVYGAVLNRASTG----RLNRLAYG---------DA-VYGYSA-----------
A0A3R8RWC7      IRAVNGTAYGAVLNRASTG----RLNRLAYG---------DA-VYGYSA-----------
A0A4U0RJZ4      LDQVGAHYFGSILNMTPPR----SMGSTVYGYGAGNYATAGY-GYGYG------------
A0A4R1FGL9      LDQVGAHYFGSILNMTPPR----SMGSTVYGYGAGNYATAGY-GYGYG------------
E3B8H1          LDQVGAHYFGSILNMTPPR----SMGSTVYGYGAGNYATAGY-GYGYG------------
A0A7D7WDT9      LEQVNARVLGVVLNLVSLN----G----------------AD-GYGYG------------
A0A0Q5AWK6      LAQVRGRVLGTVLNMVTAQ----D----------------GD-T-GY-------------
A0A6P1F176      VQQVHGRVLGTVLNMVSAQ----D----------------GD-A-GYS------------
A0A3N1NLD3      VQQVRGRVLGTVLNMVSAQ----D----------------GD-A-GYS------------
A0A3N2FVI8      VQQVRGRVLGTVLNMVSAQ----D----------------GD-A-GYS------------
A0A2S5XDQ6      VQQVRARVLGTVLNMVTAR----D----------------GD-T-GY-------------
A0A2S5XNN6      VQQVRARVLGTVLNMVTAR----D----------------GD-T-GY-------------
A0A4Q4D4T1      ITTVGGRLLGTIISMSPKK----ET---------------ARYGYGYGY-----------
A0A261FE22      FKVSRVKISGVAFNRVAHE----RS---------------RKGNYYYYE-----------
A0A5C8C085      IKAVNGTTLGIVFNGVAAR----DA---------------YTSAYYYSQ-----------
A0A1E4BP96      IAKVNGRLLGVVLNKATRR---------------------GRPDYGYAY-----------
A0A439DNZ6      LRSVGAPILGAVFTITPTR----GG---------------ASDNYSYYG-----------
A0A0J6YE86      LESVGAPLLGAVFTMVPTR----GT---------------GSYSYNYGY-----------
A0A5Q5BFU2      LESVGAALLGAVFTMIPTR----NN---------------ASYSYGYYG-----------
A0A151BT98      LETVDANLSGTVLNYADHF----------------------SDDYGYGS-----------
A0A2Y8ZRF8      LETVDANLSGTVLNYADSF----------------------SDDYGYGH-----------
A0A2R9UAT1      LERAGGRALGVVLNRVPRS----GG---------------GYYDYRYTG-----------
A0A4Q5J5D7      LDAVRGRALGVILNRVARR----DA---------------AAGYYGGTY-----------
A0A1Y4CKD6      LDGERASVLGYVLNGCPQTAGSYGY---------------GYGRYGYGK-----------
A0A3S0V9U6      IDKVQGNVLGAVMNMAPAK----GI---------------GSQYYGFGY-----------
A0A1S2N0P2      LGRVNGHLLGTVMNMTPEK----GL---------------GSHYYGFGY-----------
A0A0Q3BEY5      LGRVNGHLLGTVMNMTPEK----GL---------------GSHYYGFGY-----------
A0A4R6Q3C6      LGRVNGHLLGTVMNMTPEK----GL---------------GSHYYGFGY-----------
A0A2X3GKL3      LGRVNGHLLGTVMNMTPEK----GL---------------GSHYYGFGY-----------
A0A0Q7KBQ4      IETVGGKLFGTILNRTPRR----AG---------------DVYGYGYGY-----------
A0A1F1IHY9      IRKIDGEVLGAVLNRVPAS----GT---------------AASAYQY-------------
A0A542HCT5      LAAVNGHTLGVVLNRVSPK----SS---------------SAGYYSGSY-----------
A0A2S8WHZ8      LKKVDANILGAILNQVPTK----GA---------------GAAQYGY-Y-----------
A0A537WNY9      LSVISVRPTAVVLNDAPIG----D-----------------SSYYHMGP-----------
A0A5B8M469      LEQAKSRLLGVVLNKVPVN----DR---------------DGGYSYYHN-----------
A0A1Y4CTD2      AWKSAGDFSGFVLN--AFQ----GE---------------WSLTHGRGY-----------
A0A0Q5M6Z7      VVRVNGKVLGVVLNKIPPR----GI---------------DSHDYGYYR-----------
A0A3N3ZPU0      LHTVGATILGAVLNQVPRK----GS---------------GANEYGYYS-----------
A0A359IQX7      LKQVNGRLLGSVMNLAPLR----GI---------------GAVVYGYGY-----------
A0A433EDP2      LNKVNANLFGLVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A231VTW0      LNKVNANLFGLVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A433ECD0      LNKVNANLFGLVLNRAPRK----GL---------------GNSYYGFGY-----------
U7V3Z1          LNKVNANLFGLVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1F1J417      LERVNSHLFGVVLNKAPRK----GL---------------GNSYYGFGY-----------
A0A2A8D6P2      LERVNSHLFGVVLNKAPRK----GL---------------GNSYYGFGY-----------
A0A1F0THV9      LERVNSHLFGVVLNKAPRK----GL---------------GNSYYGFGY-----------
A0A5F0M6Y0      LERVNSHLFGVVLNKAPRK----GL---------------GNSYYGFGY-----------
D8USQ4          LERVNSHLFGVVLNKAPRK----GL---------------GNSYYGFGY-----------
E3H5W1          LERVNSHLFGVVLNKAPRK----GL---------------GNSYYGFGY-----------
A0A1F1QKB0      LERVNSHLFGVVLNKAPRK----GL---------------GNSYYGFGY-----------
A0A509JY23      LERVNSHLFGVVLNKAPRK----GL---------------GNSYYGFGY-----------
A0A448USF4      LERVNSHLFGVVLNKAPRK----GL---------------GNSYYGFGY-----------
A0A0Q9LZR0      LATVNGHTLGVVLNRVSPK----SS---------------SAGYYSGNY-----------
A0A1N7E3F1      LSSINARLVGTVLNFVPAK----HG---------------SY--YGYGY-----------
A0A544ZKQ1      LSSINARLVGTVLNFVPAK----HG---------------SYYGYGYGY-----------
A0A372P1T1      LSSINARLVGTVLNFVPAK----HG---------------SYYGYGYGY-----------
A0A5D0Q2X0      LSSINARLVGTVLNFVPAK----HG---------------SY--YGYGY-----------
A0A5R8Z2E7      LSSINARLVGTVLNFVPAK----HG---------------SY--YGYGY-----------
A0A1L2ZMV4      LDRVNGHVLGVVLNQVPRK----GS---------------SAGQYGYYS-----------
A0A6I3F378      FDRIGSPVLGIVLNGLDRK----HT---------------RYGYGAYGY-----------
A0A1E9T6I0      LKKVNANLFGLVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1S1CQC5      LKKVNANLFGLVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1S1CAD0      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
G5ET14          LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1E9DXX2      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1E8S156      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1E8S5S2      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1S1DFA8      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A2I1Z490      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1F0DAA9      LKKVNANLFGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1F0PHK9      LKKVNANLFGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1F0VZG6      LKKVNANLFGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1E9G8X4      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1E9IAW2      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1E9ZBC9      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1E9ZDP4      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1F0R6B5      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1F0Z7N5      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1F1D897      LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
D2NP38          LKKVNANLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1F1FV74      LKKVNANLFGLVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1E9M791      LKKVNANLFGLVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A291DEI8      LKKVNANLFGLVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1S1D5T1      LKKVNANLFGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1E8TRD6      LKKVNANLFGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1F0XT88      LKKVNANLFGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1F1EVP5      LKKVNANLFGMVLNRAPRK----GL---------------GNSYYGFGY-----------
C6R548          LKKVNANLFGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A0K2RXS2      LKKVNAKLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A1F0KX60      LKKVNAKLLGMVLNRAPRK----GL---------------GNSYYGFGY-----------
A0A542I3V2      LQKVQAPVLGAIFNCVPTK----GV---------------DSYAYYGAY-----------
A0A2T0UZ65      IQQVGGRILGIVLNMAPKR----GM---------------GSVMYGDGY-----------
A0A1R4JTI6      LEKVNGDVLGTVLNRVPTR----GK---------------EAGYYGYYG-----------
A0A4R7TM52      LDRAGARCLGVVINRVPVR----GR---------------GKGYDEYRY-----------
A0A542XE74      LDQTKARLLGVVLNAASKR----SL---------------TDSAYS--Y-----------
A0A0G3V3F3      LQRAGANVVGVVVNRTEVV----NR---------------SAYYEA--------------
A0A0Q7QDF6      ITTVGGRLLGTIISMSPKK----ET---------------ARYGYGYGY-----------
A0A5R8L819      IEKVGGRALGVVLNRVPKR----GG---------------GYYGGHYGR-----------
A0A261FQA1      FELVGVKPAGAVVDMVKEQ----RG---------------KGDYYYSDK-----------
A0A1Q2CJ92      LRQVDGNLLGVVLNKVAKK----DL---------------GEATFGYGY-----------
A0A2T0S3C8      LQSVDARLLGCVFNMVSAK----GP---------------E----GYYY-----------
A0A4Y8WZJ3      IRKIDGEVLGAVLNRVPAS----GT---------------AASAYQY-------------
A0A285VUW0      LEAAEAEVSGFVLTKTPAE----RS---------------GS--YNYQY-----------
A0A2R7Z032      LDQVGSRLLGIVLNKAPLK----GV---------------GAIAYGDGY-----------
A0A6J4MTQ2      LDQVGGRLLGVVLNKAPVR----GV---------------SAVAYGYGY-----------
A0A1I0W453      LDQVGSRLLGVVLNKAPVK----GA---------------SAIAYGGGY-----------
A0A1H4LCS9      LDQVGGRLLGVVLNKAPIK----GA---------------AAIAYGGGY-----------
A0A4Q2RZP8      LDQVGSRLLGVVLNKAPVK----GA---------------AAIAYGGGY-----------
A0A0Q6VV12      LDQVGSRLLGVVLNKAPVK----GA---------------SAIAYGGGY-----------
A0A495NTA9      LDQVGSRLLGVVLNKAPVK----GA---------------TAIAY-GGY-----------
A0A0Q9QB08      LDQVGSRLLGVVLNKAPVK----GA---------------ASIAYGGGY-----------
A0A4Q2SA86      LDQVGSRLLGVVLNKAPVK----GA---------------AAIAYGGG------------
A0A4Z1C3Z0      LDQVGSRLLGVVLNKAPVK----GA---------------AAIAYGGG------------
A0A542J310      LRKARGRALGVVLNKVPMR----GT---------------DSATYSYEY-----------
A0A4Q2JUT1      LRKARGRALGIVLNKAPIR----GA---------------DAATYSYEY-----------
A0A6L5R0V7      LRKARGRALGIVLNKAPIR----GA---------------DAATYSYEY-----------
A0A444BL03      MGQVGGRVLGVVLNMAPKR----RA---------------GGVMYGYGY-----------
A0A4Y8X357      LARVHARVLGVVLNGVPAS----GV---------------GSDYYGGGL-----------
R4LD52          LQSVDARLLGCVLNMVAAK----GP---------------DAY---HYY-----------
A0A4T2CD79      ISMGGGRTLGVVLNRVPTK----GA---------------GGRGYGYYH-----------
A0A6L6AM03      LDQVGSRLLGVVLNKAPVK----GA---------------AAIAYGGGY-----------
A0A4Q2RU39      LDQVGSRLLGVVLNKAPVK----GA---------------NAIVYG--------------
A0A4Q2SK58      LDQVGSRLLGVVLNKAPIK----GA---------------NAIVYGGGY-----------
A0A2N3YJR1      MGQVGGRVLGVVLNLAPKG----RA---------------GAVMYGYGY-----------
A0A6G8FYB9      MSQVGGRVLGVVLNLAPQR----KV---------------GGVVYG-GY-----------
A0A4Q4D742      VETVGGQLFGCVLNRTPRR----AS---------------DDA---YGY-----------
A0A1C6T1J1      LHAVSVRLLGCVLNMAKVP----KA----------------DA---YQY-----------
A0A2W2CFC8      LNAVSVRLLGCVLNMAKLA----KA----------------EA---YQY-----------
A0A2W2A4B0      LATVGASVQGVVVTMARSR----GA---------------RDA---YAV-----------
