BYKdb

Dataset for cluster orphancd of phylum actinobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

231 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A0G3V3M7      ------------------------------------------------------------
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A1Q2CI19      ------------------------------------------------------------
A0A512T3M3      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A543PXP1      ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A5R8VLL6      MGPRHCLINREPGRRVACCRYPQFPHSSPRAPTSSRLYQTSTFGRVLAWQHAEAAPDTGN
A0A1H6WL79      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A0A4Y3NEG0      ------------------------------------------------------------
A0A1H6YPK1      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A5Q2FA83      ------------------------------------------------------------
A0A542FTE6      ------------------------------------------------------------
A0A2S5UYV0      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A653YMF0      ------------------------------------------------------------
A0A4V1VGV9      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
A0A4U0RJZ4      ------------------------------------------------------------
A0A4R1FGL9      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A538JQF8      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A0Q9TBP0      ------------------------------------------------------------
A0A346XTB0      ------------------------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A351ETF8      ------------------------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A346Y185      ----------------------------------------MEAVCLFCWQLWQGSQLERT
A0A259S8H9      ------------------------------------------------------------
A0A0Q5L115      ------------------------------------------------------------
A0A2W1Z497      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A4R8TXC3      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
D8USQ4          ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      --------------------------------------------MPIDEDQRQGEGLRIL
A0A3L7ADK2      ----------------------------------------MDAETNPDIVNDNDRSLRDF
A0A0G3V3M7      ------------------------------------------------------MRPADY
A0A3E2DN22      ------------------------------------------------------MTIVDV
A0A3Q9ULZ9      ------------------------------------------------------MTVIDF
A0A3S9JFL2      ------------------------------------------------------MTVIDL
A0A1Q2CI19      ------------------------------------------------------MSLKDF
A0A512T3M3      ------------------------------------------------------MTLRDY
W6JTW4          ------------------------------------------------------MPLREY
A0A0A0JTY0      ------------------------------------------------------MTLQDY
A0A0A0JXF2      ------------------------------------------------------MTLQDY
E6S8H2          ------------------------------------------------------MTLSEY
A0A0A0JGH0      ------------------------------------------------------MTLQDY
N0E4U7          ------------------------------------------------------MTLRDY
A0A0A0IYK2      ------------------------------------------------------MTLQDY
A0A0Q9L0H3      ------------------------------------------------------MTLQDY
A3TMK0          ------------------------------------------------------MTLQDY
A0A543PXP1      ------------------------------------------------------MTLKDY
A3TMH6          ------------------------------------------------------MTLNDY
A0A5R8VLL6      HEKGEVMAEEEFFRTGPVAPGPFAMPAHSARQPAGGIGSLSNPEIGGSEASAAGMGVSDY
A0A1H6WL79      ---------------------------------------MERTTQLLQDDKPQGMSGNDL
A0A101LAM5      ------------------------------------------------------MSGNDL
A0A4Y3NEG0      ---------------------------------------------MLQDDKPQGMSGNDL
A0A1H6YPK1      ------------------------------------------------------MEFRDY
A0A2R7MGI0      --------------------------------------------------------MQRV
A0A2T7WQY4      ------------------------------------------------------MDMQRV
A0A1G6GTN3      --------------------------------------------------------MQRV
A0A1N7DLV3      --------------------------------------------------------MQRV
A0A1V2NSB5      --------------------------------------------------------MQRV
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      --------------------------------------------------------MQRV
A0A5Q2FA83      ------------------------------------------------------MQFREF
A0A542FTE6      ------------------------------------------MASTVDEQITPTLDLREF
A0A2S5UYV0      ------------------------------------------------------MTVLDF
A0A2S5X9U6      ------------------------------------------------------MTVLDF
A0A2S5ULV5      ------------------------------------------------------MTVLDF
A0A653YMF0      ------------------------------------------------------MTVLDF
A0A4V1VGV9      ------------------------------------------------------MTALDL
A0A3Q9IY80      ------------------------------------------------------MELRTY
A0A0F0LP73      ------------------------------------------------------MTVLDF
A0A1F1X071      ------------------------------------------------------MTIEDF
A0A3R8RWC7      ------------------------------------------------------MTIEDF
A0A4U0RJZ4      ------------------------------------------------------MTILDL
A0A4R1FGL9      ------------------------------------------------------MTILDL
E3B8H1          ------------------------------------------------------MTILDL
A0A0Q5AWK6      ------------------------------------------------------MTVVDF
A0A3N1NLD3      ------------------------------------------------------MTVVDF
A0A3N2FVI8      ------------------------------------------------------MTVVDF
A0A2S5XDQ6      ------------------------------------------------------MTVVDL
A0A2S5XNN6      ------------------------------------------------------MTVVDL
A0A538JQF8      ------------------------------------------------------------
A0A0Q5JKD6      -----------------------------------------------------------M
A0A0Q9TBP0      ------------------------------------------------------------
A0A346XTB0      -------------------------------------------------MEEQLRRGPSL
A0A2W6DK08      ------------------------------------------------------MGIKDY
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A351ETF8      ---------------MSAAVVGVRPVNVAELQHVRGSFCMAEQPSNQDSSSLAVLDLRAH
A0A349B7N2      ------------------------------------------------------------
A0A346Y185      SRWRGGSSWGQRRKACGSSLRVVRVSAEVRGGVHLLEAHRSGRLNPMDSLQAPATSVEAL
A0A259S8H9      --------------------------------------------------------MLDL
A0A0Q5L115      -----------------------------------------MDRPDTEPRPRTL-DLQDY
A0A2W1Z497      ------------------------------------------MAPDARPDERTSRTLADY
A0A3L8NYD3      ----------------------------------------MEAAR---------VTVVDF
A0A1M6K628      ----------------------------------------MAIARRKPRTGRDILDLVQL
A0A561E8R3      ------------------------------------------------------MTVTDF
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------MTIRDF
A0A2Y8ZRF8      ------------------------------------------------------MTIRDF
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      -------------------------------MNDRRYGLDLSPVRDEEQGLDMAELASNY
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------MSLSKA
A0A542HCT5      ---------------------MPQTNPKGAERPLASVLLHFALLGGALRGEFIGVELTDY
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------MDLRDL
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      -------------------------------------------------MVLDGVTVREA
A0A0Q5M6Z7      --------------------------------------------------------MRDF
A0A3N3ZPU0      -----------------------------------MPQQDTSDEQYLDAPVHIAHRLRAV
A0A359IQX7      ------------------------------------------MLRVGTLETGRPMTLLDF
A0A4R8TXC3      ------------------------------------------------------MTILDF
A0A433EDP2      ------------------------------------------------------MTILDF
A0A231VTW0      ------------------------------------------------------MTILDF
A0A433ECD0      ------------------------------------------------------MTILDF
U7V3Z1          ------------------------------------------------------MTILDF
A0A1F1J417      ------------------------------------------------------MTILDF
A0A2A8D6P2      ------------------------------------------------------MTILDF
A0A1F0THV9      ------------------------------------------------------MTILDF
A0A5F0M6Y0      ------------------------------------------------------MTILDF
D8USQ4          ------------------------------------------------------MTILDF
E3H5W1          ------------------------------------------------------MTILDF
A0A1F1QKB0      ------------------------------------------------------MTILDF
A0A509JY23      ------------------------------------------------------MTILDF
A0A448USF4      ------------------------------------------------------MTILDF
A0A0Q9LZR0      ------------------------------------------------------MELTDY
A0A1N7E3F1      ------------------------------------------------------MELLRY
A0A544ZKQ1      ------------------------------------------------------MELLYY
A0A372P1T1      ------------------------------------------------------MELLYY
A0A5D0Q2X0      ------------------------------------------------------MELLYY
A0A5R8Z2E7      ------------------------------------------------------MELLYY
A0A1L2ZMV4      -----------------------------------------MEYTAENQPQALNHQVRRL
A0A1S1CAD0      ------------------------------------------------------MTILEF
G5ET14          ------------------------------------------------------MTILEF
A0A1E9DXX2      ------------------------------------------------------MTILEF
A0A1E8S156      ------------------------------------------------------MTILEF
A0A1E8S5S2      ------------------------------------------------------MTILEF
A0A1S1DFA8      ------------------------------------------------------MTILEF
A0A2I1Z490      ------------------------------------------------------MTILEF
A0A1F0DAA9      ------------------------------------------------------MTILEF
A0A1F0PHK9      ------------------------------------------------------MTILEF
A0A1F0VZG6      ------------------------------------------------------MTILEF
A0A1E9G8X4      ------------------------------------------------------MTILEF
A0A1E9IAW2      ------------------------------------------------------MTILEF
A0A1E9ZBC9      ------------------------------------------------------MTILEF
A0A1E9ZDP4      ------------------------------------------------------MTILEF
A0A1F0R6B5      ------------------------------------------------------MTILEF
A0A1F0Z7N5      ------------------------------------------------------MTILEF
A0A1F1D897      ------------------------------------------------------MTILEF
D2NP38          ------------------------------------------------------MTILEF
A0A1F1FV74      ------------------------------------------------------MTILEF
A0A1E9M791      ------------------------------------------------------MTILEF
A0A291DEI8      ------------------------------------------------------MTILEF
A0A1S1D5T1      ------------------------------------------------------MTILEF
A0A1E8TRD6      ------------------------------------------------------MTILEF
A0A1F0XT88      ------------------------------------------------------MTILEF
A0A1F1EVP5      ------------------------------------------------------MTILEF
C6R548          ------------------------------------------------------MTILEF
A0A0K2RXS2      ------------------------------------------------------MTILEF
A0A1F0KX60      ------------------------------------------------------MTILEF
A0A542I3V2      ---------------------------------------MTGKHEVNSDESAAGMGVRDY