A0A4Y9MDA5      LAQVEAGVQGVVLNQVHRE----A-----------------DV---YGY-----------
A0A1H7N9P7      LAQVQATVLGVVLNQVRRE----A-----------------EV---YGY-----------
A0A1M7V0F8      LAQVGGTVLGVVLNQVRRD----E-----------------DV---YGY-----------
A0A520EHH5      LENVGASLLGVVMSMVPAT----GR---------------GRDQYGYDF-----------
A0A1V8PLV6      LDNLNVPVMGFVFNFAKER----KV---------------SANGNYYYY-----------
A0A4R0U4F1      LSTLSIDPVGLAMNYGETE----KP---------------Q--KGGYYY-----------
A0A357ZCV8      LGKADVHILGACANYRESV----AS---------------ESYYAYYSA-----------
A0A4R5Z7B0      LENAQSKLVGVVLNHKEVK----SN---------------D----YYYY-----------
A0A6M8GFV5      LTLVNANILGVVLNRAEQE----KD---------------G----YYYY-----------
A0A4R1CW45      LNPVPC--LGTVLNRYAGG----ML---------------DSYGYGSAN-----------
A0A419GS64      LEKVNANILGLVMNNLKID----KD---------------ARPYQY--------------
A0A2V2CXY5      LKRTETPLLGIVLNRADMN----SK---------------SNMYYHRYY-----------
A0A2S8MDM2      LHSVGAPVLGAVFTMMPTR----GS---------------SSYGYSYSY-----------
A0A357ZDL3      LKKSESRILGACASYNDRA----SA---------------DSYYAYYTV-----------
A0A4Y8ZIU8      LAGVNARVLGVVLNGTPAS----GV---------------GSDYYGGGY-----------
A0A1I6GVG4      LERAGARALGLVLNKVPRR----GS---------------GAAYYGYQY-----------
A0A1I6IST1      LERAGARALGLVLNKVPRR----GS---------------GAAYYGYQY-----------
A0A412JBM5      VSRAGGNLCGVVINGMDMK----AT---------------K---YSYRY-----------
A0A6J4SUA1      LDRLPVHMLGAVLNCVPAS----GG---------------A---YQYYS-----------
A0A1C2B334      WKATNVRLVGVVVNDASDR----AG---------------A---YHNTY-----------
R7Y679          LHASRVSILGVVLNGVNLK----AR---------------D---NRYGY-----------
A0A0F0KYJ9      LERAGARALGLVLNKVPRR----GS---------------GAAYYGYQY-----------
A0A538BBM6      LTRNQTRILGLVLNRLKAQ----DS---------------G--Y-SYGY-----------
A0A510HHA8      LRSVKANVLGTVMNNFDGG----RG---------------G--YAYH-------------
A0A6G8Q9J3      LQLVGANVLGVVVNNVEDS----GE---------------G--YPL--------------
A0A5Q2F9A3      LESVEGRLLGIVLNKLRGK----DV---------------G--YSAYRN-----------
A0A4R1BMZ2      LEAVGANIIGTVMNNVRGG----KG---------------G--YYRYGY-----------
A0A023X491      IESVGAKVLGTVMNNARPA----RN---------------G--T----Y-----------
A0A6G8QDQ0      LDAVGASVLGTVMNNVKGG----QK---------------G--L----Y-----------
A0A0K8Q3D9      LQKVRGRVLGAVLNYVPTK----GT---------------D--AYAY-------------
A0A2R7RCA1      LDKVKGRILGAVLNYVPTK----GT---------------D--AYSY-------------
A0A1Q7WJN6      LDRLPVRLLGAVVNDVRS------------------------------------------
A0A6D1QMN1      LKKVEAHLLGTVLNDRAVE----KS---------------N--YYYYYT-----------
A0A1E2SNF6      LDQAAGKLTGVVLNRVPRR----GA---------------D--AVNYGY-----------
Q6ADE8          LDQAAGKLTGVVLNRVPRR----GA---------------D--AVNYGY-----------
A0A1Q7CZ24      IDP--AKVVGLVVNGDDTR----RS---------------S--YYDVY------------
A0A2W6VLC6      LRAVGATVAGVVLSMAPTR----GP---------------D--AYGYG------------
A0A519G798      LEQVDANLLGVMVNMTPKR----GG---------------K--GYGYG------------
                         .                                                  

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      DREKQLMENPNARDLAADDIGQWARKAGIDPKQAE-------------------------
A0A538BYZ4      ----------------AEYYGEADGRLARGAGIAR-------------------------
A0A348NU28      ----------------------RKESAYYTANTDA-------------------------
A0A2N4T4Q5      ----------------GKSYYASDDSGGDAPEAPL-------------------------
A0A1M3LEY6      ----------------RYGYGAYGYGYGYGRTAQA-------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ----------------GY---------------YG-------------------------
A0A022KX11      ----------------RYEEEMTRRARKAARTEPR-------------------------
A0A4Q5A868      ----------------YYYYSDSNKKRSKKGRFSL-------------------------
A0A6N4VXX3      ----------------YYY---YGKSRRDTRTS---------------------------
A0A1H4I042      ----------------YYYGDNRGSNSRHSRKT---------------------------
A0A4R7A6D9      ----------------YYYGDKRGSNSRHSHKT---------------------------
A0A345NSU7      ----------------SYYGGEHASTRPDGPRKRK-------------------------
A0A0W8I9Y2      ----------------GY-YGKSYYANSDDQPAPK-------------------------
A0A7C6LSF9      ----------------GYGYGSASDDPAAQRRASR-------------------------
A0A4Y5YMQ6      ----------------LYTMEP--------------------------------------
A0A255G8R8      ----------------AYGSEP--------------------------------------
A0A6G7Y423      ----------------GRDHRPAGPGAAGARRARR-------------------------
A0A4Q5APW3      ----------------SNYYYYYSDSSKKGRFSLK-------------------------
A0A4Q5B0V3      ----------------GNYYYYYSDSSKKGRFSLK-------------------------
A0A1Q2CRV2      -----------------SYYSDHPRAAPKKGDRKS-------------------------
A0A222TG79      ----------------ANSYALEYGQVGVRDSAER-------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A2S5WZJ5      RKGMPVMKSIKRGHEQPEAFAVQTDASAAQTPQPT-------------------------
K6WHS4          -------------------YGVNVENNA--------------------------------
A0A1L2ZMQ6      ----------------YGKYYSKKETKAKAAADLQ-------------------------
A0A3L8NYD3      -------------------HATHS-QDYYSAYDRT-------------------------
A0A1M6K628      -------------------YSGAS-PRYYYAEDDG-------------------------
A0A561E8R3      -------------------YSGKKYNGYGYGYGDS-------------------------
A0A3E2DN22      ----------------AN-YGYGSYYGDYGKRG---------------------------
A0A3Q9ULZ9      ----------------GS-FGYSSYNSYYTDKNGK-------------------------
A0A3S9JFL2      ----------------GS-FGYSSYNAYYTDENGK-------------------------
A0A3L7ADK2      ----------------GTYYANEETPATTATAQPS-------------------------
A0A1Q2CI19      -------------------YGYGYGETKGKAKGKR-------------------------
A0A512T3M3      -------------------YGYGESGRRRSEKPVD-------------------------
W6JTW4          -------------------YGYG-SPRSTSKKPRS-------------------------
A0A0A0JTY0      -------------------YGDDRMSKRKAKRARK-------------------------
A0A0A0JXF2      -------------------YGETRKAKKKVKRERK-------------------------
E6S8H2          -------------------YGYGYG-----------------------------------
A0A0A0JGH0      -------------------YGYGDTARPQRDSPSP-------------------------
N0E4U7          -------------------YGHGDT-KKRKGARSA-------------------------
A0A0A0IYK2      -------------------YGENRQSKRKAKRARK-------------------------
A0A0Q9L0H3      -------------------YGENRQSKKKARRGRK-------------------------
A3TMK0          -------------------YGDARKTKKKVKRGRR-------------------------
A0A543PXP1      -------------------YGRGYGYGYGVSKQKR-------------------------
A3TMH6          -------------------YGSGYGQGYDAERSKG-------------------------
A0A1H6WL79      ----------------YGAYVSADESRDTIPPRSG-------------------------
A0A101LAM5      ----------------YGAYGSAEDLKDHQPPAPS-------------------------
A0A4Y3NEG0      ----------------YGAYGSAENPQDDTPPVPG-------------------------
A0A6I2XCV4      ----------------AGYYGSGYYGSGYYGSGYY-------------------------
A0A5R8VLL6      -------------------YSYYSPE----------------------------------
A0A538JQF8      ----------------PPQYQLNLPSWKSPAGGGI-------------------------
A0A1H6YPK1      -------------------YGYGNTSPGLSSLGGAPAQHDEDDSWEHDEALRKVFPEDVL
A0A2R7MGI0      ----------------GGHYGYGESHA-TGAEGIK-------------------------
A0A2T7WQY4      ----------------GGAYGYSEPDA-DTRKGAK-------------------------
A0A1G6GTN3      ----------------GGYYGYGAERS--STKAWW-------------------------
A0A1N7DLV3      ----------------GGYYGYGAPSSGVDRPRWW-------------------------
A0A1V2NSB5      ----------------GGYYGYGAPGSGAERTRWW-------------------------
A0A0Q5Q5L3      ----------------GGYYGYGIGRT--EKSTWW-------------------------
A0A0Q6DVM4      ----------------GGYYGYGIGRT--EKSTWW-------------------------
A0A1R3WWR6      ----------------GGYYGYGAPRG--TTRSWW-------------------------
A0A0Q5JKD6      ----------------SQYGGYYGYGVPSSSPNGRWRLGLR-------------------
A0A0Q9TBP0      ------------------------------------------------------------
A0A5Q2FA83      ----------------YYAYGRSKKDK---------------------------------
A0A346XTB0      -------------------YGVAED-----------------------------------
A0A0G3V3M7      -------------------YGYYGYGYGYAHPGEVPKMSRLFPW----------------
A0A6I3DD56      -------------------YGYYGYGYGYAHPGEVPKMSRLFPW----------------
A0A2W6DK08      ----------------LMSYSNGSRGSDRDARFAA-------------------------
A0A2S0LQ32      -------------------YGSYGHHYYYGERPRGWRRL----LPG--------------
A0A2N6V1R5      -------------------YGGYGQNYYYYEEDEKRKLLGFIPLPGHRKRKRENQIVSIQ
G9PHS6          -------------------YGGYGQNYYYYEEDEKRKLLGFIPLPGHRKRKRENQIVSIQ
U1PLM7          -------------------YGGYGQNYYYYEEDEKRKLLGFIPLPGHRKRKRENQIVSIQ
A0A6I1G2U1      -------------------YGSASEDPAAKASGRR-------------------------
A0A351ETF8      -------------------YGQYAEQTAETADA---------------------------
A0A542FTE6      -------------------YGYYGQKAYYTPTQRP-------------------------
A0A349B7N2      ----------------TKRYYYSKDPTSE-------------------------------
A0A2S5UYV0      -------------------YEYRRNRSYYVTADKK-------------------------
A0A2S5X9U6      -------------------YEYRRNRSYYVTADKK-------------------------
A0A2S5ULV5      -------------------YEYRRNRSYYVTADKK-------------------------
A0A653YMF0      -------------------YEYRRNRSYYVTADKK-------------------------
A0A346Y185      -------------------YRY-GYSYAYGYGE---------------------------
A0A259S8H9      -------------------YYRKNSRYYMKSHRAA-------------------------
A0A0Q5L115      -------------------YF--GGSYYYYEGD---------------------------
A0A2W1Z497      -------------------YY--GGAYYAGDDDGS-------------------------
A0A4V1VGV9      -------------------YGYGSSEDPSAATAPT-------------------------
A0A3Q9IY80      -------------------HDYRYAGDYYRSKGGE-------------------------
A0A0F0LP73      -------------------YGYYRKNSHYYAQTSR-------------------------
A0A1F1X071      ----------------YGKYGYGALGGYDESAVVP-------------------------
A0A3R8RWC7      ----------------YGKYGYGALGGYDESAVVP-------------------------
A0A4U0RJZ4      -------------------YGYGHTDESDEASALT-------------------------
A0A4R1FGL9      -------------------YGYGHTDESDEASALT-------------------------
E3B8H1          -------------------YGYGHTDESDEASALT-------------------------
A0A7D7WDT9      -------------------YGYRQNRNYYVTPK-G-------------------------
A0A0Q5AWK6      -------------------YYYDRKNSYYTQPQQA-------------------------
A0A6P1F176      -------------------YYYDRKNPYYAEPDAG-------------------------
A0A3N1NLD3      -------------------YYYDRKNPYYAEPDGG-------------------------
A0A3N2FVI8      -------------------YYYDRKNPYYAEPDGG-------------------------
A0A2S5XDQ6      -------------------YYYDRKNAYYAEPQPA-------------------------
A0A2S5XNN6      -------------------YYYDRKNAYYAEPQPA-------------------------
A0A4Q4D4T1      ----------------D--------------DGKG-------------------------
A0A261FE22      ----------------ESETKAKKSSKRSSRKASA-------------------------
A0A5C8C085      ----------------DADPSAKKRPKADKEPKPK-------------------------
A0A1E4BP96      ----------------GSGAADTRPAFVPR------------------------------
A0A439DNZ6      ----------------YSYGD----------GTSN-------------------------
A0A0J6YE86      ----------------YGEDEGRRGGNSSTRGGSA-------------------------
A0A5Q5BFU2      ----------------YGEEA---TGQQARHGLPT-------------------------
A0A151BT98      ----------------KYGYGEQEMAASGRTRSRR-------------------------
A0A2Y8ZRF8      ----------------KYGYGEQPPAARG--QSRR-------------------------
A0A2R9UAT1      ----------------DYYQADQTPYDEAVHNPPN-------------------------
A0A4Q5J5D7      ----------------ELSDKDKVPAAVGATDEAD-------------------------
A0A1Y4CKD6      ----------------YGYGSYGDGYGGLADEVDE-------------------------
A0A3S0V9U6      ----------------GGYRSEYKSYYGRSGQGSE-------------------------
A0A1S2N0P2      ----------------GGYRSGYQAYYGQDGEGSG-------------------------
A0A0Q3BEY5      ----------------GGYRSGYQAYYGQDGEGSG-------------------------
A0A4R6Q3C6      ----------------GGYRSGYQAYYGQDGEGSG-------------------------
A0A2X3GKL3      ----------------GGYRSGYQAYYGQDGEGSG-------------------------
A0A0Q7KBQ4      ----------------GYGQEQHEPIGEQARRMVG-------------------------
A0A1F1IHY9      ---------------------YGATYYTASQQQDV-------------------------
A0A542HCT5      ----------------AALEEHSKQQQTHEPAGR--------------------------
A0A2S8WHZ8      ----------------GKYYYSNTEQDPKADAKPS-------------------------
A0A537WNY9      ----------------EKTSMPRRGRRSSERLASR-------------------------
A0A5B8M469      ----------------NRSYYTRPESGKRRRDAAK-------------------------
A0A1Y4CTD2      ----------------SAY-----------------------------------------
A0A0Q5M6Z7      ----------------SNYYTSNADESGEAQPVAS-------------------------
A0A3N3ZPU0      ----------------DAYYYSSSSRH---------------------------------
A0A359IQX7      ----------------GT-YTYSSKYYRYARDTAQ-------------------------
A0A433EDP2      ----------------ANSYVGYATYYGYSKDGTK-------------------------
A0A231VTW0      ----------------ANSYVGYATYYGYSKDGTK-------------------------
A0A433ECD0      ----------------ANSYVGYATYYGYSKDGTK-------------------------
U7V3Z1          ----------------ANSYVGYATYYGYSKDGTK-------------------------
A0A1F1J417      ----------------ANSYVGYASYYGYSKDGKK-------------------------
A0A2A8D6P2      ----------------ANSYVGYASYYGYSKDGKK-------------------------
A0A1F0THV9      ----------------ANSYVGYASYYGYSKDGKK-------------------------
A0A5F0M6Y0      ----------------ANSYVGYASYYGYSKDGKK-------------------------
D8USQ4          ----------------ANSYVGYASYYGYSKDGKK-------------------------
E3H5W1          ----------------ANSYVGYASYYGYSKDGKK-------------------------
A0A1F1QKB0      ----------------ANSYVGYASYYGYSKDGKK-------------------------
A0A509JY23      ----------------ANSYVGYASYYGYSKDGKK-------------------------
A0A448USF4      ----------------ANSYVGYASYYGYSKDGKK-------------------------
A0A0Q9LZR0      ----------------GPLQE--TPQRAVRSEAGT-------------------------
A0A1N7E3F1      ----------------GYEADPVEQETSSRTPQPQ-------------------------
A0A544ZKQ1      ----------------GYGYDSAAQETVSETPQPQ-------------------------
A0A372P1T1      ----------------GYGYDAAAQEATPETPQPQ-------------------------
A0A5D0Q2X0      ----------------GYGYDAAAQEATPETPQPQ-------------------------
A0A5R8Z2E7      ----------------GYGYDAAAQEATPETPQPQ-------------------------
A0A1L2ZMV4      ----------------DSYYYTSTDGQRTRRQSGK-------------------------
A0A6I3F378      ----------------DASK----------------------------------------
A0A1E9T6I0      ----------------ASTYVGYATYYGYGKDGDK-------------------------
A0A1S1CQC5      ----------------ASTYVGYATYYGYGKDGDK-------------------------
A0A1S1CAD0      ----------------ASAYVGYATYYGYGKEGDK-------------------------
G5ET14          ----------------ASAYVGYATYYGYGKEGDK-------------------------
A0A1E9DXX2      ----------------ASAYVGYATYYGYGKEGDK-------------------------
A0A1E8S156      ----------------ASAYVGYATYYGYGKEGDK-------------------------
A0A1E8S5S2      ----------------ASAYVGYATYYGYGKEGDK-------------------------
A0A1S1DFA8      ----------------ASAYVGYATYYGYGKEGDK-------------------------
A0A2I1Z490      ----------------ASAYVGYATYYGYGKEGDK-------------------------
A0A1F0DAA9      ----------------ASAYVGYATYYGYGKEGDK-------------------------
A0A1F0PHK9      ----------------ASAYVGYATYYGYGKEGDK-------------------------
A0A1F0VZG6      ----------------ASAYVGYATYYGYGKEGDK-------------------------
A0A1E9G8X4      ----------------ASAYVGYATYYGYGKDGDK-------------------------
A0A1E9IAW2      ----------------ASAYVGYATYYGYGKDGDK-------------------------
A0A1E9ZBC9      ----------------ASAYVGYATYYGYGKDGDK-------------------------
A0A1E9ZDP4      ----------------ASAYVGYATYYGYGKDGDK-------------------------
A0A1F0R6B5      ----------------ASAYVGYATYYGYGKDGDK-------------------------
A0A1F0Z7N5      ----------------ASAYVGYATYYGYGKDGDK-------------------------
A0A1F1D897      ----------------ASAYVGYATYYGYGKDGDK-------------------------
D2NP38          ----------------ASAYVGYATYYGYGKDGDK-------------------------
A0A1F1FV74      ----------------ASTYVGYATYYGYGKDGDK-------------------------
A0A1E9M791      ----------------ASTYVGYATYYGYGKDGDK-------------------------
A0A291DEI8      ----------------ASTYVGYATYYGYGKDGDK-------------------------
A0A1S1D5T1      ----------------ASSYVGYSTYYGYGKDGDK-------------------------
A0A1E8TRD6      ----------------ASSYVGYSTYYGYSKDGDK-------------------------
A0A1F0XT88      ----------------ASSYVGYSTYYGYSKDGDK-------------------------
A0A1F1EVP5      ----------------ASSYVGYSTYYGYSKDGDK-------------------------
C6R548          ----------------ASSYVGYSTYYGYGKDGDK-------------------------
A0A0K2RXS2      ----------------ASAYVGYATYYGYSKDGDK-------------------------
A0A1F0KX60      ----------------ASAYVGYATYYGYGKEGDK-------------------------
A0A542I3V2      ----------------TAAPEAASSGSADRDVERD-------------------------
A0A2T0UZ65      ----------------STYYSHGSYEYYKSGPKKG-------------------------
A0A1R4JTI6      ----------------KSYYSSSATPDQDFDVTSR-------------------------
A0A4R7TM52      ----------------SGDYYAAPAATTVPLDSPG-------------------------
A0A542XE74      ----------------TGYTGYYKDYYAAAEPEQQ-------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ----------------DD------------------------------------------
A0A5R8L819      ----------------EYYASAEVQAVSAVPAVTP-------------------------
A0A261FQA1      ----------------AAKHSSQGTSEKSHEPTEK-------------------------
A0A1Q2CJ92      ----------------GSYTS--KYYRTDEAQKPH-------------------------
A0A2T0S3C8      ----------------EQYGMTSQHRRGAWRDRMR-------------------------
A0A4Y8WZJ3      ---------------------YGATYYTASQQQDV-------------------------
A0A285VUW0      ----------------YGRETPVTAGETRGSRRQS-------------------------
A0A2R7Z032      ----------------G-YGGY-GA-QAEYASREA-------------------------
A0A6J4MTQ2      ----------------ASYGSY-GAYKAEQKTAEA-------------------------
A0A1I0W453      ----------------GGYGGY-GGYRAEYTSREA-------------------------
A0A1H4LCS9      ----------------GGYGGY-GGYKSEYASREA-------------------------
A0A4Q2RZP8      ----------------GGYGGY-GGYKAEYASREA-------------------------
A0A0Q6VV12      ----------------SGYGGY-GGYRAEEATREA-------------------------
A0A495NTA9      ----------------GGYGGY-GGYKAEEETREK-------------------------
A0A0Q9QB08      ----------------GTYGGY-GGYEADDTSREA-------------------------
A0A4Q2SA86      ------------------YGGY-GGYQAEYASQEA-------------------------
A0A4Z1C3Z0      ------------------YGGY-GGYQAEYASLEA-------------------------
A0A542J310      ----------------RHDYTT---------PATE-------------------------
A0A4Q2JUT1      ----------------RRDYTSSGSEGTT--EASP-------------------------
A0A6L5R0V7      ----------------RRDYTSSSGPEAQPEEGAG-------------------------
A0A444BL03      ----------------GGYASYASDTKTRKDYAKA-------------------------
A0A4Y8X357      ----------------GSHEDEYHAYYRAPAESRK-------------------------
R4LD52          ----------------DEYSTRGRGSRRAGPVAPV-------------------------
A0A4T2CD79      ----------------GSYSEDAPVVGALIANGRL-------------------------
A0A6L6AM03      ----------------GSYGGY-GGYKAEYASREA-------------------------
A0A4Q2RU39      ----------------GGYGGYGGGYKSEYKSVEV-------------------------
A0A4Q2SK58      ----------------GGYGGYGGGYKSEYKSREA-------------------------
A0A2N3YJR1      ----------------GGYATYASDTKSRRDYEKA-------------------------
A0A6G8FYB9      -----------------GYSSYSSDYASRKAYDTA-------------------------
A0A4Q4D742      ----------------GYGHGYGYGSALPQAVRPE-------------------------
A0A1C6T1J1      ----------------EAYRVVAGLGTPSVPADRA-------------------------
A0A2W2CFC8      ----------------EAYQVL----SSSLPVDRA-------------------------
A0A2W2A4B0      ----------------YGADVPPETQRSHRSAVPG-------------------------
A0A4Y9MDA5      ----------------AADAAAEARRPLPAARVPA-------------------------