A0A2T0UZ65      ------------------------------------------------------MTFLDF
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------MELQTY
A0A542XE74      ------------------------------------------------------MTILDL
A0A0G3V3F3      ------------------------------------------------------MDLAAH
A0A0Q7QDF6      ------------------------------------------------------MTSRSG
A0A3S0V9U6      ------------------------------------------------------MTLLDF
A0A2R7Z032      ------------------------------------------------------MTFAEF
A0A1I0W453      ------------------------------------------MVGGGAPPRLAGMTFGDF
A0A1H4LCS9      ------------------------------------------------------MTFGDF
A0A4Q2RZP8      ------------------------------------------------------MTFGDF
A0A0Q6VV12      ------------------------------------------------------MTFGDF
A0A495NTA9      ------------------------------------------------------MTFGDF
A0A0Q9QB08      ------------------------------------------------------MTFGDF
A0A4Q2SA86      ------------------------------------------------------MTFGDF
A0A4Z1C3Z0      ------------------------------------------------------MTFGDF
A0A5R8L819      --------------------------------------------------MRSVVELGVY
A0A261FQA1      ------------------------------------------------------MSIADI
A0A1Q2CJ92      -----------------------------------------------------------M
A0A2T0S3C8      ------------------------------------------------------MDVRDY
A0A4Y8WZJ3      -----------------------------------------------MAPAPPVMSLSKA
A0A285VUW0      ------------------------------------------------------MSVRDL
A0A4Q2JUT1      --------------------------------MDPTRSWSTAPRMGRWHDPEVSMELRDY
A0A542J310      ------------------------------------------------------MELRDY
A0A444BL03      ------------------------------------------------------MTLLDF
A0A4Y8X357      ------------------------------------------------------MNLLDF
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A4Q4D742      --------------------------------------------------MGVHVELRQF
A0A4Q2RU39      ------------------------------------------------------MTFADF
A0A4Q2SK58      ------------------------------------------------------MTFADF
A0A2N3YJR1      ------------------------------------------------------MTLLDF
A0A1C6T1J1      ------------------------------------------------------MDLYRQ
A0A2W2CFC8      ------------------------------------------------------MDPLRQ
A0A2W2A4B0      --------------------------------------------------------MTPL
A0A4Y9MDA5      ------------------------------------------------------MSLSVF
A0A1H7N9P7      ------------------------------------------------------MSLSVF
A0A1M7V0F8      ------------------------------------------------------MTLSAF
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------ST----------------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      --------------------------------------MYVTSG------------DDSN
A0A1Q2CRV2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      MAVVRRFWPVLLIATLVGALCGFGWAALQ-PK------MYQSTSSGLIVTPKSSTVG---
A0A3L7ADK2      VRMIRTYWMGALLIIALSIASGAVWTLFQ-PQ------VFEAKATGIVQAPRGNDPS---
A0A0G3V3M7      LRIVRRRWWVLLVTVVIAMTFALLTRPSS-AA------TAKASRPGVSFRATTTLIS---
A0A3E2DN22      VRILRRNLALLVICTLAGGLLGAVYQLTR-SE------TFTAKATGMVVAGDSTSVG---
A0A3Q9ULZ9      VRLLRRNLLLLVICGVVGMGAAAAYVFTR-PV------QYVAQSTAMVVAGDSSSVG---
A0A3S9JFL2      VRLLRRNLALLLVCGLVGIAAAAAYVFTR-PV------QYVAESTAMVVAGDSSSVG---
A0A1Q2CI19      LSILRHRWLVIVLCVLIAAGVVFAITPAE-RDVSPRIGSYTATSTLLVGSV-GA------
A0A512T3M3      LIVFRHYGALIVATILAAATLTWVLTPAH-AQGPVT--SYTATATLLAAS--SE------
W6JTW4          LRILLHRAPLIAGATVVAGLLSWFLVPAG-TQNAPR--SYTATAQMTVDG--GE------
A0A0A0JTY0      FKVFRHRWIIIVICALVAGAITWFITPAS-SDTTKKVGSYTATATMLVTAKASS------
A0A0A0JXF2      IKVFRHRWIVIVLCAVIAAGVTWLVTPAS-ADTTKKVGSYTATATILV----GS------
E6S8H2          LKVFRQRWLIIAITTLVAGAVMWVTSPAV-ADTSQKASSYTATATLLV----TS------
A0A0A0JGH0      IRIIRQRWIVIVICAAVAGLVTWFLTPAN-ASSVKDAPSYTATATVLV----SA------
N0E4U7          LTIARRRWPIIVACALVAAAVTWFLTPAQ-TDEAEVAPSYTATATLLV----GS------
A0A0A0IYK2      IKVFRHRWMVILVCALVAGAVTWFVTPAS-ADTTKKVGSYAATATILV----GS------
A0A0Q9L0H3      IKVFRHRWPVILICALVAGAATWFITPAS-SDTTKKVGSYTATATLLV----GS------
A3TMK0          IKVFRHRWPVILICALVAGAATWFITPAS-SDTTKKVGSYTATATILV----GS------
A0A543PXP1      LKVFRHRWPVIVACALSAAAIMWLVTPAQ-TATAQKASSYTATATLLV----GT------
A3TMH6          LKAFRRRWLVIALCAVVAGAVMWTVTPAH-PEVTRSTGSYTATATLLV----ER------
A0A5R8VLL6      ARVARTYWKHITVITLIVTVLATAWSAFR-PR------VFAAEATAIVLAVGTDNVS---
A0A1H6WL79      LSVVRSHWLGILVITVLMTGGSLGWYALQ-PK------VYAAESSGIVVAAGAENLG---
A0A101LAM5      LSVVRSHWLGILFITVLMVGGSLGWYALQ-PK------VYSAESSGIVVAAGAENLG---
A0A4Y3NEG0      LSVVRSHWLGILLITVFMVGGSLGWYTLQ-PK------IYSAESSGIVVTAGAENLG---
A0A1H6YPK1      LDVLRSRWLSIAVCTLVVGAVAYLWSDMQ-PR------VYSTSAEALVTPAGSL------
A0A2R7MGI0      VRILRAYWKTIGALLALGALAGLGWSALQ-PR------VYTADASGYVATVSSDGSTG--
A0A2T7WQY4      VRILRAYWMTIGALFALGALVGLGWSALQ-PR------VYTADASGYVATVSSDGSTG--
A0A1G6GTN3      VRILRAYWKAIVALIATGALAGLGWSSLQ-PR------VYTADASGYVAAVASDGSTG--
A0A1N7DLV3      ARILRAYWKAIVALTLAGGLAGLGWSALQ-PR------VYTADASGYVASVSSDGSTS--
A0A1V2NSB5      ARILRAYWKAIVALTLAGGLAGFGWSALQ-PR------VYTADASGYVASVSSDGSTG--
A0A0Q5Q5L3      MRILRAYWKAIVVMTVLGGLAGLGWSATQ-AR------VYSADASGYVAAVASDGSTG--
A0A0Q6DVM4      MRILRAYWKAIVVMTVLGGLAGLGWSATQ-AR------VYSADASGYVAAVASDGSTG--
A0A1R3WWR6      VRILRAYWKAIVALTIAGGLVGLAWSAVQ-PR------VYTADASGYVAAVASDGSTG--
A0A5Q2FA83      LAILGSRWKTVLVSLLLVVAATVATTLRI-TP------TYEATTRVFFSAEATAKTGTN-
A0A542FTE6      LRAVRAYWVGALGILLICIAIAALWTLTQ-PR------VWTSVATGVVQTTGGGDAG---
A0A2S5UYV0      LRLTGRSWRTLLIGVAIGLLAAFGYTQVQ-PH------VFTANSSGFVMAGPAAEG----
A0A2S5X9U6      LRLTGKSWKILAVGAIVGLLAAFGYTQIQ-PK------EYEANSAGFVVASGNAEL----
A0A2S5ULV5      LRLTGKSWKILAIGVIVGLLAAFGYTQIQ-PK------VYEADSAGFVIAGSSGEF----
A0A653YMF0      LRLTGKSWKILAVGVIIGLLAAFGYTQIQ-PK------VYEADSAGFVIAGGSAEL----
A0A4V1VGV9      VRIMRANLKLLALAALIGTLLAAGYTLTR-PT------LYSASSTAQVIAGNSIDAN---
A0A3Q9IY80      LRILRAHWLGLIVLVVVGVVSAFGWTLLQ-PK------VYSADASG-IVAPVRTELSGND
A0A0F0LP73      LVLIRRGWFFLALGLLFGALGGFVTAQLT-PP------VYTAQATGFIAGTGG-------
A0A1F1X071      LRLLLRNLLLLVAGLVLGAATGYGLSFTQ-ST------TYSASALGYVSASAQSDENGDP
A0A3R8RWC7      LRLLLRNLLLLVAGLVLGAAAGYGLSFTQ-ST------TYSASALGYVSASAQSDENGDP
A0A4U0RJZ4      VRIIRTNLKLLLLSMLLGIVVAAGYTLTR-PV------EYQATSTAQIMAGASNDAS---
A0A4R1FGL9      VRIIRTNLKLLLLSMLLGIVVAAGYTLTR-PV------EYQATSTAQIMAGASNDAS---
E3B8H1          VRIIRTNLKLLLLSMLLGIVVAAGYTLTR-PV------EYQATSTAQIMAGASNDAS---
A0A0Q5AWK6      IAFIRRNWKALVVAVLVGVTAMAAFSFVT-PK------VYESSSAGFVIAATDGSSA---
A0A3N1NLD3      IAFIRRNWKILVVAVLVGVSAMAAFSAVS-PK------VYDSSSAGFVIAATDGSSA---
A0A3N2FVI8      IAFIRRNWKIIVVAVLVGVSAMAAFSAVT-PK------VYDSSSAGFVIAATDGSSA---
A0A2S5XDQ6      IAFIRRNWRTLVGAVLVGALAMAAFSFLT-PK------VYESSSAGFVIAASDGSSA---
A0A2S5XNN6      IAFIRRNWRTLVVAVLVGALAMAAFSFLT-PK------VYESSSAGFVIAASDGSSA---
A0A538JQF8      ----------------------------M-PF------PRSVRAAHTL------------
A0A0Q5JKD6      VRVVRAYWKAIVALIVVGGLAGLGWSSLQ-PR------VYTADASGYVAAVASDGSTG--
A0A0Q9TBP0      ---------MALLVLLAAVAVSCAYSLAA-TP------LYIATADVLIEPSGAD--I---
A0A346XTB0      LESLWRYRVVVAGVTLFMGLLGYVVGLQE-DV------RYVAQGTLFLADPNLGDEL---
A0A2W6DK08      LTALQRRWPVVVVAGLLGLLIGYLVAPGA-AN------QLSGKGSYVATAT---------
A0A2S0LQ32      ---MKVNAVFIICCVVVGGLLGFGYAKTQ-PK------LYQSSAQATIVIAGTD------
A0A2N6V1R5      --MTRVNLGFLILCVLLGLAGGFGYASAQ-PW------TYTATSQAMVVVPGTD------
G9PHS6          --MTRVNLGFLILCVLLGLAGGFGYASAQ-PW------TYTATSQAMVVVPGTD------
U1PLM7          --MTRVNLGFLILCVLLGLAGGFGYASAQ-PW------TYTATSQAMVVVPGTD------
A0A351ETF8      LAIVRKYWWFTVLVVVCAVAVAFLLTQRQ-ER------IYSTSAQVLLRSSENSFLF---
A0A349B7N2      ----------MVLGLTLGWVTTPSSAGPD-EP------DYYRATHTLVAETGTS------
A0A346Y185      VGVLRSSIGRILLVGVAAGLLGFGLSALQ-SL------RYTAEADLLLADPRNTG-----
A0A259S8H9      FTILRRGWLYLAAGLLLGALAGFGYAQTL-AP------VYTSQATGFIAATGTA------
A0A0Q5L115      LRIVRSYWLGAFLIVLLGVTAGAGWTLTQ-TR------VYESSASGVVQVAAGGDAN---
A0A2W1Z497      VRMFRTYWFGAVLIVLACVAAAGAWTLTQ-PR------VYTSGASGFVRVAGNGDAN---
A0A3L8NYD3      VRLTRVNWRVIFATFSLGLVAALLYTLHQ-PV------VYTATSKGYVAVDSGDSVS---
A0A1M6K628      WALARRNWLTLLLATILGVAVGAGISYLQ-PT------LYSATSVGYVVVGNSSTEN---
A0A561E8R3      VRFSRTNALLLLLFTIVGGALMFGYTFTK-PT------LYSATAQGLVSAGGADNTG---
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A4Q4D4T1      ---------MLLGALGLGAAALVLSGQTT---------RYDGSAEVLIQP----------
A0A261FE22      ---------------------------------------MAKNSDGAMTT----------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      --------------------------------------MYTASASGYVSGAS----LAAE
A0A101KZQ4      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      LRIMRQRWRWLLGTLLVVLAVAAVSTLMQ-PK------TYEASARFYLAGSNG-------
A0A2Y8ZRF8      LRIMRQRWRWLLGTLLIVLIAAAVSTMLQ-PK------TYEASARFYLAGSNG-------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------MS------AGNDTNPALGSV----------
A0A1Y4CKD6      LRIARRMWWLFLACVAIGVGCLYVASYVSYTP------LYRSEATFTI--------TSGD
A0A0Q7KBQ4      ---MRSRWVFSVSTFVVGAVATILLVLSM-SP------VYGSSAKLFITS------PVGQ
A0A1F1IHY9      MSMLQRHWMILVAAPLIGVLLAGLWVLTQ-NP------RYASTANALVVVG-----NSES
A0A542HCT5      LRVARAYWRGIVAFVLLGVAVAAGVSLVT-PK------VYQADASGFVSAG-----GATN
A0A2S8WHZ8      MQVVRAYWRGIIGIFLICILLAFLWTLTQ-PR------IYAATSSGLVIAG-----DSEN
A0A537WNY9      LNLLWRRRILFVATILAVIGTAFGSVQVV-TP------EYEATSTLALTP----------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ARQVAQNWWVVLALALATFLGMTGVGKLTYVP------EYTSAATLVIRV---------K
A0A0Q5M6Z7      VQLLRRYWVGELAIVMLTVGLVAALTAVQ-PR------VYESTASGLTQAA-----TGES
A0A3N3ZPU0      ARAAGWYWKVALALIVLSVAAGAAIALLM-PK------VYSSTNTVMVVTG-----NSNT
A0A359IQX7      VRMTRHNAWLLLASVVLGLVAAAGYSLTQ-PT------LYGSVSTGIVVAG-----NSNS
A0A4R8TXC3      VRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI------GSGG
A0A433EDP2      VRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI------GSGG
A0A231VTW0      VRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI------GSGG
A0A433ECD0      VRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI------GSGG
U7V3Z1          VRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI------GSGG
A0A1F1J417      VRTTRANLVLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
A0A2A8D6P2      VRTTRANLVLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
A0A1F0THV9      VRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
A0A5F0M6Y0      VRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
D8USQ4          VRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
E3H5W1          VRTTRANLLLLIAGIVIGAIAGLSYSLLQ-PK------VYAASASGYVTV------GQSG
A0A1F1QKB0      VRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
A0A509JY23      VRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
A0A448USF4      VRTTRANLVLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
A0A0Q9LZR0      LRVARTYWRGLVAFMLLGVAVAGGLSLVT-PK------VYQADASGFVSAG-----ASSN
A0A1N7E3F1      ARLMRRYWPLLLLSVLAGVGTAHVVTVNT-AP------RYLASITMLVSADA----GDGG
A0A544ZKQ1      ARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------RYLASITMLVSADT----REGG
A0A372P1T1      ARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------KYLASITMLVSADA----RDGG
A0A5D0Q2X0      ARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------KYLASITMLVSADA----RDGG
A0A5R8Z2E7      ARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------KYLASITMLVSADA----RDGG
A0A1L2ZMV4      AHVVLNNWKGAIAIFLLAVLASVGLFLIS-PK------TYAATNTVMVVA--G---GGNN
A0A1S1CAD0      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
G5ET14          FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1E9DXX2      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1E8S156      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1E8S5S2      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1S1DFA8      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A2I1Z490      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1F0DAA9      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1F0PHK9      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1F0VZG6      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1E9G8X4      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1E9IAW2      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1E9ZBC9      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1E9ZDP4      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1F0R6B5      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1F0Z7N5      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1F1D897      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
D2NP38          FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1F1FV74      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1E9M791      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A291DEI8      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1S1D5T1      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1E8TRD6      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1F0XT88      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1F1EVP5      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
C6R548          FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A0K2RXS2      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1F0KX60      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A542I3V2      VRVARLYWRSIAVVTVIVTALVMLWAALQ-PR------TYAAESSALVLT--V---GSDS
A0A2T0UZ65      VRLSRANLLRIVLLVLIGAGLAFAYAQTL-PK------VYAADASGYVVT--G---GGQN
A0A1R4JTI6      ------------------------------------------------MVTAG---VNEN
A0A4R7TM52      WRIARTGWWMMLIGLVVGVLLAVGWVVLQ-KP------VYTADAGGFVSASAG---SGSD
A0A542XE74      IRLLRRSWLSVAVGLMIGLILAAAYTLTR-PT------TYVAESRGVVVA--G---STIS
A0A0G3V3F3      FRIIARAWKQILIAGVLVAVAMFFWSNRA-ER------VYEATALLAVTP------SDTG
A0A0Q7QDF6      WTAVARRWPLVVLLGALGLGAAALVLSGQ-TT------RYDGSAEVLIQPTSP-------
A0A3S0V9U6      IRLTRANIILLVVGILVGALVGYGTTLIQ-PK------TYAATSSGYVTLGKSEDPTTGS
A0A2R7Z032      VRLTRAYWWFLVLLTALGAGVMIAKTSRE-PE------LYSAGASGIVKV--G---FSSS
A0A1I0W453      VRLSRAYVWVLIGCTILGAALMLAKTTRD-PV------LYSATSSGLVRV--G---NAAT
A0A1H4LCS9      VRLSRAYVWLLIGCTILGALLMVAKTTQD-PV------LYAANASGFVKV--G---NATT
A0A4Q2RZP8      VRLSRAYVWLLIGCTILGSLLMIAKTSRE-PV------LYAANASGFVKV--G---NATT
A0A0Q6VV12      VRLTRAYVWVLIGCTVLGALLMMAKTTRD-PV------LYSATSSGLVVV--G---NATT
A0A495NTA9      VRLTRAYVWVLIGCTVLGALLMMAKTTRD-PV------LYSATSSGLVVV--G---NATS
A0A0Q9QB08      VRLSRAYVWVLIGCTVLGAALMVAKTTQD-PV------LYSATANGLVKV--G---EAGS
A0A4Q2SA86      VRLSRAYVWVLIGCTVLGAVLMAAWTTRE-PV------LYSATSSGLVTV--G---NATT
A0A4Z1C3Z0      VRLTRAYVWVLVGCTVLGAAVMAAWTTRE-PV------LYSATSAGLVQV--G---NAAS
A0A5R8L819      LRVFRAHWVAIVVATIVGGALAYGWAVLQ-PK------TYTAEASGYVAAT-V---GGSD
A0A261FQA1      LQMIKKHWIVGLAVLVVSLAVTVCVVQTT-VP------EYSASV--------T---AVTN
A0A1Q2CJ92      WGLLRRGWLVIVASLAVGLALAFALSLTQ-PV------LYSATSAGYVVA--G---NSAT
A0A2T0S3C8      LRVLRKRWWMLLAGIGVACGLAGILTSQM-TP------QYATSVTFFVT---T---PNNG
A0A4Y8WZJ3      MSMLQRHWMILVAAPLIGVLLAGLWVLTQ-NP------RYASTANALVVV--G---NSES
A0A285VUW0      FLAIARRWRGAVAILLLVVAATAFATSRQ-PQ------VFESRTTVYFAATDE---AGES
A0A4Q2JUT1      LRGLRRHWVAILLLTLVGVGAGYGWTVLQ-TP------VYVASTSGIVQS--T---GVGD
A0A542J310      LRGLRRHWVAIILMTGIGVGAGFGWTLLQ-TP------VYVASASGIVQS--T---GIGD
A0A444BL03      VRLTRTHLLFLVVLTLAGGAAAYGLTLRM-PS------VYLADASGYVRID-G---AGAS
A0A4Y8X357      LRVLRNNKLLLLGGIVLGVVAGLVYSLLQ-PT------LYTATSTGFVTV---------Q
R4LD52          --------------MLAALVLGALVTVQT-AP------RYATSVTFFVT---T---PNTG
A0A4T2CD79      --------MTVVAITLLGAAAAFGWTFTQ-TR------VYTANSSGIVTL--M---SDGS
A0A4Q4D742      FGTLQARWRFALVTFVLGAIATVVLVTSM-AP------QYGSTVKIFM----S---TPGG
A0A4Q2RU39      VRLSRAYVWVLIGCTILGALLMIAKTTRD-PV------LYSATASGLVRV--G---NAES
A0A4Q2SK58      VRLSRAYVWVLIGCTILGALLMIAKTTRE-PV------LYSATSSGLVRV--G---AAST
A0A2N3YJR1      VRLSRTHLLSLVLLTLLGGAAAFGLTTRL-PQ------VYQADASGYVRVT-A---AGSS
A0A1C6T1J1      LRLVRRHWWIVLVTLMVALGTTALVTIRS-EP------RYVASVTFFVT---T---PSEG
A0A2W2CFC8      LRLVRRHWWIVLVTLMVSLGVTALVTVRA-QP------RYLATVTYFVT---T---PSQG
A0A2W2A4B0      TRALVLRWYFAVGGALLGFVVAIALSSTV-TP------QFRATSKIWISISGD---AESS
A0A4Y9MDA5      LGTLRRRWSLLLAGVLVGLTVAGIGSLTA-ER------LYTAESRLFFAL--E---SGNS
A0A1H7N9P7      LGLIRRRSSWLVAGVVLAVAVAGVGSLTA-TR------LYTAEARLFFTL--E---YGDS
A0A1M7V0F8      LGVLRRRSSWLLVSVLVGLTVAGAGSAAA-TR------LYTAEASLFFAL--E---YGDS
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      --------------------------------------MAIGLVSGIVLGVMVALIKDLL
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A538BYZ4      ----------------------------------------------MSTFFSAREQAERD
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          -----------------------------------------------------MFGRSRL
A0A5Q2F9A3      ------------------------------------------------------MLRNSL
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      --------------------------------------MA--------------R-----
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      --------------------------------------IE--------------K-----
A0A538AM15      --------------------------------------MS--------------K-----
A0A022KX11      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A4Y5YMQ6      --------------MLSFA----SLATSGAVLEPVVEDLAEAGIDISLPQLR--R-----
A0A4Q5A868      -----------------------------------------------MAQLK--E-----
A0A0W8I9Y2      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A4Q5APW3      -----------MSQIKSYP----VLTTTQSVLQPVI--ED-LGLHTTVAQLK--E-----
A0A4Q5B0V3      -----------MSQIKSYP----VLTTTQSVLQPVI--ED-LGLHTTVAQLK--E-----
A0A222TG79      VQAAYQGSLASQQRIASYA----QLASSDAVISNAV--SE-SRKSISSEDVR--K-----
A0A1Q2CRV2      ---MQAGSNYAANQVQSFA----KVAKSGFVLTPVI--ED-LQLSVTPEQLA--R-----
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          -SASYQNSLASAQRVASYA----ELVDSDVIVSRAL--ES-TGVGLKQDEAK--D-----
A0A1L2ZMQ6      --EAIAGNSLAQDRAGSYAVMASSQRTAERAVEKLEKQGV-ADVPDAGSLIS--------
A0A3L7ADK2      --NAYSSEALSKSQAASYA----TVATSLAVAERVE--KA-GVVKQSAGVLL--G-----
A0A0G3V3M7      --SGSANTSVNGRDYDRLA----LLMITGEVPKRVA--EA-IDEVRWPQIQNANANKCTE
A0A3E2DN22      --EAMSGNAIAQQRAATYT----KLVETRTMAQKTS--EI-LKKHGMPEAAN--G-----
A0A3Q9ULZ9      --GAMSGNTIAQQRASAYS----TLIGTEAVDNRVQ--KT-LGSKGLSKAAD--G-----
A0A3S9JFL2      --GAMSGNTIAQQRASAYS----TLVGTAAVDNRVR--AT-LNKQGLSKATD--G-----
A0A1Q2CI19      --PDAGAGYASLGRVALFI-------TTGEVPRNAA--AA-LGYEGDPALLA--K-----
A0A512T3M3      --NPQLPPSLPLGRIALYV-------TTGVVPVRVA--KK-VGFVGQPTELA--G-----
W6JTW4          --ERV---TVGLPRIAFFI-------TTGDIPQAAA--DK-LKYADGPFALA--R-----
A0A0A0JTY0      --AA-TAVAPNLDRVALYL-------KTGEVPKRAA--KK-VGYEGDPAVLA--S-----
A0A0A0JXF2      --TD-PERTGNMGRIPLYM-------TTGEIPRRAA--AV-VGYEGDPARLA--A-----
E6S8H2          --TE-TDSESPMGRIALYL-------TTGEIPQRAA--AE-LGYTGDPAVLA--S-----
A0A0A0JGH0      --AT-ADEQVSVDRVVLYA-------KTGAIPTAAA--KA-LEFEGDPAILA--S-----
N0E4U7          --GG-PPELVSIDRLALFI-------KTGEIPSRAA--KV-LSFDGDPALLA--S-----
A0A0A0IYK2      --TDPENPNPNMGRIPLYM-------TTGEIPRRAA--AA-VGYDGDPALLA--R-----
A0A0Q9L0H3      --NDPETGSTNLGRIALYM-------TSGEVPKRAA--AR-VDFTGDPALLA--S-----
A3TMK0          --KDPEATGSNLGRIALYL-------TTGEVPKRAA--AV-VKFEGDPALLA--R-----
A0A543PXP1      --S--ADSTAQMGRIALYL-------TTGEIPRRAA--AK-LGYTGDPAMLA--S-----
A3TMH6          --T--EDVNSQLGRIALFL-------TTGDIPRGAA--KR-LGYPGDPALLA--A-----
A0A5R8VLL6      --SLLAGDTLAKAKAKTYK----SLAESRLVADKVS--AS-TGVNMTGESLL--G-----
A0A1H6WL79      --LSLAGDSLAKSKAKGYQ----SVGESILVAESVI--RT-LGLKESAPDIT--R-----
A0A101LAM5      --MSLAGDSLAKSKAKGYQ----SVGESILVAESVI--KS-LGLKESAPDVT--R-----
A0A4Y3NEG0      --MSLAGDNLAKSKAKGYQ----SVGESILIAESVI--ES-LGLKESAPDIT--R-----
A0A1H6YPK1      --DEVGDAATVESRMAVYT----RLATSDQVAAVVA-----ESIGGDADALR--S-----
A0A2R7MGI0      --SALAGDQLALSKVKSFV----DMGYWRSVAEAAR--QT-LGVNDSPESLV--Q-----
A0A2T7WQY4      --SALAGDQLALSKVKSFV----DMGYWRSVAEAAR--ES-LGVEDSPESLV--Q-----
A0A1G6GTN3      --AALAGDQLALSKVKSFI----DMGYWRSVAETAR--QD-LGLSDPAESLV--Q-----
A0A1N7DLV3      --SALAGGTLALSRVKSFI----DMGYWKSVAETAR--DE-LGLTDSPESLV--Q-----
A0A1V2NSB5      --SALAGGTLALARVKSFI----DMGYWKSVAETAR--DE-LGLTDSPESLV--Q-----
A0A0Q5Q5L3      --AALAGDQLALSKVKSFI----DMGYWRSVADTAR--QQ-LGLSDSPEALV--E-----
A0A0Q6DVM4      --AALAGDQLALSKVKSFI----DMGYWRSVADTAR--QQ-LGLSDSPEALV--E-----
A0A1R3WWR6      --AALAGDQLALSKVKSFI----DMGYWRSVAETAR--TE-LGITDSPEALV--Q-----
A0A5Q2FA83      --TGGGGYVLTTNDLGTYE----QLVSSPVVMDPLR--QQ-LKLAPSTPL----------
A0A542FTE6      --LALAAENLAKSKAKTYV----ELAKSQAVAESV---AE-AIGSSSPGSLL--A-----
A0A2S5UYV0      --GYIGGSEAAIAKAQSYI----PLITSQPVYAKIAENPA-LGLAEG-QALT--G-----
A0A2S5X9U6      --GYINGSEAAIAKANSYI----PLITSQPVYAKIAENPD-SGLAEG-ETLN--G-----
A0A2S5ULV5      --SSIDGSEQAITKANSYL----PLITSQPVYAKIAENPN-SGLAAG-ETLT--G-----
A0A653YMF0      --GYINGSEAAIAKANSYL----PLITSQPVYNKIAENPN-SGLAAG-ETLN--G-----
A0A4V1VGV9      --SAVLSQQLSTGRAGYYA----QLASSSGVANRIAEESK-GSLRAGEFSVV--G-----
A0A3Q9IY80      AGSALVAENLAKAKVGSYL----DLGSWRAVAEHAI--AE-LGLTSSPESLV--N-----
A0A0F0LP73      --AVIAGTNIAIDRAGAYM----PLVDTAQVREEIAKDAK-VPLSK----LN--G-----
A0A1F1X071      IQQASGNMEFQYSKAQSYL----PLFNTRAVGQRIV--DE-LGLEASPDEVA--G-----
A0A3R8RWC7      IQQASGNMAFQYQKAQSYL----PLFNTRAVGQRIV--DE-LGLEASPDAVA--G-----
A0A4U0RJZ4      --AAMVNQQLANQRSGAYA----QLASGSGVADRVVALSN-GALSPGDFVLA--G-----
A0A4R1FGL9      --AAMVNQQLANQRSGAYA----QLASGSGVADRVVALSK-GALSPGDFVLA--G-----
E3B8H1          --AAMVNQQLANQRSGAYA----QLASGSGVADRVVALSK-GALSPGDFVLA--G-----
A0A0Q5AWK6      --DAISGAQTAVTRANAYL----PLISSSAVYERIQ--SD-PEANPGGEALN--G-----
A0A3N1NLD3      --DAISGAQTAVTRANAYL----PLISSSAVYERIE--SD-PEANPGGEPLN--G-----
A0A3N2FVI8      --DAISGAQTAVTRANAYL----PLISSSAVYERIE--SD-PEANPGGEPLN--G-----
A0A2S5XDQ6      --DAISGSQTAVTRANAYL----PLISSSAVSERIE--AD-PEANPGGEALS--G-----
A0A2S5XNN6      --DAISGSQTAVTRANAYL----PLISSSAVSERIE--AD-PEANPGGEALS--G-----
A0A538JQF8      ---ILANNTLAPEDTQKPLNVYALFIKVGEVPKLAA--ER-LGYKKEAFELVRSA-----
A0A0Q5JKD6      --AALAGDQLALSKVKSFI----DMGYWRSVAETAR--GE-LGLSDSPESLV--Q-----
A0A0Q9TBP0      --SASSGTKIDADEVATQV----QVVTSLPVSRLVQ--ER-FSL-ASPPDLS--E-----
A0A346XTB0      --QGIVSARIS---AEEYVPRQAARIQSRAVLQEAA--DL-IDNRISVGELG--S-----
A0A2W6DK08      ---VLQAPDVKEAVASTTL-----LVTAEPVAERVS--KM-LNTHHAPQDLL--L-----
A0A2S0LQ32      ---AWSANSVAQQKAGVFA----KLAGSAAVAQSVS--QS-LGL----QDLG--G-----
A0A2N6V1R5      ---AFSQNSISGQKASVYA----VLAGSQNVANRVA--KT-LKT----SNME--G-----
G9PHS6          ---AFSQNSISGQKASVYA----VLAGSQNVANRVA--KT-LKT----SNME--G-----
U1PLM7          ---AFSQNSISGQKASVYA----VLAGSQNVANRVA--KT-LKT----SNME--G-----
A0A351ETF8      --PFPATGPLALNREGEIE--------TLYVTSPAF--TE-AALLKSPPE----------
A0A349B7N2      --------------APPNLAQLSLLLRVGDVPERVA--AE-FG--VEPDVLV--S-----
A0A346Y185      ---LFGETGVNFLDPSRYVRNQAEFAQSNAVAERAS--VL-LGGRLDSDQVR--E-----
A0A259S8H9      ---VIAGSDEAVARAGAYM----PLINTSQVRDEIA--KE-AGVSA--AELH--G-----
A0A0Q5L115      --LAFAADQLAKSQAQSYV----ELGGSLAVAESAA--AA-LGGAASPASLL--G-----
A0A2W1Z497      --LDYAADQLSKSQAETYV----ELGGSLAVAKRVV--RA-TGTSASPQELL--G-----
A0A3L8NYD3      --DVYSATSLAQQKLSVYV----GLVSSTAVAQDVI--DS-LKLDETPSDIA--S-----
A0A1M6K628      --AGAR--NPAAEKAATYL----PLAESRSVAETVA--QE-LG--VQSGEVS--L-----
A0A561E8R3      --SALNGVSLAQTKAQEYA----ALASSAPVAERAA--QA-LGPNAPGGSIS--A-----
A0A1H4I042      -MDTYQGNLLSQERVRSYT----ILLTGEALAQRTI--DA-LHLDMSARALR--Q-----
A0A4R7A6D9      -MDTYQGNLLSQERVRSYT----ILLTGEALAQRTI--DA-LHLDMSARALR--Q-----
A0A4Q4D4T1      ---TSPATSLSGRAVESYA----HVLGGTALEQRAV--KALGLEDAGDAEVR--G-----