A0A1H7N9P7      ----------------AADVVAGTDRPVPTAPAPL-------------------------
A0A1M7V0F8      ----------------AAEAQPPA-RVGELPAVPV-------------------------
A0A520EHH5      ----------------EPGRVPTPPTQSAPVRTNR-------------------------
A0A1V8PLV6      ----------------YDEGGKKSRKKSKHKS----------------------------
A0A4R0U4F1      ----------------YGDESDDNGRKRQIQHKKS-------------------------
A0A357ZCV8      ----------------DGKRVKDRPAADAASQL---------------------------
A0A4R5Z7B0      ----------------YGAK----------------------------------------
A0A6M8GFV5      ----------------YGNEN---------------------------------------
A0A4R1CW45      ----------------YDSYYSE-------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ----------------RSSYYYNSYGSRSQKQK---------------------------
A0A2S8MDM2      ----------------YGTETPRHAPP---------------------------------
A0A357ZDL3      ----------------TGHRVRDKYNEDGAYEFLG-------------------------
A0A4Y8ZIU8      ----------------ASKGDDYHAYYQAPRDAES-------------------------
A0A1I6GVG4      ----------------HGDYYRSDEQELPSGTVRG-------------------------
A0A1I6IST1      ----------------HGDYYRSDEQELPSGTVRG-------------------------
A0A412JBM5      ----------------KYEDKYGGAKDYGYGYGYG-------------------------
A0A6J4SUA1      ----------------YLDGYEAEDDP-------A-------------------------
A0A1C2B334      ----------------YGD----TDTP-------R-------------------------
R7Y679          ----------------YAQ----ASRE-------G-------------------------
A0A0F0KYJ9      ----------------HGDYYRNDGQELPTGTVRG-------------------------
A0A538BBM6      ----------------YGYGEPEPNGERPAGE----------------------------
A0A510HHA8      ----------------QGYTR---------------------------------------
A0A6G8Q9J3      ----------------AGYASG--------------------------------------
A0A5Q2F9A3      ----------------RSGQGPEPRRVARRAAGEE-------------------------
A0A4R1BMZ2      ----------------GGYTYK--------------------------------------
A0A023X491      ----------------GGYTYSYGEAAGS-------------------------------
A0A6G8QDQ0      ----------------SAYSY---------------------------------------
A0A0K8Q3D9      ----------------HGTYTS--------------------------------------
A0A2R7RCA1      ----------------YGTYTS--------------------------------------
A0A1Q7WJN6      ----------------GGDYRQYSYYLAGYEVADE-------------------------
A0A6D1QMN1      ----------------EGN-----------------------------------------
A0A1E2SNF6      ----------------YGAKYGYGYYHDASLTAGP-------------------------
Q6ADE8          ----------------YGAKYGYGYYHDASLTAGP-------------------------
A0A1Q7CZ24      ----------------AGSSRG--------------------------------------
A0A2W6VLC6      ----------------YGSYGTYS------------------------------------
A0A519G798      ----------------YGYGYGYG------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ----------EPSVTDNPPTEQIQTPASVASR----------------------------
A0A3L8NYD3      ----------GGDRSNGNTLRARFLYRRMRRREE--------------------------
A0A1M6K628      ----------RRRPAAEVS-------------GA--------------------------
A0A561E8R3      ----------PAPTPAQPS-------------PP--------------------------
A0A3E2DN22      ---------------------YSSYGSEEQESRESIAVVQEAQ-----------------
A0A3Q9ULZ9      ----------KKRRKKKMSLEEDYFGAVEPAPLGSHPTQDQPSSEGEQEDATSGG-----
A0A3S9JFL2      ----------KKRRKKRMSLEEDYFGRVELAPVNSRPTEDEPT-----------------
A0A3L7ADK2      ------------------------------------------------------------
A0A1Q2CI19      -----------------GGARAVA------------------------------------
A0A512T3M3      --------------H--RAQRGAFDPAADEDGQSSDIDT--------HG-----------
W6JTW4          ----------GGHGP--RSAHGTSASRRDRLGRAEAPSTIRGGGEARHD-----------
A0A0A0JTY0      ----------GARSRQSGPVGP--------------------------------------
A0A0A0JXF2      ----------LAEKR--GPVAPATPSTSSRPTTGPAEETRSRDAV---------------
E6S8H2          ------------YGD--KKKGKARKRLPSSAVQGPPELSE--------------------
A0A0A0JGH0      ----------KMELD--PRQQPSAPSVAVPQHASAPEVDR--------------------
N0E4U7          ----------RVEAD--RSLRPTRADAST-QFAGSEDGAR--------------------
A0A0A0IYK2      -----------RAQS--RSARSAAEQETTFVDSRTPGASPVHSAESRDTSRNPEDAPDDL
A0A0Q9L0H3      -----------RQQL--RAAEPVA------------------------------------
A3TMK0          ----------LADQR--RPAAPVV------------------------------------
A0A543PXP1      -----------GRSI--GGAQGAR------------------------------------
A3TMH6          ----------IRRVL--PGRRGTTDG----------------------------------
A0A1H6WL79      ----------MNPTSQPGHAGVSVDGNGFEAHSPWQGPAKAAEITSQAMLSGLG------
A0A101LAM5      ----------TTTTSASRRS----------------------------------------
A0A4Y3NEG0      ----------TVLSAPAGAL----------------------------------------
A0A6I2XCV4      ----------GSGYYSSGEGQPAQ------------------------------------
A0A5R8VLL6      ------------------------------------------------------------
A0A538JQF8      ----------RRATKARSAKKAAKKSSARAPAKTGPDTTNASADEPV-------------
A0A1H6YPK1      HRADDVPVLAERDDELVFGQAPEGAEKGPGGHESIDETHSE-------------------
A0A2R7MGI0      ----------RSTRRGARGVAAKSGPAETGPRRRSNAAPDDARAL---------------
A0A2T7WQY4      ----------RTRGRDRRPSSVMGAPGATGPRRRSGTASDDARVG---------------
A0A1G6GTN3      ----------RFRRRGQTTPVAAAEDREAGSRTQPADPPPENVSGLRTLAPV--------
A0A1N7DLV3      ----------RRPWRRATVEKKDAGEQAPGPRRRSAELPPSNVRGLRTLAPG--------
A0A1V2NSB5      ----------RRPWRRQVGDAGDAGASAPGPRRRSAELPPSNVSGLRTLSAR--------
A0A0Q5Q5L3      ----------RRVLRKSSTEPGAAEEH--GKRRTSADLPAENVSALRPLSHR--------
A0A0Q6DVM4      ----------RRVLRKSSTEPGAAEEH--GKRRTSADLPAENVSALRPLSHR--------
A0A1R3WWR6      ----------RFGRRPRTADSENTTDT--GPRRQSADPPPENVRGLRTLSHG--------
A0A0Q5JKD6      ----------RRGKKAEVVDAEQEATPRRRSGGLPPENVSGLRTLS--------------
A0A0Q9TBP0      ----------SRERAVTGTDAAPDSAPTRAGKDQAGDPVPSAGT----------------
A0A5Q2FA83      ----------SKREAVASRHGSLEEAVPVTSAAIPGSPSGTEQDEETVRAARTALSSLFT
A0A346XTB0      ------------------------------------------------------------
A0A0G3V3M7      ------------------------------------------------------------
A0A6I3DD56      ------------------------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      -----------------GRRHTRHQEPAETQEHVPAAS----------------------
A0A2N6V1R5      EEEVHPLPKDKQSNRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAASPRVSTVVN
G9PHS6          EEEVHPLPKDKQSNRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAASPRVSTVVN
U1PLM7          EEEVHPLPKDKQS-RRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAASPRVSTVVN
A0A6I1G2U1      ----------GRRGARAAGDQPRPRTRREAKERAADGGLSSADLS---------------
A0A351ETF8      ------------------------------------------------------------
A0A542FTE6      ----------KVED----------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A2S5UYV0      ----------GMPVFKSSKGHVDLLE---PQPEKNASAAISLAPRPNSQSSE--------
A0A2S5X9U6      ----------GMPKFKAVKGHADPSEQFRAQNDAVPAQRESLAP----SQPA--------
A0A2S5ULV5      ----------GMPKFKAVKGHTDPSEHFGAQPDVAAPQRESLSP----SRPA--------
A0A653YMF0      ----------GMPKFKAVKGHTDPSEHFGAQPDVVAPQRESLSP----SRPS--------
A0A346Y185      ------------------------------------------------------------
A0A259S8H9      ----------TAEDGDDAVDAFAAMANLSPAPLGDAAATAEAPRDGGATVEEGTFTTSSG
A0A0Q5L115      -----------------------------------------VGTGGAVGAGAGSGTAPA-
A0A2W1Z497      ----------EPAPGTD--------------------GGAEHGTDGDAEARAARGARPSG
A0A4V1VGV9      ----------PSPEVRDLTLTEGRSSADLPGKEDAARLRQPAPQAPT-------------
A0A3Q9IY80      ----------DGFDIDLTEDTAGTMVSAGAPGA---------------------------
A0A0F0LP73      ----------NDDAAGDDEVAALISEAELSPAAFDGEPPAPEESGAE-------------
A0A1F1X071      ----------DAEEVDVEQAGGPAEPGPASAPA---------------------------
A0A3R8RWC7      ----------DSEEVDVEQAGGPAEPGPVSAPAAAVAAPDAPRPADT-------------
A0A4U0RJZ4      ----------PAHELADITLHAPESSPAAGPQADRGNAGAPFDTTRH-------------
A0A4R1FGL9      ----------PAHELADITLHAPESTPAAGPQVDRGNAGVPLDTTRH-------------
E3B8H1          ----------PAHELADITLHAPESTPAAGPQVDRGNAGVPLDTTRH-------------
A0A7D7WDT9      ----------KSRGKRKKQASAVSAPAVARASLVPAATRADVVAGPR-------------
A0A0Q5AWK6      ----------ATENAAVGR------------SARRSPRTQALEP----------------
A0A6P1F176      ----------RGRGRSNGRRSAGEEPARSLPAVRPSEPARAVEPERI-------------
A0A3N1NLD3      ----------RSRGRSAGRRAAAEEPARSLPAVRPAEPARAVEPERT-------------
A0A3N2FVI8      ----------RSRGRSTGRRAAAEEPARSLPAVRPAEPARAVEPERTRAAEPERAAEPER
A0A2S5XDQ6      ----------TGRKR---------------------------------------------
A0A2S5XNN6      ----------TGRKR---------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A4R6Q3C6      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
D8USQ4          ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A6J4MTQ2      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A6L5R0V7      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A6L6AM03      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A6G8FYB9      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      --------------------------------RRESGERPRRQGSGAGVGAGASPNANAG
A0A538BYZ4      --------------------------------------------------WLQWAKRGGD
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      --------------------------------RPAKEVPDAGTAAPASRAPDTGSTAALE
A0A1M3LEY6      --------------------------------GFSQIISPAESPGRRQSSAVPPSGPART
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      --------------------------------GAPQTAQTSPNGHDRGRLGRTVARVGHM
A0A022KX11      --------------------------------AKQRARG---------------------
A0A4Q5A868      --------------------------------K---------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      --------------------------------RRQGKRDKRMSKSRPHAEAAASARAERA
A0A0W8I9Y2      --------------------------------TGAQPVVAAPAAKQPWGTAPRAESSDAH
A0A7C6LSF9      --------------------------------KKRRSKEREPRPPSLPPAVQPRPTSEPD
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      ---------------------------------------------------GRQRSSSAA