A0A261FE22      -----GASNGGSSPLASYA----QLVQSDAVLEPVV--NN-LGLHTSVAGLR--G-----
A0A5C8C085      --------------------------------------------NESPASLI--G-----
A0A1E4BP96      TGSPLVGDQLARSKVTSYL----DIGSWRAVAEHAI--ED-LGLSASPESLV--G-----
A0A101KZQ4      ------------------------MAKSRSVALDVQ--EN-LGIDTSINQLL--S-----
A0A439DNZ6      --------------MISYT----ELLMGETLAQRTI--DK-LDLEMSAGELQ--N-----
A0A0J6YE86      ---------------------------------------------MSADELQ--A-----
A0A5Q5BFU2      MADTYQGNRFSQERVISYA----ELLMGETLAQRTI--DK-LGLDMTAQALQ--E-----
A0A151BT98      -----QGTPVQRDDLATYA----QVVSAPAVQKVIR--QQ----AKLGPSVP--V-----
A0A2Y8ZRF8      -----QGTPVQRDDLATYA----QVVSAPAVQEVIR--KQ----AKVGPTAA--V-----
A0A2R9UAT1      ----MLANNLALSKVVSYV----DIGSWRSVAEYAI--EK-LRLDSSPEALV--R-----
A0A4Q5J5D7      ------ADTLAKSRAKSYV----DIARSRATAEGVI--DE-LGLDDSPASLI--G-----
A0A1Y4CKD6      GSSLYSSVSSASQLSKTFP----YVLDSSYFRGVLE--DA-----LGTDSLD--G-----
A0A0Q7KBQ4      QVTDPTAAYFASQRLASYA----DLAREPSLLQDVI--NRLNLTGVTREELA--G-----
A0A1F1IHY9      LGVALTADNLAKSKAQQYA----LLGESRAVSDKAV--EE-LPFDLSSGEAL--R-----
A0A542HCT5      PGEASVLDSLAKSRATSYV----DLAQGRATAQDVI--KT-LGLDAQPAGLI--G-----
A0A2S8WHZ8      IGNALAGDNLAKSKAVGYK----SIAGTRTIADLVR--KE-LKLDESSDVLL--G-----
A0A537WNY9      --KTLNDPNSAYVFFGTLD----AIVPVYADAAAAR--STKERASALLGRSV--A-----
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      GADAYSSLAQASQMTAVYS----EVFQSSALRNEIS--AS------VGEPVE--G-----
A0A0Q5M6Z7      LSMAFAGESLAKSRAESYV----RVANSDAVADRAR--KI-LGTDRSIGDLL--G-----
A0A3N3ZPU0      LGDYMTADSVSLSKADSYM----QLGGSPEVAQIAA--ES------LDGTPV--H-----
A0A359IQX7      IGDATAGMVLAEQKAAAYT----ILTGTRQVSQDVA--DG--LRSKYGKDVP--F-----
A0A4R8TXC3      TIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQ--EKNPNMGMTVSGIR--G-----
A0A433EDP2      TIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQ--EKNPNMGMTVSGIR--G-----
A0A231VTW0      TIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQ--EKNPNMGMTVSGIR--G-----
A0A433ECD0      TIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQ--EKNPNMGMTVSGIR--G-----
U7V3Z1          TIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQ--EKNPNMGMTVSGIR--G-----
A0A1F1J417      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--LSIGTIR--G-----
A0A2A8D6P2      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--LSIGTIR--G-----
A0A1F0THV9      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--LSIGTIR--G-----
A0A5F0M6Y0      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--LSIGTIR--G-----
D8USQ4          TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--LSIGTIR--G-----
E3H5W1          TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--LSIGTIR--G-----
A0A1F1QKB0      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSN--LSIGTIR--G-----
A0A509JY23      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--LSIGTIR--G-----
A0A448USF4      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--LSIGTIR--G-----
A0A0Q9LZR0      PGEASVGDSLAKSRATSYV----DLAKSRATAQDVI--NT-LGLGAQPAGLI--G-----
A0A1N7E3F1      LSTALQAGALSQQRVQSYA----ALLTSRQVVGRIA--GG-----EDVADVQ--A-----
A0A544ZKQ1      LSTALQAGALSQQRVQSYA----TLLTSRQVIGRIA--RG-----EAVDDLQ--A-----
A0A372P1T1      LSTALQAGALSQQRVQSYA----TLLTSRQVVGRIA--RG-----EDVTDLQ--A-----
A0A5D0Q2X0      LSTALQAGALSQQRVQSYA----TLLTSRQVVGRIA--RG-----EDVTDLQ--A-----
A0A5R8Z2E7      LSTALQAGALSQQRVQSYA----TLLTSRQVVGRIA--RG-----EDVTDLQ--A-----
A0A1L2ZMV4      LGSYLSAETLANTKAETYL----ALGNAPEVSQLVS--KHFAEEGQAVS--W--K-----
A0A1S1CAD0      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNTPELSLTTGQIR--S-----
G5ET14          TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNTPELSLTTGQIR--S-----
A0A1E9DXX2      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--G-----
A0A1E8S156      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--G-----
A0A1E8S5S2      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--G-----
A0A1S1DFA8      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--G-----
A0A2I1Z490      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNTPELSLTTGQIR--S-----
A0A1F0DAA9      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSLSTGQIR--S-----
A0A1F0PHK9      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSLSTGQIR--S-----
A0A1F0VZG6      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSLSTGQIR--S-----
A0A1E9G8X4      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--A-----
A0A1E9IAW2      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--A-----
A0A1E9ZBC9      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--A-----
A0A1E9ZDP4      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--A-----
A0A1F0R6B5      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--A-----
A0A1F0Z7N5      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--A-----
A0A1F1D897      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--A-----
D2NP38          TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--A-----
A0A1F1FV74      TVDVLSGSSAAKERARSYA----AIVSSEAVAQKIK--QNNPDLSLTTGQIR--A-----
A0A1E9M791      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--A-----
A0A291DEI8      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSMTTGQIR--A-----
A0A1S1D5T1      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNTPELSLTTGQIR--S-----
A0A1E8TRD6      TVDVLSGSSAAKERARSYA----AIVSSEAVAQKIK--QNNPELSLTTGQIR--A-----
A0A1F0XT88      TVDVLSGSSAAKERARSYA----AIVSSEAVAQKIK--QNTPELSLTTGQIR--A-----
A0A1F1EVP5      TVDVLSGSSAAKERARSYA----AIVSSEAVAQKIK--QNNPELSLTTGQIR--A-----
C6R548          TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNTPELSLTTGQIR--S-----
A0A0K2RXS2      TVDVLSGSSAAKERARSYA----AIVSSEAVAQKIK--QNNPELSLSTGQIR--A-----
A0A1F0KX60      TVDVLSGSSAAKERARSYA----AIVSSEAVAQKIK--QNNPELSLSTGQIR--A-----
A0A542I3V2      VNTLLTGDALAKSKIKNYE----SIAESRLIADQVI--AT-VGLNTTADALL--P-----
A0A2T0UZ65      TGDVFAGSTLAGSKAESYL----PLINSRAVGKRAG--EI-IGSDAPPEVLA--A-----
A0A1R4JTI6      LGIALTADNLAKSKATQYQ----ELATSRAVAEGAV--KQ-AGLDISPEAAS--G-----
A0A4R7TM52      TGGALIADNLAKSKVKSYL----DVGTWRSVADDAI--SQ-LGLNTQPEALV--R-----
A0A542XE74      VGDTMSGDTVTVSRASMYA----SLVNTSAVAQRAD--RT---LASQGITRD--G-----
A0A0G3V3F3      LGINADQATFL---AKSYA----LYAETPRVTAAAA--KS-SGLDITANDAA--S-----
A0A0Q7QDF6      ------ATSLSGRAVESYA----HVLGGTALEQRAV--KA-LGLEDAGDA----------
A0A3S0V9U6      AGEILSGDAAAQSKAKAYL----PLITSAPVAQKIA--SS-SKTSLDAAAIP--S-----
A0A2R7Z032      AGEEMSNQSLASDKAALYV----ALANTTPVAERVV--EK-LGLDVDPGAIA--G-----
A0A1I0W453      AGEEQGNAQLAEDKANLYA----FLVSKTPVAAQVV--ED-LDLDVPPEAIA--G-----
A0A1H4LCS9      AGEEQNNAQLAEDKANLYA----FLVSKLPVAQLVV--DD-LGLDVPPEAIA--G-----
A0A4Q2RZP8      AGEEQGNAQLAEDKANLYA----FLVSKLPVAQLVV--DD-LGLDVPPEAIA--G-----
A0A0Q6VV12      AGEEQGNAALAEEKAGLYA----FLVSSMPVAEKVV--DD-LGLDVPPSEIA--G-----
A0A495NTA9      AGEEQGNSALAEEKAGLYA----FLVNSEPVAEKVV--ED-LGLSTPPSEIA--G-----
A0A0Q9QB08      AAEEQGNASLAEDKANLYA----FLVPTTPVAEQVV--KE-LGLDMPPSAIA--S-----
A0A4Q2SA86      AGEEQGNAQLAEDKAVLYA----FLVSTTPVAEKVV--ED-LGLDVPPSAIA--G-----
A0A4Z1C3Z0      AAEEQGNAQLAEDKAVLYA----YLVSTTPVAERVV--ED-LGLDVPPSAIA--G-----
A0A5R8L819      AGSALIGENLAKAKVKSYI----DLGSWRAVAQHAI--DE-LGLKVTPEYLV--N-----
A0A261FQA1      AQSAAADGSTSDSRMGVVS----RVATSSAVLEPVI--DE-LDLDTSVDAMA--S-----
A0A1Q2CJ92      VGDAFAGSTLAAEKAGTYL----PLVQSRSVANRIA--EE-LALP-STGPVV--G-----
A0A2T0S3C8      VTDAYQGGLFSQQRVKSYA----TLLTGDRLAKVVA--AKTPGLELTPAEVR--E-----
A0A4Y8WZJ3      LGVALTADNLAKSKAQQYA----LLGESRAVSDKAV--EE-LPFDLSSGEAL--R-----
A0A285VUW0      SGNLYQ---MPAGERSTLA----RIARSPLMLDPVR--ET-LGLDASVPLSV--E-----
A0A4Q2JUT1      VSNVSLGDSVARSRVPSYL----VMAGWTDVAQGVI--DD-LDLSTTPEALI--Q-----
A0A542J310      VSNVSLGDSVARSRVPSYL----VMAGWTDVAEGVI--AD-LGLETTPEALI--E-----
A0A444BL03      TGESIAANSLGGSKADSYL----PLVTSRAVAQRAI--TA-TGIDASPEDVA--R-----
A0A4Y8X357      GEASISGTETAQTRAQSYV----PLINSRTVRERIS--QG------GVDTAG--A-----
R4LD52          VTDAYQGGLFSQQRVKSYA----SLLVSDRLAQLVA--AE-PGVGLDARHIR--E-----
A0A4T2CD79      IGDTVASDALAKSKATTYV----AVGESRAVAQLVI--TA-LGLTASPETVA--G-----
A0A4Q4D742      GQTEYVAAYTLQQRVASYA----DLAVDPAVLQTVV--DR-LNLDESPTQLA--G-----
A0A4Q2RU39      AGEEQGNNQVAEDKANLYA----FLVSKTPVAQEVV--DE-LGLDVPPSAIA--G-----
A0A4Q2SK58      AGEEQSNSQLAEDKANLYA----FLVTKTPVAAEVV--DD-LGLDVPPEAIA--G-----
A0A2N3YJR1      TGEGIAANALSGSKADSYL----PLVTSRAVAQRAI--EA-TGVKASPASVA--S-----
A0A1C6T1J1      VAAAYQGGLFLQQRIKSYA----DLLVSDRLAQSVV--AE-GQVGLTAEQIQ--G-----
A0A2W2CFC8      VSDAYQGGLFLQQRVKSYE----QLLTSDRLARSVV--AD-NQLGLTAEQVR--G-----
A0A2W2A4B0      ALDLAQGTNAAQQRIHSYL----DLVPQPIVLQPVI--DE-LHLDVKASELA--R-----
A0A4Y9MDA5      AGDLAQGSNYLQGQVTSFA----LLAETPTVLGPAG--EA-PDVAA-TGSLA--G-----
A0A1H7N9P7      AGDLAQGSNYLQSQVASFA----LLAETPTVLGPAG--EA-PDVAAGSRSLA--A-----
A0A1M7V0F8      AGDLAQGSNYLQSQVSSFA----LLAGTPTVLGPAG--ER-AGVSADARSLA--G-----
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      DTRVRRDSDVTTVIDAPVL-----------------------------------G-----
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A538BYZ4      RALRGQIESSSLPAVVEPS-----------------------------------P-----
A0A4R1CW45      ----------MAEAVSSSM-----------------------------------N-----
A0A4R5Z7B0      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A510HHA8      ----------MVRLNLKRR-----------------------------------A-----
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ---------------KPVV-----------------------------------G-----
A0A1I6IST1      ---------------KPVV-----------------------------------G-----
A0A412JBM5      ---------MMGMAMSHEL-----------------------------------K-----
A0A1C2B334      ------MGVVDSPV----I-----------------------------------G-----
R7Y679          GTRIRDEGDLDDAIGVHSL-----------------------------------G-----
A0A5Q2F9A3      DTRVRTASDVAQLTDSPLV-----------------------------------G-----
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A023X491      -------------MARSKP-----------------------------------L-----
A0A4R1BMZ2      -------------MIISRR-----------------------------------K-----
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------TIDAPVL-----------------------------------S-----
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      --------------------------------SIEVTIPLNTVILEIKSSSGDPESAAEI
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      --------------------------------VIDSNIATDTGNMRVVCRLPDPLRAERC
A0A538AM15      --------------------------------FFKALEQAERDRALQQGRAPEAPPPAPV
A0A022KX11      ------------------------------------------------------------
A0A255G8R8      ---------------------------------MTTTVPQKTVIVEVTVTDPDAASAARI
A0A4Y5YMQ6      --------------------------------AVAVTIPQNTVILDITAASADPRDAAEI
A0A4Q5A868      --------------------------------QVSVTNPTNTAFVNISVTDGDPAQAADI
A0A0W8I9Y2      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A4Q5APW3      --------------------------------QVSVTNPTNTAFVNISVTDGNPAQAADI
A0A4Q5B0V3      --------------------------------QVSVTNPTNTAFVNISVTDGNPAQAADI
A0A222TG79      --------------------------------KLSTSWDPDTVLLNVTVEDSDRSVAVVL
A0A1Q2CRV2      --------------------------------RVAVTIPAQTATMDLAVTADSPEEAARI
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          --------------------------------SLSVSTSPDTVLLVVTAENANPDLAARL
A0A1L2ZMQ6      --------------------------------SITAAVLEGSTELRVTASASDPVFAQQL
A0A3L7ADK2      --------------------------------RITALQPQDTVLIEITAKGPTGDSARTL
A0A0G3V3M7      TGADATSPDCKKSGRRVSAGSGQVELGTGGFIKASAIPDPATGSLAITAQVGDAELAAKV
A0A3E2DN22      --------------------------------QVSASVPGDTAFIDIKATGGTAKNAQAL
A0A3Q9ULZ9      --------------------------------TLAAKVVSGTSFIKITATGSSALNAQSL
A0A3S9JFL2      --------------------------------TLSAKVVTGTSFIRITATGSSAQNAQAL