A0A6G7Y423      --------------------------------RRLTYRRGGPSRPSRIRPVGRSNTATAA
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A1Q2CRV2      --------------------------------KKRRARAEVAA-----------------
A0A222TG79      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A2S5WZJ5      --------------------------------FAAVAPAAAPARESLAPTRPSASSAPRA
K6WHS4          --------------------------------------------DDMSVDKVGTSSAS--
A0A1L2ZMQ6      --------------------------------SRHNEGTRGTSSQSMTVTKPAPDNFDEI
A0A3L8NYD3      --------------------------------REQAQREQTLRERTAARENEHGQPPVEL
A0A1M6K628      --------------------------------RQGRGRSQSTPRPRRVAADDQRVEVVDA
A0A561E8R3      --------------------------------ATPAAPTATMGTQPATAGDNITDQELGL
A0A3E2DN22      ----------------------------------PAEGLVRVPKKDRADTDTEITP----
A0A3Q9ULZ9      --------------------------------SQPSRAVRTNGSDT-DQIPAGLRPVGPQ
A0A3S9JFL2      ----------------------------------PSRVTSSSASRSQENRPADLTPVGPR
A0A3L7ADK2      --------------------------------DESTVVEGDSATPIAAATPLAAPEEATS
A0A1Q2CI19      ----------------------------------------DEKPEASLV-------EPAE
A0A512T3M3      ----------------------------------------SSGPRSAA--------VPGS
W6JTW4          ----------------------------------------AAGPRPAV--------VEAS
A0A0A0JTY0      --------------------------------------------PTGHMGDFF---DDAE
A0A0A0JXF2      ----------------------------------------GTADPTTTVDPVLGVDDDDV
E6S8H2          ----------------------------------------ERVPESRS--------ARRE
A0A0A0JGH0      ----------------------------------------WSLPPRVD--------DPQD
N0E4U7          ----------------------------------------PFSPQADG--------APDD
A0A0A0IYK2      QLDVTP--------------------------GGEVPTATDEAHAATR--------GEVG
A0A0Q9L0H3      ----------------------------------------DELHPPTT--------GDER
A3TMK0          ----------------------------------------TESEPDDF--------LDDA
A0A543PXP1      ----------------------------------------AKRPAHDV--------DSKS
A3TMH6          ----------------------------------------SSTPPHPA--------ESEP
A0A1H6WL79      --------------------------------HAIAGPSNSLTNSSDTPSFLAPESQWRS
A0A101LAM5      ---------------------------------PDADAVNPVPDIREASPFLGSVSTWRA
A0A4Y3NEG0      ---------------------------------AD-NPATPLPEPREASTFLAPDSPWRA
A0A6I2XCV4      --------------------------------TGQPAQLGQRVRPTPVAPMDAPQTPTST
A0A5R8VLL6      --------------------------------PDSLDSTSSPEKAAARDKTASPDKAARP
A0A538JQF8      --------------------------------VHEAPAAGPGSRVSDGKPRLRWSWSAGA
A0A1H6YPK1      --------------------------------ERPPGEISFGHSVDAVEVAVSGRSAVRD
A0A2R7MGI0      -----------------------------------------HAGE---------------
A0A2T7WQY4      -----------------------------------------ASGE---------------
A0A1G6GTN3      --------------------------------TTPAVPGGEVTDEITVPATSGETAAGTL
A0A1N7DLV3      --------------------------------RKGSPVPGDSGGE-GVVPVAAPAADVPD
A0A1V2NSB5      --------------------------------RNPVAASGDFTGE-GAVAVAPPAAVVAD
A0A0Q5Q5L3      --------------------------------RTKDRDAGEATSEVEVVRTSEPPVDAGA
A0A0Q6DVM4      --------------------------------RTKDRDAGEATSEVEVVRTSEPPVDAGA
A0A1R3WWR6      --------------------------------RTSASNQDDSSGE-NVASVTTAPSPVGR
A0A0Q5JKD6      --------------------------------QRRMSATAEGEATSEIAVASTAEPDTVD
A0A0Q9TBP0      --------------------------------PPPSGDTHHGSAPTGHRDTPPVAPAGHG
A0A5Q2FA83      EDPDDTQFS-----------------------MPAITSEPVTQGTPLAAPAPASSPDETI
A0A346XTB0      --------------------------------DDGQRRLLPGSRRRNGGNEGTRGSHRDA
A0A0G3V3M7      --------------------------------RKPTNGAGTVRRKPDPEQVGVSASNQGA
A0A6I3DD56      --------------------------------RKPTNGAGTVRRKPDPEQVGASASNQGA
A0A2W6DK08      --------------------------------VISANDRAHSDRHWRRAEMSELIWHPST
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      PEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGAPQA
G9PHS6          PEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGAPQA
U1PLM7          PEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGAPQA
A0A6I1G2U1      --------------------------------SGSAEDAFDPYEGYDVRRDLATTDDSGD
A0A351ETF8      ------------------------------------------------------------
A0A542FTE6      --------------------------------DAPPPQAPPIANTTNLRPEDLPRRTRRN
A0A349B7N2      --------------------------------PLPPPTDGQEQRGIESDELDALDAEGEL
A0A2S5UYV0      --------------------------------QPPQAVVAQQQAPASETPSDLSSTPEVQ
A0A2S5X9U6      --------------------------------QVRSAPVVPAQLETQSAEP------VSE
A0A2S5ULV5      --------------------------------QPAAEQAAPSQPQAGPVPSSAPTAVATE
A0A653YMF0      --------------------------------QPATGQAVPEQAQAAPVQASAPTAVATE
A0A346Y185      --------------------------------TPDDRRPQKEVKPRRRPGGRHREKATTK
A0A259S8H9      PADIITDGDAADAGEEASPAIVRPHGSNGRAAAARARRSVPPVEVAEPVGERVDGEDEAH
A0A0Q5L115      ---------SREAVTAPAPVV-----------APTPPAAPTPAPVPAPAGAAAAAAAAAA
A0A2W1Z497      GSRLTPSLPDRDASVPRSPVV-----------SPYDPSLELPSRRSRRRAAAVGGTDDTR
A0A4V1VGV9      ------------PPEPATAVR-----------APSAPSRAGASEASGPNVAPHGRQSGEA
A0A3Q9IY80      --------------ASTPSPS-----------SATRPASGVTGSPAATGTATPTVVATDS
A0A0F0LP73      ---------DEGASRERRASR-----------SRTVSDDAASSRATHARPRIAQTGQRST
A0A1F1X071      --------------------E-----------PGPVVEP------------DGHEPEGDS
A0A3R8RWC7      -------EAPRRAAQASPRPE-----------AQPVAHPARAADESAPVEHDENEPEGDS
A0A4U0RJZ4      --------------DPMRGAS-----------SEAPSASANVECAPREATPATSGSDGAP
A0A4R1FGL9      --------------DPMRGES-----------SQAPSASANVERAPRQATPATSDSDGAP
E3B8H1          --------------DPMRGES-----------SQAPSASANVERAPRQATPATSDSDGAP
A0A7D7WDT9      -----------RTVHDSPSTT-----------NTVSPTPEPAGSSQPDVRDATPPTQSEL
A0A0Q5AWK6      --------------------------------------------------VE---SRAER
A0A6P1F176      ---------------AEPERA-----------VGPARTVEPARSTEHVVRAA---PKADV
A0A3N1NLD3      -----------RAAEPERTRV-----------AEPERAVEPARSLEHVVRAA---PKAEV
A0A3N2FVI8      AAEPERAAEPERAAEPERTRV-----------TEPERAAEPARSLEHVVRAA---PKAEV
A0A2S5XDQ6      -----------AAAAPRRSEL-----------APVESRALP-------------------
A0A2S5XNN6      -----------AAAAPRRSEL-----------APVESRALP-------------------
A0A4Q4D4T1      --------------------------------RRRR------------------------
A0A261FE22      --------------------------------SAPA---------------TQARPQVQA
A0A5C8C085      --------------------------------KGKKPAPDSFEPGPGPEPSDQTDNGPDD
A0A1E4BP96      ------------------------------------------------------------
A0A439DNZ6      --------------------------------SAVA---------------TTPRMKVMR
A0A0J6YE86      --------------------------------ESSK---------------TTSANASES
A0A5Q5BFU2      --------------------------------ETRV---------------EKSSPSSAT
A0A151BT98      --------------------------------SDKRG-----------------------
A0A2Y8ZRF8      --------------------------------TGKRG-----------------------
A0A2R9UAT1      --------------------------------NVDGITRPVVETQPAATGDPQDQLAPLR
A0A4Q5J5D7      --------------------------------ATEV---------------SSKHRRRTA
A0A1Y4CKD6      --------------------------------GVKPVVEPEIVEEEVVPPRGKHFRV---
A0A3S0V9U6      --------------------------------SAGT---------------KK-------
A0A1S2N0P2      --------------------------------SGSS---------------PAAGGKHGA
A0A0Q3BEY5      --------------------------------SGSS---------------PAAGGKHGA
A0A4R6Q3C6      --------------------------------SGSS---------------PAAGGKHGA
A0A2X3GKL3      --------------------------------SGSS---------------PAAGGKHGA
A0A0Q7KBQ4      --------------------------------ALGR---------------GESRSSSGR
A0A1F1IHY9      --------------------------------AGRS------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      --------------------------------RRLQDPVPVDQPVISSNRFGEIPGLGAH
A0A537WNY9      --------------------------------R---------------------------
A0A5B8M469      --------------------------------KVTPVPAPHEVASPATAAQARATAAAGR
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      --------------------------------IEAG---------------GDTSVDGQA
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      --------------------------------QRGR---------------RAGKPKADR
A0A433EDP2      --------------------------------KKVK---------------SRKKAKK--
A0A231VTW0      --------------------------------KKVK---------------SRKKAKK--
A0A433ECD0      --------------------------------KKVK---------------SRKKAKK--
U7V3Z1          --------------------------------KKVK---------------SRKKAKK--
A0A1F1J417      --------------------------------KVSS---------------GAHGA----
A0A2A8D6P2      --------------------------------KVSS---------------GAHGA----
A0A1F0THV9      --------------------------------KVSS---------------GAHGA----
A0A5F0M6Y0      --------------------------------KVSS---------------GAHGA----
D8USQ4          --------------------------------KVSS---------------GAHGA----
E3H5W1          --------------------------------KVSS---------------GAHGA----
A0A1F1QKB0      --------------------------------KVSS---------------GAHGA----
A0A509JY23      --------------------------------KVSS---------------GAHGA----
A0A448USF4      --------------------------------KVSS---------------GAHGA----
A0A0Q9LZR0      --------------------------------AATR------------------------
A0A1N7E3F1      --------------------------------TPMPV-----------------------
A0A544ZKQ1      --------------------------------APMPV-----------------------
A0A372P1T1      --------------------------------APIPV-----------------------
A0A5D0Q2X0      --------------------------------APIPV-----------------------
A0A5R8Z2E7      --------------------------------APIPV-----------------------
A0A1L2ZMV4      --------------------------------RRAA---------------SSSSK----
A0A6I3F378      ------------------------------------------------------------
A0A1E9T6I0      --------------------------------KSSK---------------SKSSAPKA-