A0A1Q2CI19      --------------------------------QITVETQGESASVTITTTASDGERAANV
A0A512T3M3      --------------------------------RIDVGQDSEAMALTITSSNTDSKRAGLI
W6JTW4          --------------------------------RIVVAPDPAASTISISATDPHATTAESI
A0A0A0JTY0      --------------------------------GLTVVTDPAAQAITVAATASDGKQAAAV
A0A0A0JXF2      --------------------------------GLTVTPDNAAEALTVSATASDGEEAAAV
E6S8H2          --------------------------------GLTVTPDFSAGALTVAVTDAEGKRAASI
A0A0A0JGH0      --------------------------------QVTITSDPSGAALTIAASDRDGAKAAET
N0E4U7          --------------------------------QITVTPDPAAAALTIAASAPDGERAAAT
A0A0A0IYK2      --------------------------------GLTVTPDVVAAAITVSATASDGSRAAAV
A0A0Q9L0H3      --------------------------------GLTVTPDTVAQALTVSATASDGKQAAAV
A3TMK0          --------------------------------GLTVTPDTVSQALMVSATASDGKQAAAV
A0A543PXP1      --------------------------------GLTVTPDFNAAALTVAATAPDGQRAAAV
A3TMH6          --------------------------------GLTVKPEFIATALTVSATASDGARAAAV
A0A5R8VLL6      --------------------------------AVTVTVPRDTAEMRIKAESPNPTTAQRV
A0A1H6WL79      --------------------------------SISVSVPLDSVEIRITARSSDAQTAQNV
A0A101LAM5      --------------------------------SISVSVPLDSVEIRVSARSSDPQTAQNV
A0A4Y3NEG0      --------------------------------SVSVSVPLDSVEIRISARSSDPQTAQNV
A0A1H6YPK1      --------------------------------RISVSGSTETAIMLFTGTGSAPESAQEL
A0A2R7MGI0      --------------------------------RVRVSNPVDTVNVRVDATGPTPESARDL
A0A2T7WQY4      --------------------------------RVRVSNPVETVNVRVDATGSTPESARDL
A0A1G6GTN3      --------------------------------RIRVSNPVDTVNVRVEATGPTPESARDL
A0A1N7DLV3      --------------------------------RIRVSNPVDTVNVRVDATGPTPEAARDL
A0A1V2NSB5      --------------------------------RVHVSNPVDTVNVRVDATGPTPEAARDL
A0A0Q5Q5L3      --------------------------------RIRVSNPVDTVNVRVDATGATPESARDL
A0A0Q6DVM4      --------------------------------RIRVSNPVDTVNVRVDATGATPESARDL
A0A1R3WWR6      --------------------------------RVHVSNPIDTVNVRVDATGPTPESARDL
A0A5Q2FA83      --------------------------------NVTAKAATGSPMLDITATSSSPRVAADA
A0A542FTE6      --------------------------------ATTPYLADDSSLIQISASASTPEAARVL
A0A2S5UYV0      --------------------------------RLSASVAPGSNLIQVQASADSPSSAVAL
A0A2S5X9U6      --------------------------------RLSATVAPNSNLINVQATASTPSSAVAL
A0A2S5ULV5      --------------------------------RLSATVAPNSNLIQVSASASTPSSAVAL
A0A653YMF0      --------------------------------RLSATVAPSSNLIQVSASASTPSSAVAL
A0A4V1VGV9      ------------------------------------ASSEGSATLTLTASAATPAKAQRA
A0A3Q9IY80      --------------------------------RVQVSNPTDTVNIRVVASASSPEGARDL
A0A0F0LP73      --------------------------------SLSAQVVPGSTMVRVTANAPDPQSALRL
A0A1F1X071      --------------------------------SLQTTLDPNAPIITVEAVAPTAEEASAI
A0A3R8RWC7      --------------------------------SLQTTLDPNAPIITVEAVAPTAEEASAI
A0A4U0RJZ4      ------------------------------------AGSEGTSNLSLTASSSSAAKAQQA
A0A4R1FGL9      ------------------------------------AGSEGTSNLSLTASSSSAAKAQQA
E3B8H1          ------------------------------------AGSEGTSNLSLTASSSSAAKAQQA
A0A0Q5AWK6      --------------------------------RLTASVAPGSTLIQVTAEASTPENAAAL
A0A3N1NLD3      --------------------------------RLTAAVAPGSTLIEVTASASTPENAAAL
A0A3N2FVI8      --------------------------------RLTAAVAPGSTLIEVTASAATPENAAAL
A0A2S5XDQ6      --------------------------------RLTARVAPGSTLIEVTAAAGTAQNAAAL
A0A2S5XNN6      --------------------------------RLTARVAPGSTLIEVTAEAGTAQNAAAL
A0A538JQF8      --------------------------------NVQARPNVEVGTLTITANDRDPKRAALI
A0A0Q5JKD6      --------------------------------RVRVSNPIETVNVRVDATGPTPESARDL
A0A0Q9TBP0      --------------------------------LVSVQAVGTSRILRVTAQDSSPDRAART
A0A346XTB0      --------------------------------NFDIESSAETLEIVLVAEDETAEGAAEL
A0A2W6DK08      --------------------------------KVTAVADKPSNAINITASDVDPQNAVAL
A0A2S0LQ32      --------------------------------SLTGAAEPSSPIVTITAVSSDPSRARDL
A0A2N6V1R5      --------------------------------TLSGSADAVPGLFTLTATASTPERARDI
G9PHS6          --------------------------------TLSGSADAVPGLFTLTATASTPERARDI
U1PLM7          --------------------------------TLSGSADAVPGLFTLTATASTPERARDI
A0A351ETF8      ---------------------------------VKVAAAGTGSTLTFNARGAVPEDLAAA
A0A349B7N2      --------------------------------QVQVRQNPQVATLDITSVGTDPDRAVRI
A0A346Y185      --------------------------------QSRIRPASDLDQLSISATDGTASGAAQI
A0A259S8H9      --------------------------------SLSARVVPGSTLVEVTADAADPKSALKL
A0A0Q5L115      --------------------------------RVTTSLPEDTAIITVTSRGSTPADAAAL
A0A2W1Z497      --------------------------------RVQTRLPEGTAIIDVTASGATPRESADL
A0A3L8NYD3      --------------------------------RFSAVGDADNPQLTIYATASSPSQARDL
A0A1M6K628      --------------------------------DAKNDGVI----FEITAQAPTAEGARLM
A0A561E8R3      --------------------------------SVSAVSSV----INFTAISSTPNGAREL
A0A1H4I042      --------------------------------EVSARSKMGTVLIDVDVLDPSPVRARDI
A0A4R7A6D9      --------------------------------EVSARSKMGTVLIDVDVLDPSPVRARDI
A0A4Q4D4T1      --------------------------------EVVG----NSSVVRVVVRTTDPERAAQL
A0A261FE22      --------------------------------NVSASASDGSAFVSMTVTYSDPNDTVTI
A0A5C8C085      --------------------------------RISAEQPTDTVLIKITAKADSPHAAQAL
A0A1E4BP96      --------------------------------NVTVSNPLDTVVIHVAATAATPESARDL
A0A101KZQ4      --------------------------------SISIANPVDTATLKVSAESNTPESAQQL
A0A439DNZ6      --------------------------------KVKASSKLDTVLINVSVLDESPVRARDI
A0A0J6YE86      --------------------------------RITATAKPDTVLIDVAVLDESAVRARDI
A0A5Q5BFU2      --------------------------------NVKAGAKPDTVLIDVAVLDQSPVRARDI
A0A151BT98      --------------------------------TVSATLSDTANIMTATASSGSAQEAAAI
A0A2Y8ZRF8      --------------------------------NVNATLSDTANIMTGTASSGSAQEAAAI
A0A2R9UAT1      --------------------------------RVDVTNATGTVTIKVQASAPTPETARDL
A0A4Q5J5D7      --------------------------------KISVEQPLDTVLIKVTARDATPLGAQQL
A0A1Y4CKD6      --------------------------------TIEAQTIDNSNMVTMWVDSASPENARAI
A0A0Q7KBQ4      --------------------------------QVTAQIIATTQTLQVDVTADSAELAQQI
A0A1F1IHY9      --------------------------------NVEVASTSGSAQIVVRAEDSSPERAQQL
A0A542HCT5      --------------------------------RITVKQPLDTVGIKISARASTPRGAQQL
A0A2S8WHZ8      --------------------------------KVEVTVPTNTAEIRVTASSQGAEEARNL
A0A537WNY9      --------------------------------AISVETFKGTGIIKITARSTSRSLAQQS
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      --------------------------------SVSCSQVSGTNLLTLSVTSPTPRQAYLF
A0A0Q5M6Z7      --------------------------------HIQASLPADTAVIEITARASTPDGAAKL
A0A3N3ZPU0      --------------------------------DVAFSVVPGTSQIKVEGRSDSPEGSAKV
A0A359IQX7      --------------------------------SLSPGVTGGSVLFTVTAIAPTPSEAKDA
A0A4R8TXC3      --------------------------------SVTASTDENSSLIKVSAHASTPEQAQVL
A0A433EDP2      --------------------------------SVTASTDENSSLIKVSAHASTPEQAQVL
A0A231VTW0      --------------------------------SVTASTDENSSLIKVSAHASTPEQAQVL
A0A433ECD0      --------------------------------SVTASTDENSSLIKVSAHASTPEQAQVL
U7V3Z1          --------------------------------SVTASTDENSSLIKVSAHASTPEQAQVL
A0A1F1J417      --------------------------------SLSATTEENSSLIKVRATASSPEQARVL
A0A2A8D6P2      --------------------------------SLSATTEENSSLIKVRATASSPEQARVL
A0A1F0THV9      --------------------------------SLSATTEENSSLIKVRATASSPEQARVL
A0A5F0M6Y0      --------------------------------SLSATTEENSSLIKVRATASSPEQARVL
D8USQ4          --------------------------------SLSATTEENSSLIKVRATASSPEQARVL
E3H5W1          --------------------------------SLSATTEENSSLIKVRATASSPEQARVL
A0A1F1QKB0      --------------------------------SLSATTEENSSLIKVRATASSPEQARVL
A0A509JY23      --------------------------------SLSATTEENSSLIKVRATASSPEQARVL
A0A448USF4      --------------------------------SLSATTEENSSLIKVRATASSPEQARVL
A0A0Q9LZR0      --------------------------------SITVTQPVDTVLLKISARAATPRGAQQL
A0A1N7E3F1      --------------------------------RITANAIPETTLLRATVADSVPTRAAAR
A0A544ZKQ1      --------------------------------RITAGAVPDTTLLRATVADSVPARAAAR
A0A372P1T1      --------------------------------RITADAIPDTTLLRATVADSVPVRAAAR
A0A5D0Q2X0      --------------------------------RITADAIPDTTLLRATVADSVPVRAAAR
A0A5R8Z2E7      --------------------------------RITADAIPDTTLLRATVADSVPVRAAAR
A0A1L2ZMV4      --------------------------------GVTFTKDPSNSQIRVTATAENPEHARAS
A0A1S1CAD0      --------------------------------SITAAAGENAALITVSAKASSPKNAQLL
G5ET14          --------------------------------SITAAAGENAALITVSAKASSPKNAQLL
A0A1E9DXX2      --------------------------------SLTATAGENAALITVNAKASSPKNAQLL
A0A1E8S156      --------------------------------SLTATAGENAALITVSAKASSPKNAQLL
A0A1E8S5S2      --------------------------------SLTATAGENAALITVSAKASSPKNAQLL
A0A1S1DFA8      --------------------------------SLTATAGENAALITVSAKASSPKNAQLL
A0A2I1Z490      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1F0DAA9      --------------------------------SLTATAGDNAALITVNAKASSPKNAQVL
A0A1F0PHK9      --------------------------------SLTATAGDNAALITVNAKASSPKNAQVL
A0A1F0VZG6      --------------------------------SLTATAGDNAALITVNAKASSPKNAQVL
A0A1E9G8X4      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1E9IAW2      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1E9ZBC9      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1E9ZDP4      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1F0R6B5      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1F0Z7N5      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1F1D897      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
D2NP38          --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1F1FV74      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1E9M791      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A291DEI8      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1S1D5T1      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1E8TRD6      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1F0XT88      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1F1EVP5      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
C6R548          --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A0K2RXS2      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A1F0KX60      --------------------------------SLTATAGDNAALITVSAQASSPKNAQLL
A0A542I3V2      --------------------------------TVSVNVPVETAEIRITATSPDPVMAQRV
A0A2T0UZ65      --------------------------------RVAGSVAPGSVILKINATGPTPTDARDL
A0A1R4JTI6      --------------------------------AVTATVPPDTAEVRLSVVQDSPDAARAL
A0A4R7TM52      --------------------------------QVKVTNPTDTVNLVVQASASTPEGARDL
A0A542XE74      --------------------------------TVTATASEGSPFINVTAQAPTARDAQAL
A0A0G3V3F3      --------------------------------LISASAVGDLGFLEVYAKGPSVSEAEQL
A0A0Q7QDF6      --------------------------------EVRGEVVGNSSVVRVVVRTTDPERAAQL
A0A3S0V9U6      --------------------------------HLEPSVEDGSTLIRVRATASSPEDAVAL
A0A2R7Z032      --------------------------------RFSASVDTDINLLTVQAIGTTPEEARDL
A0A1I0W453      --------------------------------RFSASVDADVNALTVTAIGTTPEEARDL
A0A1H4LCS9      --------------------------------NFSASVDTTVNALTVTATASTPQDAQDL
A0A4Q2RZP8      --------------------------------NFSASVDTSVNALTVTAVSTSPTDARDL
A0A0Q6VV12      --------------------------------RFSATVNADVNALTITAIGSTPEQARDL
A0A495NTA9      --------------------------------RFTATVNADVNALTVTAIGSTPEEARDL
A0A0Q9QB08      --------------------------------RFSATVNSDVNAITISAVGTTPEEARDL
A0A4Q2SA86      --------------------------------RFSASVDASVNALTVTAIGSTPEEARDL
A0A4Z1C3Z0      --------------------------------RFSASVDASVNALTVTAIGSTPQEARDL
A0A5R8L819      --------------------------------RVAVTNPLDTVNINVRAQASTPEGARDL
A0A261FQA1      --------------------------------SVSASV-DASGLMTVTATSSDSQQAADI
A0A1Q2CJ92      --------------------------------NLEGSV--DGVIFRIRATADSPELAASL
A0A2T0S3C8      --------------------------------RITAEALPETVLLQATVTDGSAERSRLI
A0A4Y8WZJ3      --------------------------------NVEVASTSGSAQIVVRAEDSSPERAQQL
A0A285VUW0      --------------------------------AVPGG--DDTALFDFVVRSDSPDHASAV
A0A4Q2JUT1      --------------------------------RVTVENPTGTVILSVTAQAPTAEGAREL
A0A542J310      --------------------------------RIVVENPAGTVILSVTARAETAEGARAL
A0A444BL03      --------------------------------RVTGTVAENSVIMQVTATGPTPDESRRL
A0A4Y8X357      --------------------------------SLSAALVPGSNLITVSAIAPDAQQAAAL
R4LD52          --------------------------------RVAAQAVPETVLLQATVTDTDRDRSARI
A0A4T2CD79      --------------------------------EITVTNIKDTPTINVTARASSGIEAKKL
A0A4Q4D742      --------------------------------QISATVVTGTINIQIDVTADTAEQAQLI
A0A4Q2RU39      --------------------------------RFSATVDASVNSITISAIGTTPVEARDL
A0A4Q2SK58      --------------------------------RFSASVDAAVNSLTVSAVGTTPEEARDL
A0A2N3YJR1      --------------------------------RVTASVAPDSVILKVTATAPSPEEARVL
A0A1C6T1J1      --------------------------------RVSTSTETGTVLLRASVTDTDQTRALKL
A0A2W2CFC8      --------------------------------RISTSTETGTVLLRASVVDTDQTRALRV
A0A2W2A4B0      --------------------------------SVSATSPTGSVVMQIAVTSPDRQRVAEI
A0A4Y9MDA5      --------------------------------QVTATVVPDTVIVAITATDPSADRAAAI
A0A1H7N9P7      --------------------------------QVSASVVPETVVVQISATDPSPARAAAI
A0A1M7V0F8      --------------------------------RVTATVVPETVVVRIAATDPSPARAAAI
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      --------------------------------SLSRNEAYVGTSPVIISRPASREA----
A0A357ZCV8      ---------------------------------------------MARHRKVGREQESPG
A0A419GS64      ------------------------------------------MAMKTKSRGSKYLYTKDF
A0A538BYZ4      --------------------------------AAPVREPGPTPATGAVDGADEHLVSLLT
A0A4R1CW45      --------------------------------IKSLQLETLRVVQPNRDAVASNNVVGFD
A0A4R5Z7B0      -------------------------------------MVFKKNKKVRTTDPARKLIANLD
A0A2V2CXY5      -----------------------------------------MASEGRAGMKELVIRNMPK
A0A2S8MDM2      ---------------------------------------------LDKERRKQPAISFET
A0A357ZDL3      --------------------------------------------------MSKKNNKSFS
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A510HHA8      --------------------------------REEQRNGDLSGRLITLHDPSNPAS----
A0A538BBM6      ----------------------------------------------MRTRSSRGGAEVRS
A0A1I6GVG4      --------------------------------TIPEEKSFTADNRLLPFDGGTSRSSESA
A0A1I6IST1      --------------------------------TIPEEKSFTADNRLLPFDGGTSRSSESA
A0A412JBM5      --------------------------------RESGHMRPACDRKLLTYDSPFAIR----
A0A1C2B334      --------------------------------LVPGDSALDGEGFVDFGAGGSVIA----
R7Y679          --------------------------------VVASDGAFADRSLIDFRAGGSSTA----
A0A5Q2F9A3      --------------------------------RIGYDAASERGLTLISDAITSPRA----
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A023X491      --------------------------------KKHKKTENLTDRLVSLSDPGGQAA----
A0A4R1BMZ2      --------------------------------KRSEREEDLSGRLVTILDPEGPAA----
A0A1Q7WJN6      -------------------------------------MPHVERRNGSGEEGAAGVI----
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ----------------------------------------MGEHLVSLLNPASFEA----
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      --------------------------------SVAYDADVPKHPLLTEVGSHSTRV----
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      ANGV-------------------ADSLTAVVREIS-------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ANAF-------------------AKQAVVFSKKDRLLSA---------------------
A0A538AM15      VPEV-------------------HTANEAAPRQEPLVAV---------------------
A0A022KX11      -----------------------------MAGEFS-------------------------
A0A255G8R8      ANAI-------------------GDQVAETVRELS-------------------------
A0A4Y5YMQ6      ANSV-------------------ADNLTEVVYDIA-------------------------
A0A4Q5A868      ANAI-------------------AKSLSSVVETTL-------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A4Q5APW3      ANAI-------------------AKSLSSVVENTLYASG---------------------
A0A4Q5B0V3      ANAI-------------------AKSLSSVVENTLYASG---------------------
A0A222TG79      ANSV-------------------AASLQDYVESLE-------------------------
A0A1Q2CRV2      AHAI-------------------TERLIVAVDELS-------------------------
A0A2S5WZJ5      --------------------------MADVITDVE-------------------------
K6WHS4          ASGV-------------------SQALIEYVEVLE-------------------------
A0A1L2ZMQ6      ANVW-------------------IDALAEEAHDIESTGV---------------------
A0A3L7ADK2      ADAW-------------------ITAMSEQIEAIQGNDG---------------------
A0A0G3V3M7      ANLF-------------------AAKLVGYVDELGQKQY---------------------
A0A3E2DN22      ANAG-------------------LEALISEALRMETYGQ---------------------
A0A3Q9ULZ9      ANAA-------------------LVGLQAEALRMETYTQ---------------------
A0A3S9JFL2      ANAA-------------------LVGVQAEALRMETYSQ---------------------
A0A1Q2CI19      VNTF-------------------ANETIAFFET-SPPGA---------------------
A0A512T3M3      VNTF-------------------ADEAVAFFSG-TRPEA---------------------
W6JTW4          AQTF-------------------AEAAKAYFAK-ASP-S---------------------
A0A0A0JTY0      ANAF-------------------ANETINYIKEKPRAGV---------------------
A0A0A0JXF2      ANAF-------------------ATETVKFFKETSPPGA---------------------
E6S8H2          ANTF-------------------ADETVTYFKK-NRPGV---------------------
A0A0A0JGH0      ANAF-------------------AKQTVAFFAK-PRPGV---------------------
N0E4U7          ANAF-------------------ADETVAFFEK-GAPGT---------------------
A0A0A0IYK2      ANAF-------------------ATETVKFFRERSRPGA---------------------
A0A0Q9L0H3      ANAF-------------------ATETVKFIEERKRPGA---------------------
A3TMK0          ANAF-------------------ANQTVLFIEQARRPGA---------------------
A0A543PXP1      ANAF-------------------ADETVAFFKQ-SRPGT---------------------
A3TMH6          ANAF-------------------ADEAVSFFDT-PRPGT---------------------
A0A5R8VLL6      ADAW-------------------IVELARQVEERERAAA---------------------
A0A1H6WL79      ADAW-------------------VAALASQVYELDKGNA---------------------
A0A101LAM5      ADAW-------------------VTALAAQVYELDKGNA---------------------
A0A4Y3NEG0      ADAW-------------------VAALASQVYELDKGNA---------------------
A0A1H6YPK1      VNAW-------------------MDATFLVVSDVERTSR---------------------
A0A2R7MGI0      AEAW-------------------IRGMTTQVDDLETGGT---------------------
A0A2T7WQY4      AEAW-------------------IRGMTTQVDELETGGS---------------------
A0A1G6GTN3      AEAW-------------------IRGMTVEVDQLETGAG---------------------
A0A1N7DLV3      AQAW-------------------LQGMTVQVDQLESTGG---------------------
A0A1V2NSB5      AQAW-------------------LHGMTVQVDQLESTGG---------------------
A0A0Q5Q5L3      AEAW-------------------IRAMTTQVDELESGGS---------------------
A0A0Q6DVM4      AEAW-------------------IRAMTTQVDELESGGS---------------------
A0A1R3WWR6      AEAW-------------------IRGMTTEVDQLQSGGN---------------------
A0A5Q2FA83      ANAV-------------------GPQLASIGKEFAPLLN---------------------
A0A542FTE6      ADAW-------------------IAAMSQRVEELEVPEG---------------------
A0A2S5UYV0      ANGA-------------------LQALADVITDLESQAG---------------------
A0A2S5X9U6      ANGA-------------------LQAMADVITEIETQVG---------------------
A0A2S5ULV5      ANGA-------------------LQAMADVITEIETQVG---------------------
A0A653YMF0      ANGA-------------------LQAMADVITEIETQVG---------------------
A0A4V1VGV9      ADLA-------------------RTALADEAKYLETVGT---------------------
A0A3Q9IY80      AQAW-------------------IRAMATEVENLETSGG---------------------
A0A0F0LP73      ANGA-------------------LHALANVVARIEDAAG---------------------
A0A1F1X071      ANAA-------------------VEATAAEARELETGGN---------------------
A0A3R8RWC7      ANAA-------------------VEATAAEARELETGGN---------------------
A0A4U0RJZ4      ANLA-------------------PAALSQEIKHIETLNG---------------------
A0A4R1FGL9      ANLA-------------------PAALSQEIKHIETLNG---------------------
E3B8H1          ANLA-------------------PAALSQEIKHIETLNG---------------------
A0A0Q5AWK6      ANGA-------------------LAALAAVIADIETQST---------------------
A0A3N1NLD3      ANGA-------------------LAALADVIADIETQST---------------------
A0A3N2FVI8      ANGA-------------------LAALADVIADIETQST---------------------
A0A2S5XDQ6      ANGA-------------------LAALAAVITDIETQST---------------------
A0A2S5XNN6      ANGA-------------------LAALAAVITDIETQST---------------------
A0A538JQF8      ADTFADSLKTVLADQTTQRRQLQIDSQLKAAEQIQGQIN---------------------
A0A0Q5JKD6      AEAW-------------------IRGMTEEVDQLETGGG---------------------
A0A0Q9TBP0      ANIVATSYLQFREQDSVGRYEQARDRLAQEQADIESRLS---------------------
A0A346XTB0      VNAVAEAYRTQKRAQEVQRAEDAVAELRAQQVRLEEERS---------------------
A0A2W6DK08      ANAFAAGTVDEFRARHAAAAAARFRSLEGQLTEVDNQLK---------------------
A0A2S0LQ32      ANAA-------------------IPALGSYIASLEAIGSGQSPSPADAQPPAAGSDQPST
A0A2N6V1R5      ANAG-------------------IKAVSDEANAITTLNA---------------------
G9PHS6          ANAG-------------------IKAVSDEANAITTLNA---------------------
U1PLM7          ANAG-------------------IKAVSDEANAITTLNA---------------------
A0A351ETF8      ANVWAQTYVTARYAETLAQNVESIEFLQALIAEIAEDRD---------------------
A0A349B7N2      ADGFAGALLATLTETTQQERAEAQTRLSARLDELEARLA---------------------
A0A346Y185      ANAIGEAYQAVVREEAERSTQASLSELQTQRAALEDAIA---------------------
A0A259S8H9      ANGA-------------------LHALAKVVAHIEQVAQ---------------------
A0A0Q5L115      TDAW-------------------LAAMGEQIAAMQE------------------------
A0A2W1Z497      ADAW-------------------IAGMGRQIAAIQS------------------------
A0A3L8NYD3      ANAV-------------------IGAMSTEAAKLES------------------------
A0A1M6K628      ADAG-------------------IRATSVAANELETMTV---------------------
A0A561E8R3      ADAA-------------------VNATRDEAAQIET------------------------
A0A1H4I042      ANTL-------------------SDQFVKMVRELE-------------------------
A0A4R7A6D9      ANTL-------------------SDQFVKMVRELE-------------------------
A0A4Q4D4T1      AGQV-------------------AEELVSWIASYQDRAA---------------------
A0A261FE22      LNEV-------------------VKQLNK-------------------------------
A0A5C8C085      ADAW-------------------IVALQDQIEAVE-------------------------
A0A1E4BP96      AEAW-------------------IRGMTAAIDDIE-------------------------
A0A101KZQ4      AEAW-------------------VKAIENQVSEVENSS----------------------
A0A439DNZ6      ADAL-------------------SEEFVVMVRELE-------------------------
A0A0J6YE86      ANTL-------------------SDEFVGRVRELE-------------------------
A0A5Q5BFU2      ANTL-------------------SDEFVAMVRELE-------------------------
A0A151BT98      ANAT-------------------GPALAAVAPQF--------------------------
A0A2Y8ZRF8      ANAT-------------------GPALAAVAPQF--------------------------
A0A2R9UAT1      AEAW-------------------IQGMATEIDGLE-------------------------
A0A4Q5J5D7      ADAW-------------------VSALADQVAEIE-------------------------
A0A1Y4CKD6      LEKA-------------------LEVYPEVSRFVL-------------------------
A0A0Q7KBQ4      AEAE-------------------AEGIVSLVARLEK------------------------
A0A1F1IHY9      ASAW-------------------LGALEAQATEVE-------------------------
A0A542HCT5      ADAW-------------------VAALARQVQAVE-------------------------
A0A2S8WHZ8      ADAW-------------------VVALAAQVEELESVS----------------------
A0A537WNY9      AQAA-------------------TDALVERT-----------------------------
A0A5B8M469      -----------------------------MITEIQK------------------------
A0A1Y4CTD2      IQSA-------------------LQNYERVSGY---------------------------