A0A1S1CQC5      --------------------------------KSSK---------------SKSSAPKA-
A0A1S1CAD0      --------------------------------KSSK---------------KSSTKK---
G5ET14          --------------------------------KSSK---------------KSSTKK---
A0A1E9DXX2      --------------------------------KSSK---------------KSSAKK---
A0A1E8S156      --------------------------------KSSK---------------KSSTKK---
A0A1E8S5S2      --------------------------------KSSK---------------KSSTKK---
A0A1S1DFA8      --------------------------------KSSK---------------KSSTKK---
A0A2I1Z490      --------------------------------KSSK---------------KSSTKK---
A0A1F0DAA9      --------------------------------KSSK---------------KSSTKK---
A0A1F0PHK9      --------------------------------KSSK---------------KSSTKK---
A0A1F0VZG6      --------------------------------KSSK---------------KSSTKK---
A0A1E9G8X4      --------------------------------KSSK---------------KSSAKK---
A0A1E9IAW2      --------------------------------KSSK---------------KSSAKK---
A0A1E9ZBC9      --------------------------------KSSK---------------KSSAKK---
A0A1E9ZDP4      --------------------------------KSSK---------------KSSAKK---
A0A1F0R6B5      --------------------------------KSSK---------------KSSAKK---
A0A1F0Z7N5      --------------------------------KSSK---------------KSSAKK---
A0A1F1D897      --------------------------------KSSK---------------KSSAKK---
D2NP38          --------------------------------KSSK---------------KSSAKK---
A0A1F1FV74      --------------------------------KSSK---------------KSSAKK---
A0A1E9M791      --------------------------------KSSK---------------KSSAKK---
A0A291DEI8      --------------------------------KSSK---------------KSSAKK---
A0A1S1D5T1      --------------------------------KSSK---------------KSSAKK---
A0A1E8TRD6      --------------------------------KSSK---------------KSSAKK---
A0A1F0XT88      --------------------------------KSSK---------------KSSAKK---
A0A1F1EVP5      --------------------------------KSSK---------------KSSAKK---
C6R548          --------------------------------KSSK---------------KSSAKK---
A0A0K2RXS2      --------------------------------KSSK---------------KSSTKK---
A0A1F0KX60      --------------------------------KSSK---------------KSSTKK---
A0A542I3V2      --------------------------------RPGT---------------EKDGAEI--
A0A2T0UZ65      --------------------------------RRRA---------------AKKAKDRVG
A0A1R4JTI6      --------------------------------NAGS---------------TRE------
A0A4R7TM52      --------------------------------AAASPSVTEGEPRVLADQPSRRSRRTSA
A0A542XE74      --------------------------------SPERSRADDVEDAEPTSSRAARKRRRSK
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ---------------------------------------------------GKGRRRR--
A0A5R8L819      --------------------------------AAGDNPAD-----------GQGLRRRSR
A0A261FQA1      --------------------------------AEQ-------------------------
A0A1Q2CJ92      --------------------------------RRER---------------ARRVTKLVE
A0A2T0S3C8      --------------------------------APAT---------------TELRDLMAC
A0A4Y8WZJ3      --------------------------------AGRS------------------------
A0A285VUW0      --------------------------------GGAR---------------RLARRKGAR
A0A2R7Z032      --------------------------------YSTA---------------GKGKRRSK-
A0A6J4MTQ2      --------------------------------YASASTASTASTASTGGKLGKGRRVRAG
A0A1I0W453      --------------------------------YSTA---------------GKGRRRKEA
A0A1H4LCS9      --------------------------------YSTA---------------GKGRRKLLK
A0A4Q2RZP8      --------------------------------YSTA---------------GKGRRKLTK
A0A0Q6VV12      --------------------------------YSTA---------------GKGRRRKLV
A0A495NTA9      --------------------------------YSTA---------------GKG-RRKLV
A0A0Q9QB08      --------------------------------DATA---------------GGGRRRKHP
A0A4Q2SA86      --------------------------------DATA---------------GKGWRKKAD
A0A4Z1C3Z0      --------------------------------ESSA---------------GKGWRKKAD
A0A542J310      --------------------------------VTPA---------------VESVRPGNV
A0A4Q2JUT1      --------------------------------ETGK---------------PDSKRRGRK
A0A6L5R0V7      --------------------------------ETPK---------------ATPKRRGHK
A0A444BL03      --------------------------------ASRG---------------KHAE-----
A0A4Y8X357      --------------------------------AEAP---------------LDGAGTDAA
R4LD52          --------------------------------RVAV---------------GRLPELMGA
A0A4T2CD79      --------------------------------TPTI---------------PVTAAESAD
A0A6L6AM03      --------------------------------YSTA---------------GKGRRRKQA
A0A4Q2RU39      --------------------------------YSTA---------------GKGRRRKPA
A0A4Q2SK58      --------------------------------YSTA---------------GKGRRRREA
A0A2N3YJR1      --------------------------------S---------------------------
A0A6G8FYB9      --------------------------------PVAE---------------SDVVEPVVP
A0A4Q4D742      --------------------------------QPEK---------------SGDEASTLS
A0A1C6T1J1      --------------------------------TSGR---------------HAEHAAAGV
A0A2W2CFC8      --------------------------------TAGR---------------HAEQTAADE
A0A2W2A4B0      --------------------------------STSE---------------VTP------
A0A4Y9MDA5      --------------------------------PAAE---------------PVGPVGVGA
A0A1H7N9P7      --------------------------------PAAR---------------SAEAADRPA
A0A1M7V0F8      --------------------------------PAGR---------------IGQL-----
A0A520EHH5      --------------------------------H---------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      --------------------------------EKMKKD----------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      --------------------------------GEQESVKVEGLSAAVALDTAAPDPAADY
A0A4Y8ZIU8      --------------------------------RSAGETTPEAGAGR--------------
A0A1I6GVG4      --------------------------------DS--------PRRRGESEAA--------
A0A1I6IST1      --------------------------------DSLAPTRPRMPRRASKTRVGS-------
A0A412JBM5      --------------------------------YGNSGHRRQARGRSGQS-----------
A0A6J4SUA1      --------------------------------LPEAQRSRLTAGPVGTR-----------
A0A1C2B334      --------------------------------MASQRSRSHDIAQVGLRR----------
R7Y679          --------------------------------VTA-------------------------
A0A0F0KYJ9      --------------------------------DNANIYAKSK------------------
A0A538BBM6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      --------------------------------PADRQRVIA-------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------AVAPSVLGEDADLLQRDSDASGS-
A0A2R7RCA1      ------------------------------------APTSA----PGPVAEAEPDLTGPF
A0A1Q7WJN6      --------------------------------DELREPAQSLLRDPQ-------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      --------------------------------EAAPAPAATPVPTPAEPDAADRDATDPH
Q6ADE8          --------------------------------EAAPAPAATPVPTPAEPDAADRDATDPH
A0A1Q7CZ24      ---------------------------------ARGRGAWSRA-----------------
A0A2W6VLC6      --------------------------------ASVPDTGWSVSHAAAEASAGVAGAARTE
A0A519G798      --------------------------------PDKPRN----------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      AGMPPAASPQRATRASADEQFPRGAFKPAVPRRADGRAPRHKNTRI--------------
A0A538BYZ4      ALRRQRSRRGP-------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      TESPADAAVSDLPADESERFDLAAWQRPGKGTHRA-------------------------
A0A1M3LEY6      TAQARQESV---------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      LQRRRRGGR---------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      VDGGEA-------------------------------------------LEFRSRARQRL
A0A0W8I9Y2      QPAGASTRQEPTVPSAEDAAPAPRAERSNGQGSAEHESFGLEAWGRSGSSTGSTAQGH--
A0A7C6LSF9      NDFSADPVDDAGKVGVVGGAGSVEEFDP-------YAGYDLDRDGLASSTPSEPPIESRR
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      TGRRAA-----------PSGQRPDDLVL------------------------TPRQARE-
A0A6G7Y423      PSRAAVSVVTAAARSTQPATPAPEGTSAARAAAITPAPTRTASRRAAGAPPPSPRRPRQY
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A2S5WZJ5      TPAASQPTPPPQTPGSELPSRRSRRGA---------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      VFRGTRAKRSDES-----------------------------------------------
A0A3L8NYD3      TSIAGKRRSS--------------------------------------------------
A0A1M6K628      SADAVVMEPASTQL----------------------------------------------
A0A561E8R3      SRRDRRSKQGK-------------------------------------------------
A0A3E2DN22      ----RRAK----------------------------------------------------
A0A3Q9ULZ9      PKPARRAR----------------------------------------------------
A0A3S9JFL2      PRPARRAR----------------------------------------------------
A0A3L7ADK2      RRTVRRSGH---------------------------------------------------
A0A1Q2CI19      DVQAQRSK----------------------------------------------------
A0A512T3M3      GARSPRANRATG------------------------------------------------
W6JTW4          PDDSV-SDRSGG------------------------------------------------
A0A0A0JTY0      QPESRRSRRTSSSA----------------------------------------------
A0A0A0JXF2      EPDSRRTRRRASSL----------------------------------------------
E6S8H2          ASRKRSSRRTSSSA----------------------------------------------
A0A0A0JGH0      AAPSRRSRHSSH------------------------------------------------
N0E4U7          AALSRRARRTSSSA----------------------------------------------
A0A0A0IYK2      EERRRSRRRSSSSA----------------------------------------------
A0A0Q9L0H3      PRESRHDRRTSSSL----------------------------------------------
A3TMK0          SRESRRTRRASSA-----------------------------------------------
A0A543PXP1      DPDSRQTRRTSSSSL---------------------------------------------
A3TMH6          GAESRRDRRTTSA-----------------------------------------------
A0A1H6WL79      PSDG-RGRRSAPPS----------------------------------------------