A0A0Q5M6Z7      ANAW-------------------IAGLTKQVRALEA------------------------
A0A3N3ZPU0      ADAY-------------------AGALTQEVQRIESIAT---------------------
A0A359IQX7      ADLG-------------------LTATADAAARLESLT----------------------
A0A4R8TXC3      ANSA-------------------LHATAEYIKNIEGNNG---------------------
A0A433EDP2      ANSA-------------------LHATAEYIKNIEGNNG---------------------
A0A231VTW0      ANSA-------------------LHATAEYIKNIEGNNG---------------------
A0A433ECD0      ANSA-------------------LHATAEYIKNIEGNNG---------------------
U7V3Z1          ANSA-------------------LHATAEYIKNIEGNNG---------------------
A0A1F1J417      ANSA-------------------LHATAQYIENIEKNGS---------------------
A0A2A8D6P2      ANSA-------------------LHATAQYIENIEKNGS---------------------
A0A1F0THV9      ANSA-------------------LHATAQYIENIEKNGS---------------------
A0A5F0M6Y0      ANSA-------------------LHATAQYIENIEKNGS---------------------
D8USQ4          ANSA-------------------LHATAQYIENIEKNGS---------------------
E3H5W1          ANSA-------------------LHATAQYIENIEKNGS---------------------
A0A1F1QKB0      ANSA-------------------LHATAQYIENIEKNGS---------------------
A0A509JY23      ANSA-------------------LHATAQYIENIEKNGS---------------------
A0A448USF4      ANSA-------------------LHATAQYIENIEKNGS---------------------
A0A0Q9LZR0      ADAW-------------------VAALARQVQAVE-------------------------
A0A1N7E3F1      ANAL-------------------GAAFARLIDQIE-------------------------
A0A544ZKQ1      ANAL-------------------GAAFAQLIDKIE-------------------------
A0A372P1T1      ANTL-------------------GATFAALIDRIE-------------------------
A0A5D0Q2X0      ANTL-------------------GATFAALIDRIE-------------------------
A0A5R8Z2E7      ANTL-------------------GATFAALIDRIE-------------------------
A0A1L2ZMV4      ADAF-------------------ASALAEEAERVERVMA---------------------
A0A1S1CAD0      ANGA-------------------LQATADYIKEIEQNPG---------------------
G5ET14          ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1E9DXX2      ANSA-------------------LQATADYIKEIEQNPG---------------------
A0A1E8S156      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1E8S5S2      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1S1DFA8      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A2I1Z490      ANGA-------------------LQATADYIKEIEQNPS---------------------
A0A1F0DAA9      ANSA-------------------LQATADYIKEIEQNPG---------------------
A0A1F0PHK9      ANSA-------------------LQATADYIKEIEQNPG---------------------
A0A1F0VZG6      ANSA-------------------LQATADYIKEIEQNPG---------------------
A0A1E9G8X4      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1E9IAW2      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1E9ZBC9      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1E9ZDP4      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1F0R6B5      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1F0Z7N5      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1F1D897      ANGA-------------------LQATADYIKEIEQNPG---------------------
D2NP38          ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1F1FV74      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1E9M791      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A291DEI8      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1S1D5T1      ANGA-------------------LQATADYIKEIEQNPS---------------------
A0A1E8TRD6      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1F0XT88      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1F1EVP5      ANGA-------------------LQATADYIKEIEQNPG---------------------
C6R548          ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A0K2RXS2      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A1F0KX60      ANGA-------------------LQATADYIKEIEQNPG---------------------
A0A542I3V2      ADAW-------------------VAELAKRVQLLESFV----------------------
A0A2T0UZ65      ADAT-------------------MEAVAAEANRLELGGG---------------------
A0A1R4JTI6      ADSW-------------------VSSLAEEVSNIENQTL---------------------
A0A4R7TM52      AQAW-------------------VKAMSNEVKKLE-------------------------
A0A542XE74      ANAT-------------------LSALRVEALRLETFGR---------------------
A0A0G3V3F3      SSAA-------------------TVALIDAVRAQQTASL---------------------
A0A0Q7QDF6      AGQV-------------------AEELVSWIASYQDRA----------------------
A0A3S0V9U6      ANAS-------------------LKATADTVNEID-------------------------
A0A2R7Z032      ASIV-------------------VQAIADEAEEIENTG----------------------
A0A1I0W453      ANAV-------------------VDAVVVVAQEIETGE----------------------
A0A1H4LCS9      ANAV-------------------IKAVVVYAAQVDNGG----------------------
A0A4Q2RZP8      ANAV-------------------IDAVVIYAAQVENGG----------------------
A0A0Q6VV12      ANGV-------------------VDAVVEYAQEVDTGE----------------------
A0A495NTA9      ATSV-------------------VDAVVEYAQEVDTGE----------------------
A0A0Q9QB08      ANAV-------------------VDAVVVVAQQYETGE----------------------
A0A4Q2SA86      ASAV-------------------VDAVVVYAQEVETGE----------------------
A0A4Z1C3Z0      ATAV-------------------VDAVVVYAQEVETGE----------------------
A0A5R8L819      AQAW-------------------LAGMAVEVQNLE-------------------------
A0A261FQA1      ANAV-------------------YDSLVQQIEDDSFA-----------------------
A0A1Q2CJ92      ADAA-------------------IRATSVEANALETLT----------------------
A0A2T0S3C8      AGVL-------------------AREFTTMVEALE-------------------------
A0A4Y8WZJ3      ASAW-------------------LGALEAQATEVE-------------------------
A0A285VUW0      AEAL-------------------PQQLATTARSYA-------------------------
A0A4Q2JUT1      AEAW-------------------LISLGSVVEEVEV------------------------
A0A542J310      AEAW-------------------LSSLGEVVDEVEK------------------------
A0A444BL03      ADAV-------------------IKATAQEANRIE-------------------------
A0A4Y8X357      ANTA-------------------LVATADVANGLD-------------------------
R4LD52          ATVL-------------------AGQFKQLVESLE-------------------------
A0A4T2CD79      ADAW-------------------IVGLTTQIATLEN------------------------
A0A4Q4D742      AGAE-------------------ADAIVALVKRLER------------------------
A0A4Q2RU39      ANAV-------------------VDAVVVVAEDV--------------------------
A0A4Q2SK58      ANAV-------------------VDAVVVVARDI--------------------------
A0A2N3YJR1      ADAV-------------------IKATAEEANRIE-------------------------
A0A1C6T1J1      TELL-------------------SAKFVDLVQKVE-------------------------
A0A2W2CFC8      TEAV-------------------SAKFVELVKQVE-------------------------
A0A2W2A4B0      TDSI-------------------VRSFSSVVQDRL-------------------------
A0A4Y9MDA5      ANAV-------------------ATQLERAVLDLS-------------------------
A0A1H7N9P7      ANAV-------------------AAELELAVEGLS-------------------------
A0A1M7V0F8      ADAV-------------------ADQLERTVEQLS-------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      SRSE--------------------------------------------------------
A0A419GS64      PASV--------------------------------------------------------
A0A538BYZ4      PTSF--------------------------------------------------------
A0A4R1CW45      SRDK--------------------------------------------------------
A0A4R5Z7B0      PKSP--------------------------------------------------------
A0A2V2CXY5      LPFD--------------------------------------------------------
A0A2S8MDM2      DNAA--------------------------------------------------------
A0A357ZDL3      NNHE--------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A538BBM6      PEEI--------------------------------------------------------
A0A1I6GVG4      HLFG--------------------------------------------------------
A0A1I6IST1      HLFG--------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A0G3V3M7      --------------------------------------------------------DEQI
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A1Q2CI19      ------------------------------------------------------------
A0A512T3M3      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A543PXP1      ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A5R8VLL6      ------------------------------------------------------------
A0A1H6WL79      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A0A4Y3NEG0      ------------------------------------------------------------
A0A1H6YPK1      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A5Q2FA83      ------------------------------------------------------------
A0A542FTE6      ------------------------------------------------------------
A0A2S5UYV0      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A653YMF0      ------------------------------------------------------------
A0A4V1VGV9      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
A0A4U0RJZ4      ------------------------------------------------------------
A0A4R1FGL9      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A538JQF8      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A0Q9TBP0      ------------------------------------------------------------
A0A346XTB0      ------------------------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      PSPADEQPAAPEPATPEPRQEEPRGGNQDEGANPGTGERRSTPGRGNGTGEEKEDAAADA
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A351ETF8      ------------------------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A346Y185      ------------------------------------------------------------
A0A259S8H9      ------------------------------------------------------------
A0A0Q5L115      ------------------------------------------------------------
A0A2W1Z497      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A4R8TXC3      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
D8USQ4          ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A0G3V3M7      FGLTISRGNSETLISKIDSQLAAPGLSASEYDSLDIRREAVLRKLANADSDLSNLQEIGP
A0A3E2DN22      ---------------------------------------------------------IAA
A0A3Q9ULZ9      ---------------------------------------------------------AQA
A0A3S9JFL2      ---------------------------------------------------------AQA
A0A1Q2CI19      ------------------------------------------------------------
A0A512T3M3      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A543PXP1      ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A5R8VLL6      -------------------------------------------------------AAGQP
A0A1H6WL79      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A0A4Y3NEG0      ------------------------------------------------------------
A0A1H6YPK1      ----------------------------------------------------------GI
A0A2R7MGI0      ----------------------------------------------------------GQ
A0A2T7WQY4      ----------------------------------------------------------GQ
A0A1G6GTN3      ----------------------------------------------------------GR
A0A1N7DLV3      ----------------------------------------------------------GH
A0A1V2NSB5      ----------------------------------------------------------AH
A0A0Q5Q5L3      ----------------------------------------------------------GQ
A0A0Q6DVM4      ----------------------------------------------------------GQ
A0A1R3WWR6      ----------------------------------------------------------GE
A0A5Q2FA83      ----------------------------------------------------------SA
A0A542FTE6      ----------------------------------------------------------TI
A0A2S5UYV0      ----------------------------------------------------------GG
A0A2S5X9U6      ----------------------------------------------------------GG
A0A2S5ULV5      ----------------------------------------------------------GG
A0A653YMF0      ----------------------------------------------------------GG
A0A4V1VGV9      ----------------------------------------------------------EA