A0A101LAM5      PQDGSRGRRSAPPS----------------------------------------------
A0A4Y3NEG0      PQDGSRGRRSAPPRQV--------------------------------------------
A0A6I2XCV4      NGSAEGDAQS--------------------------------------------------
A0A5R8VLL6      QPANSRETRSPVSEVGRDKFSKSSTSF---------------------------------
A0A538JQF8      EDFLGREGPA--------------------------------------------------
A0A1H6YPK1      TMHLRRLFRT--------------------------------------------------
A0A2R7MGI0      ----VFRDLG--------------------------------------------------
A0A2T7WQY4      ----VRRSRG--------------------------------------------------
A0A1G6GTN3      PR--RRTRRG--------------------------------------------------
A0A1N7DLV3      DRTSRRRQRG--------------------------------------------------
A0A1V2NSB5      ERTPRRRRRG--------------------------------------------------
A0A0Q5Q5L3      PR--RRRTTP--------------------------------------------------
A0A0Q6DVM4      PR--RRRTTP--------------------------------------------------
A0A1R3WWR6      RR--QR------------------------------------------------------
A0A0Q5JKD6      TMSRRRARRG--------------------------------------------------
A0A0Q9TBP0      DSRKTAVAEPGDDVA---------------------------------------------
A0A5Q2FA83      DAPSPALSRGRRFAE---------------------------------------------
A0A346XTB0      DRDADRDADPDGEGA---------------------------------------------
A0A0G3V3M7      NSSSEAFDDPSF------------------------------------------------
A0A6I3DD56      PASTEAFDDTSA------------------------------------------------
A0A2W6DK08      PAPNGFLPERRP------------------------------------------------
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      SVPTRRSLRERRNG----------------------------------------------
G9PHS6          SVPTRRSLRERRNG----------------------------------------------
U1PLM7          SVPTRRSLRERRNG----------------------------------------------
A0A6I1G2U1      PPVLGQTRRQRRASSG--------------------------------------------
A0A351ETF8      ------------------------------------------------------------
A0A542FTE6      PPTIAPSDEMNDAPAERSHLA---------------------------------------
A0A349B7N2      PEVHPADR----------------------------------------------------
A0A2S5UYV0      GAPTRRSRRGA-------------------------------------------------
A0A2S5X9U6      QPQSRRSRRGA-------------------------------------------------
A0A2S5ULV5      QPQSRRSRRGA-------------------------------------------------
A0A653YMF0      QPQSRRSRRGA-------------------------------------------------
A0A346Y185      ------------------------------------------------------------
A0A259S8H9      DAAKPRYARRNARP----------------------------------------------
A0A0Q5L115      PGGEPAPARVPASPASPAAPTSPAVPASPVEAPGGALTRREIRERERTR-----------
A0A2W1Z497      P-----------------------------------------------------------
A0A4V1VGV9      PSPQGPRTRRARRRADLGE-----------------------------------------
A0A3Q9IY80      TRRSRRSKR---------------------------------------------------
A0A0F0LP73      PVRARRAKDANDLDPDATA-----------------------------------------
A0A1F1X071      AAAARTSPRGRRAASTWGR-----------------------------------------
A0A3R8RWC7      APAARTSPRGRRAASTWGR-----------------------------------------
A0A4U0RJZ4      PSRRSRRFRANDDA----------------------------------------------
A0A4R1FGL9      PSRRARRFRANDDA----------------------------------------------
E3B8H1          PSRRARRFRANDDA----------------------------------------------
A0A7D7WDT9      PQLRRRSSTRA-------------------------------------------------
A0A0Q5AWK6      PTASRRTLR---------------------------------------------------
A0A6P1F176      PASFRRPAR---------------------------------------------------
A0A3N1NLD3      PSSFRRPAR---------------------------------------------------
A0A3N2FVI8      PSSFRRPAR---------------------------------------------------
A0A2S5XDQ6      PQTSRRAAR---------------------------------------------------
A0A2S5XNN6      PQTSRRAAR---------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      QAPRSARTAVSGK-----------------------------------------------
A0A5C8C085      RPGRRVASWSN-------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A439DNZ6      RLRRYRPAYQSPGTDPASENEN--------------------------------------
A0A0J6YE86      RDRSAGDLPARPVTQRRYKTT---------------------------------------
A0A5Q5BFU2      SAQGDSEVAEPAGTRQTRETD---------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      RTRRRAG-----------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A1S2N0P2      KGRGRRARTSHSS-----------------------------------------------
A0A0Q3BEY5      KGRGRRARTSHSS-----------------------------------------------
A0A4R6Q3C6      KGRGRRARTSHSS-----------------------------------------------
A0A2X3GKL3      KGRGRRARTSHSS-----------------------------------------------
A0A0Q7KBQ4      RVSR--------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      AGSSEPEFRRLRRRR---------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      SGMPQARLVEPQMPAPVAPAPAAPTPVTSPSAGPVEPKPVDSQQESPWPFTELDLPDPSL
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      NEQRSRRASRS-------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      PARAK-------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
D8USQ4          ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      AGRRG-------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      LSQD--------------------------------------------------------
A0A542XE74      NTVG--------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A5R8L819      RSA---------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      TDDQAAELAEPRRPVA--------------------------------------------
A0A2T0S3C8      GEPESAPERRLDEPIGSGR-----------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      AARR--------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A6J4MTQ2      K-----------------------------------------------------------
A0A1I0W453      KAKAAKVDKVEKVDTAEKPSASEKAGTS--------------------------------
A0A1H4LCS9      VGKKD-------------------------------------------------------
A0A4Q2RZP8      LGRKS-------------------------------------------------------
A0A0Q6VV12      RSSSDKA-----------------------------------------------------
A0A495NTA9      KSLKG-------------------------------------------------------
A0A0Q9QB08      KKAAKNAAKKDAE-------AEAQTEADAGV-----------------------------
A0A4Q2SA86      KGDKAADAEQAE--------AAAEAEKAARS-----------------------------
A0A4Z1C3Z0      KADKPDKADKPDKPAQAEQAEAGEAEKATRS-----------------------------
A0A542J310      EAPAKDDELVPEAPRRG-GRRS--------------------------------------
A0A4Q2JUT1      R-AAKDAELVTEPPANERGSRD--------------------------------------
A0A6L5R0V7      RNAAKDAELVTEPPADERGARD--------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      AEARGSTVAEERRG----------------------------------------------
R4LD52          GRPGKERSKVGSAS----------------------------------------------
A0A4T2CD79      STARAESTELKDPTAAL-------------------------------------------
A0A6L6AM03      KSEAKAEAKAQSKAGSKTEATAAKNADAPEKAAKS-------------------------
A0A4Q2RU39      KAEKAEKAEKSEKAGKS-------------------------------------------
A0A4Q2SK58      KVDKADTPVTPDKPARPVKAGRTSKR----------------------------------
A0A2N3YJR1      ------------------RGRHGTD-----------------------------------
A0A6G8FYB9      AGPGVPVPVAKPASKVRRTAARKAD-----------------------------------
A0A4Q4D742      RS----------------------------------------------------------
A0A1C6T1J1      S-DRTQELTRLPR-----------------------------------------------
A0A2W2CFC8      PVDNAEELTRLSR-----------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      RKK---------------------------------------------------------
A0A1H7N9P7      SRR---------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      VSLAGKGGKKKSKKSRRA------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      WVGENYEVDHAMIEEYVPPRRRVKS-----------------------------------
A0A2R7RCA1      WEGPGESVQ---VPESVSAGRRARG-----------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      STSGSVPEPVPAEPANRGRRAARHG-----------------------------------
Q6ADE8          STSGSVPEPVPAEPANRGRRAARHG-----------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      STAGREGTPHREAPFS--------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A519GXS6      ---------------------------
A0A6N6NKS9      ---------------------------
A0A538BYZ4      ---------------------------
A0A348NU28      ---------------------------
A0A2N4T4Q5      ---------------------------
A0A1M3LEY6      ---------------------------
A0A538AJI7      ---------------------------
A0A538AM15      ---------------------------
A0A022KX11      ---------------------------
A0A4Q5A868      ---------------------------
A0A6N4VXX3      ---------------------------
A0A1H4I042      ---------------------------
A0A4R7A6D9      ---------------------------
A0A345NSU7      DRRNGSG--------------------
A0A0W8I9Y2      ---------------------------
A0A7C6LSF9      HRRRSSG--------------------
A0A4Y5YMQ6      ---------------------------
A0A255G8R8      ---------------------------
A0A6G7Y423      HSRTAVR--------------------
A0A4Q5APW3      ---------------------------
A0A4Q5B0V3      ---------------------------
A0A1Q2CRV2      ---------------------------
A0A222TG79      ---------------------------
A0A6I3DFP2      ---------------------------
A0A2S5WZJ5      ---------------------------
K6WHS4          ---------------------------
A0A1L2ZMQ6      ---------------------------
A0A3L8NYD3      ---------------------------
A0A1M6K628      ---------------------------
A0A561E8R3      ---------------------------
A0A3E2DN22      ---------------------------
A0A3Q9ULZ9      ---------------------------
A0A3S9JFL2      ---------------------------
A0A3L7ADK2      ---------------------------
A0A1Q2CI19      ---------------------------
A0A512T3M3      ---------------------------
W6JTW4          ---------------------------
A0A0A0JTY0      ---------------------------
A0A0A0JXF2      ---------------------------
E6S8H2          ---------------------------
A0A0A0JGH0      ---------------------------
N0E4U7          ---------------------------
A0A0A0IYK2      ---------------------------
A0A0Q9L0H3      ---------------------------
A3TMK0          ---------------------------
A0A543PXP1      ---------------------------
A3TMH6          ---------------------------
A0A1H6WL79      ---------------------------
A0A101LAM5      ---------------------------
A0A4Y3NEG0      ---------------------------
A0A6I2XCV4      ---------------------------
A0A5R8VLL6      ---------------------------
A0A538JQF8      ---------------------------
A0A1H6YPK1      ---------------------------
A0A2R7MGI0      ---------------------------
A0A2T7WQY4      ---------------------------
A0A1G6GTN3      ---------------------------
A0A1N7DLV3      ---------------------------
A0A1V2NSB5      ---------------------------
A0A0Q5Q5L3      ---------------------------
A0A0Q6DVM4      ---------------------------
A0A1R3WWR6      ---------------------------
A0A0Q5JKD6      ---------------------------
A0A0Q9TBP0      ---------------------------
A0A5Q2FA83      ---------------------------
A0A346XTB0      ---------------------------
A0A0G3V3M7      ---------------------------
A0A6I3DD56      ---------------------------
A0A2W6DK08      ---------------------------
A0A2S0LQ32      ---------------------------
A0A2N6V1R5      ---------------------------
G9PHS6          ---------------------------
U1PLM7          ---------------------------
A0A6I1G2U1      ---------------------------
A0A351ETF8      ---------------------------
A0A542FTE6      ---------------------------
A0A349B7N2      ---------------------------
A0A2S5UYV0      ---------------------------
A0A2S5X9U6      ---------------------------
A0A2S5ULV5      ---------------------------
A0A653YMF0      ---------------------------
A0A346Y185      ---------------------------
A0A259S8H9      ---------------------------
A0A0Q5L115      ---------------------------
A0A2W1Z497      ---------------------------
A0A4V1VGV9      ---------------------------
A0A3Q9IY80      ---------------------------
A0A0F0LP73      ---------------------------
A0A1F1X071      ---------------------------
A0A3R8RWC7      ---------------------------
A0A4U0RJZ4      ---------------------------
A0A4R1FGL9      ---------------------------
E3B8H1          ---------------------------
A0A7D7WDT9      ---------------------------
A0A0Q5AWK6      ---------------------------
A0A6P1F176      ---------------------------
A0A3N1NLD3      ---------------------------
A0A3N2FVI8      ---------------------------
A0A2S5XDQ6      ---------------------------
A0A2S5XNN6      ---------------------------
A0A4Q4D4T1      ---------------------------
A0A261FE22      ---------------------------
A0A5C8C085      ---------------------------
A0A1E4BP96      ---------------------------
A0A439DNZ6      ---------------------------
A0A0J6YE86      ---------------------------
A0A5Q5BFU2      ---------------------------
A0A151BT98      ---------------------------
A0A2Y8ZRF8      ---------------------------
A0A2R9UAT1      ---------------------------
A0A4Q5J5D7      ---------------------------
A0A1Y4CKD6      ---------------------------
A0A3S0V9U6      ---------------------------
A0A1S2N0P2      ---------------------------
A0A0Q3BEY5      ---------------------------
A0A4R6Q3C6      ---------------------------
A0A2X3GKL3      ---------------------------
A0A0Q7KBQ4      ---------------------------
A0A1F1IHY9      ---------------------------
A0A542HCT5      ---------------------------
A0A2S8WHZ8      ---------------------------
A0A537WNY9      ---------------------------
A0A5B8M469      SDQASDPSQLTSRRSGRRASGLPRGDQ
A0A1Y4CTD2      ---------------------------
A0A0Q5M6Z7      ---------------------------
A0A3N3ZPU0      ---------------------------
A0A359IQX7      ---------------------------
A0A433EDP2      ---------------------------
A0A231VTW0      ---------------------------
A0A433ECD0      ---------------------------
U7V3Z1          ---------------------------
A0A1F1J417      ---------------------------
A0A2A8D6P2      ---------------------------
A0A1F0THV9      ---------------------------
A0A5F0M6Y0      ---------------------------
D8USQ4          ---------------------------
E3H5W1          ---------------------------
A0A1F1QKB0      ---------------------------
A0A509JY23      ---------------------------
A0A448USF4      ---------------------------
A0A0Q9LZR0      ---------------------------
A0A1N7E3F1      ---------------------------
A0A544ZKQ1      ---------------------------
A0A372P1T1      ---------------------------
A0A5D0Q2X0      ---------------------------
A0A5R8Z2E7      ---------------------------
A0A1L2ZMV4      ---------------------------
A0A6I3F378      ---------------------------
A0A1E9T6I0      ---------------------------
A0A1S1CQC5      ---------------------------
A0A1S1CAD0      ---------------------------
G5ET14          ---------------------------
A0A1E9DXX2      ---------------------------
A0A1E8S156      ---------------------------
A0A1E8S5S2      ---------------------------
A0A1S1DFA8      ---------------------------
A0A2I1Z490      ---------------------------
A0A1F0DAA9      ---------------------------
A0A1F0PHK9      ---------------------------
A0A1F0VZG6      ---------------------------
A0A1E9G8X4      ---------------------------
A0A1E9IAW2      ---------------------------
A0A1E9ZBC9      ---------------------------
A0A1E9ZDP4      ---------------------------
A0A1F0R6B5      ---------------------------
A0A1F0Z7N5      ---------------------------
A0A1F1D897      ---------------------------
D2NP38          ---------------------------
A0A1F1FV74      ---------------------------
A0A1E9M791      ---------------------------
A0A291DEI8      ---------------------------
A0A1S1D5T1      ---------------------------
A0A1E8TRD6      ---------------------------
A0A1F0XT88      ---------------------------
A0A1F1EVP5      ---------------------------
C6R548          ---------------------------
A0A0K2RXS2      ---------------------------
A0A1F0KX60      ---------------------------
A0A542I3V2      ---------------------------
A0A2T0UZ65      ---------------------------
A0A1R4JTI6      ---------------------------
A0A4R7TM52      ---------------------------
A0A542XE74      ---------------------------
A0A0G3V3F3      ---------------------------
A0A0Q7QDF6      ---------------------------
A0A5R8L819      ---------------------------
A0A261FQA1      ---------------------------
A0A1Q2CJ92      ---------------------------
A0A2T0S3C8      ---------------------------
A0A4Y8WZJ3      ---------------------------
A0A285VUW0      ---------------------------
A0A2R7Z032      ---------------------------
A0A6J4MTQ2      ---------------------------
A0A1I0W453      ---------------------------
A0A1H4LCS9      ---------------------------
A0A4Q2RZP8      ---------------------------
A0A0Q6VV12      ---------------------------
A0A495NTA9      ---------------------------
A0A0Q9QB08      ---------------------------
A0A4Q2SA86      ---------------------------
A0A4Z1C3Z0      ---------------------------
A0A542J310      ---------------------------
A0A4Q2JUT1      ---------------------------
A0A6L5R0V7      ---------------------------
A0A444BL03      ---------------------------
A0A4Y8X357      ---------------------------
R4LD52          ---------------------------
A0A4T2CD79      ---------------------------
A0A6L6AM03      ---------------------------
A0A4Q2RU39      ---------------------------
A0A4Q2SK58      ---------------------------
A0A2N3YJR1      ---------------------------
A0A6G8FYB9      ---------------------------
A0A4Q4D742      ---------------------------
A0A1C6T1J1      ---------------------------
A0A2W2CFC8      ---------------------------
A0A2W2A4B0      ---------------------------
A0A4Y9MDA5      ---------------------------
A0A1H7N9P7      ---------------------------
A0A1M7V0F8      ---------------------------
A0A520EHH5      ---------------------------
A0A1V8PLV6      ---------------------------
A0A4R0U4F1      ---------------------------
A0A357ZCV8      ---------------------------
A0A4R5Z7B0      ---------------------------
A0A6M8GFV5      ---------------------------
A0A4R1CW45      ---------------------------
A0A419GS64      ---------------------------
A0A2V2CXY5      ---------------------------
A0A2S8MDM2      ---------------------------
A0A357ZDL3      ---------------------------
A0A4Y8ZIU8      ---------------------------
A0A1I6GVG4      ---------------------------
A0A1I6IST1      ---------------------------
A0A412JBM5      ---------------------------
A0A6J4SUA1      ---------------------------
A0A1C2B334      ---------------------------
R7Y679          ---------------------------
A0A0F0KYJ9      ---------------------------
A0A538BBM6      ---------------------------
A0A510HHA8      ---------------------------
A0A6G8Q9J3      ---------------------------
A0A5Q2F9A3      ---------------------------
A0A4R1BMZ2      ---------------------------
A0A023X491      ---------------------------
A0A6G8QDQ0      ---------------------------
A0A0K8Q3D9      ---------------------------
A0A2R7RCA1      ---------------------------
A0A1Q7WJN6      ---------------------------
A0A6D1QMN1      ---------------------------
A0A1E2SNF6      ---------------------------
Q6ADE8          ---------------------------
A0A1Q7CZ24      ---------------------------
A0A2W6VLC6      ---------------------------
A0A519G798      ---------------------------
                                           

© 1998-2021Legal notice