A0A3Q9IY80      ----------------------------------------------------------VS
A0A0F0LP73      ----------------------------------------------------------AG
A0A1F1X071      ----------------------------------------------------------EN
A0A3R8RWC7      ----------------------------------------------------------EN
A0A4U0RJZ4      ----------------------------------------------------------A-
A0A4R1FGL9      ----------------------------------------------------------A-
E3B8H1          ----------------------------------------------------------A-
A0A0Q5AWK6      ----------------------------------------------------------AD
A0A3N1NLD3      ----------------------------------------------------------AD
A0A3N2FVI8      ----------------------------------------------------------AD
A0A2S5XDQ6      ----------------------------------------------------------AD
A0A2S5XNN6      ----------------------------------------------------------AD
A0A538JQF8      -------------DINLQIARAPDAGTVAALQARRQPLQVRVDRAMNQVDIIQNRPDPLP
A0A0Q5JKD6      ------------------------------------------------------------
A0A0Q9TBP0      -----------------EVNALLEKNPGGQALQG-------------ERRTLIASSAQVA
A0A346XTB0      -----------------GLQSSLEADSSNVALPF-------------LIQSLDARILDIS
A0A2W6DK08      ----------QVTGFTGAVSTPVNPVLQA------------------RAAALSARYAAIY
A0A2S0LQ32      QARVVPAVAGTGASLVPAVAGAPQAAVGQ------------------AGVGQAGQAAPAA
A0A2N6V1R5      ----------------PTVQPTTKTTTNP------------------DGTQVTTTTQSVD
G9PHS6          ----------------PTVQPTTKTTTNP------------------DGTQVTTTTQSVD
U1PLM7          ----------------PTVQPTTKTTTNP------------------DGTQVTTTTQSVD
A0A351ETF8      ------AIRVEVDFYDDLLAETTDPDEYSRYLSQMVSIETLLQPQLAPLEAQISEYQRQI
A0A349B7N2      ------DLDAQIE------DGAGDLVQAQRDALVREYGIVYEDFQVLSREPEATVGLRTL
A0A346Y185      ------AAEARLA------ASPTDASARA------------------ERDAAVSQLIMID
A0A259S8H9      ------SAAPVDP------SLPPEPKSAT------------------NAAPGGIAIVPMD
A0A0Q5L115      --------------------------EST------------------DTGGSATSFVALS
A0A2W1Z497      --------------------------SGE------------------ALASATTKLVPLA
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------ERA---------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------EGNNYEPPSPSPSEDGGEEASP--------------
A0A359IQX7      ------------------------------------------------------------
A0A4R8TXC3      ------------------------GSGNAANSNGGNNATPNAENGNTAGASASANT----
A0A433EDP2      ------------------------GSGNAANSNGGNNATPNAENGNTAGANASANT----
A0A231VTW0      ------------------------GSGNAANSNGGNNATPNTENGNTAGASASANT----
A0A433ECD0      ------------------------GSGNAANSNGGNNATPNTENGNTAGASASANT----
U7V3Z1          ------------------------GSGNAANSNGGNNATPNTENGNTAGASASANT----
A0A1F1J417      ------------------------GNNSTATP------TPAGEENQESAQNKVSST----
A0A2A8D6P2      ------------------------GNNSTATP------TPAGEENQESAQNKVSST----
A0A1F0THV9      ------------------------GNNSTATP------TPAGEENQESAQNKVSST----
A0A5F0M6Y0      ------------------------GNNSTATP------TPAGEENQESAQNKVSST----
D8USQ4          ------------------------GNNSTATP------TPAGEENQESAQNKVSST----
E3H5W1          ------------------------GNNSTATP------TPAGEENQESAQNKVSST----
A0A1F1QKB0      ------------------------GNNNTATP------APAGEENQESAQNKVSST----
A0A509JY23      ------------------------GNNSTATP------TPAGEENQESAQNKVSST----
A0A448USF4      ------------------------GNNSTATP------TPAGEENQESAQNKVSST----
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------TGG---------------------------------
A0A1S1CAD0      ------------------------NAQALVNGDST-------------------------
G5ET14          ------------------------NAQALVNGDST-------------------------
A0A1E9DXX2      ------------------------NAQALVNGDNA-------------------------
A0A1E8S156      ------------------------NAQALVNGENT-------------------------
A0A1E8S5S2      ------------------------NAQALVNGENT-------------------------
A0A1S1DFA8      ------------------------NAQALVNGENT-------------------------
A0A2I1Z490      ------------------------NAQALVNGENT-------------------------
A0A1F0DAA9      ------------------------NAQALVNGENT-------------------------
A0A1F0PHK9      ------------------------NAQALVNGENT-------------------------
A0A1F0VZG6      ------------------------NAQALVNGENT-------------------------
A0A1E9G8X4      ------------------------NAQALVNGENT-------------------------
A0A1E9IAW2      ------------------------NAQALVNGENT-------------------------
A0A1E9ZBC9      ------------------------NAQALVNGENT-------------------------
A0A1E9ZDP4      ------------------------NAQALVNGENT-------------------------
A0A1F0R6B5      ------------------------NAQALVNGENT-------------------------
A0A1F0Z7N5      ------------------------NAQALVNGENT-------------------------
A0A1F1D897      ------------------------NAQALVNGENT-------------------------
D2NP38          ------------------------NAQALVNGENT-------------------------
A0A1F1FV74      ------------------------NAQALVNGENT-------------------------
A0A1E9M791      ------------------------NAQALVNGENT-------------------------
A0A291DEI8      ------------------------NAQALVNGENT-------------------------
A0A1S1D5T1      ------------------------NAQALVNGENT-------------------------
A0A1E8TRD6      ------------------------NAQALVNGENT-------------------------
A0A1F0XT88      ------------------------NAQALVNGENT-------------------------
A0A1F1EVP5      ------------------------NAQALVNGENT-------------------------
C6R548          ------------------------NAQALVNGENT-------------------------
A0A0K2RXS2      ------------------------NAQALVNGENT-------------------------
A0A1F0KX60      ------------------------NAQALVNGENA-------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------PGVEQ-------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------TQGRETS-----------------------------
A0A0G3V3F3      ------------------------AQDIAPIQAQRVILQKQLSNLPAFDPQAASIQANID
A0A0Q7QDF6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      -----PSSANGSSRISA------NLVDEAVVPNVQAL-----------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------MPQEPIS-----------------------
A0A538AJI7      -----------------------QLVAPAVKPTTPAA-----------------------
A0A538AM15      -----------------------DAAEPLTLQQSPA------------------------
A0A022KX11      -----TLLKSSGQKVVS------TPIQPASAPAQPVS-----------------------
A0A255G8R8      -----PKRD-GQDTVKA------TTISPALPPPSPSS-----------------------
A0A4Y5YMQ6      -----PKDDRGESTVGA------RVIDPGAPAQFQSS-----------------------
A0A4Q5A868      -----YASG-SHSSVKL------SVVQPAAVPSSPSS-----------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A345NSU7      -----MLQM-SGSAVSA------ETVVPAAVPGRPVE-----------------------
A0A4Q5APW3      ----------SHSSVKL------SVVQPAAVPSSPSS-----------------------
A0A4Q5B0V3      ----------SHSSVKL------SVVQPAAVPSSPSS-----------------------
A0A222TG79      -----TPAGGGSPMAKL------TTVTPAVEPSVPVS-----------------------
A0A1Q2CRV2      -----PPGADGQKPVVA------TVIRQPLVPTAPTS-----------------------
A0A2S5WZJ5      -----TQVGGGVSNVTV------IPLEDAVPPTTPVT-----------------------
K6WHS4          -----VPSAGGDPLAKL------TVVSPATVDDAPVS-----------------------
A0A1L2ZMQ6      ----DGVDKDFQPAVEL------MPMTEGTLPTSPYA-----------------------
A0A3L7ADK2      --------VIGAQNTKF------VSVSKAATPNSPVS-----------------------
A0A0G3V3M7      QTSGLTTLEAATKGRAT------IIVSRAQGSTSESQ-----------------------
A0A3E2DN22      SDHKSDAQLAKMTSVHV------LGYESAGLPSGDRG-----------------------
A0A3Q9ULZ9      NPGYTQAQLEKLTAIHV------LSYEPAGLPATPKQ-----------------------
A0A3S9JFL2      NPGYSQAQLEKLTAIHV------LSYEPAGLPATPKT-----------------------
A0A1Q2CI19      -------------ETTR------LSVLQEATPIPNE----------------STANFVIP
A0A512T3M3      -------------AGTR------LSILQRGIPVAEA-----------------HKGTLIP
W6JTW4          -------------GGTR------LTIVQDAVAVPDA-----------------NPGSILP
A0A0A0JTY0      -------------ENAR------LEVLQTATPIPTAG---------------SDGGFVIP
A0A0A0JXF2      -------------ENTT------LTILQPATPIPSTA---------------NDGGFVVP
E6S8H2          -------------GRAN------VSILQRATPIPNV----------------TGGGFVIP
A0A0A0JGH0      -------------GRAV------VTILQEATPIPDE----------------IGGGFVVP
N0E4U7          -------------GGAA------VSVLQVATPIPDQ----------------IGGGFVVP
A0A0A0IYK2      -------------ENVA------VSILQAASPVPVAN---------------SDGGFVVP
A0A0Q9L0H3      -------------ETTT------LSLLQPATPIPSAA---------------TDGGFVIP
A3TMK0          -------------ENAT------LSVLQPATPIPSAT---------------TDGGFVVP
A0A543PXP1      -------------GNAT------VTILQRATPIPNV----------------TGGGFVVP
A3TMH6          -------------GTVG------ITVLQSASPIPNA----------------DGGGFVVP
A0A5R8VLL6      AAPAGQPAPVVTPPISL------VPLDPATVPTHPVS-----------------------
A0A1H6WL79      -------SPGTEPVTKI------VPLAKATLPSAPVS-----------------------
A0A101LAM5      -------SPGTEPVTKI------VPLAKASLPSAPVS-----------------------
A0A4Y3NEG0      -------SPGTEPVTKI------VPLTKASLPSAPIS-----------------------
A0A1H6YPK1      SNP-------ERTVINV------MVLQQARLPSVPAS-----------------------
A0A2R7MGI0      GAV------------RL------IAGDSARLPTSPSS-----------------------
A0A2T7WQY4      GAV------------RL------IAGDSARLPTSPSS-----------------------
A0A1G6GTN3      SAV------------RL------VAGDSARLPTAPSS-----------------------
A0A1N7DLV3      GAV------------KL------VAGDSARLPTAPSS-----------------------
A0A1V2NSB5      SAV------------KL------VAGDSARLPTSPSS-----------------------
A0A0Q5Q5L3      GAV------------RL------VAGDSARLPTSPSS-----------------------
A0A0Q6DVM4      GAV------------RL------VAGDSARLPTSPSS-----------------------
A0A1R3WWR6      SAV------------RL------IAGDSARLPTSPSS-----------------------
A0A5Q2FA83      GQG-----------VKA------TTITPATVPSQPVS-----------------------
A0A542FTE6      RTQ----------ATSF------VPLAAATTPTAPSS-----------------------
A0A2S5UYV0      VSS-----------VTV------LPLQDAVEPTSPES-----------------------
A0A2S5X9U6      ASG-----------VTV------VELQNAVEPTSPVS-----------------------
A0A2S5ULV5      TSG-----------VTV------VPLQNAVEPTSPVS-----------------------
A0A653YMF0      ASG-----------VTV------VPLQNAVEPTSPVS-----------------------
A0A4V1VGV9      KTS----------VYRV------FPLTAAARPSAPSS-----------------------
A0A3Q9IY80      LAT-----------VQL------VPGDTARLPSSPSS-----------------------
A0A0F0LP73      ATPPPGSTVVPTEGIVI------VPLDQAVAPRTPSA-----------------------
A0A1F1X071      AAV----------GVQL------TNYQNAVVPGAPVS-----------------------
A0A3R8RWC7      AAV----------GVQL------TNYQNAVVPGAPVS-----------------------
A0A4U0RJZ4      KST----------VYDA------YPLSRAGLPASQTS-----------------------
A0A4R1FGL9      KST----------VYDA------YPLSRAGLPASQTS-----------------------
E3B8H1          KST----------VYDA------YPLSRAGLPASQTS-----------------------
A0A0Q5AWK6      RTP----------QITV------VPLENAEPASTPTS-----------------------
A0A3N1NLD3      RTP----------QITV------VPLENAEPAAAPTS-----------------------
A0A3N2FVI8      RTP----------QITV------VPLENAEPAAAPTS-----------------------
A0A2S5XDQ6      RTP----------QITV------VPLENAEPPAAPTS-----------------------
A0A2S5XNN6      RTP----------QITV------VPLENAEPPAAPTS-----------------------
A0A538JQF8      ALLTLESGSIRGGRTDL------SRFLAQRAAATFHP-----------------------
A0A0Q5JKD6      ----------GQSAVRL------VAGDSARLPTAPSS-----------------------
A0A0Q9TBP0      AQIDALTDSLTTAAAGG------ELLHSAEPADNPVS-----------------------
A0A346XTB0      GRIDATLLAVRLRGDGV------EDFQDAIPPDFPSR-----------------------
A0A2W6DK08      GLLQETANQANNPTGLD------TLSPAAGATFNAGAFSL--------------------
A0A2S0LQ32      PATAAPTDETYNSQTRL------VALEPAQLPGAPFS-----------------------
A0A2N6V1R5      GTTNVTTTDNSYRETRV------TQTLQAVAPSAPSS-----------------------
G9PHS6          GTTNVTTTDNSYRETRV------TQTLQAVAPSAPSS-----------------------
U1PLM7          GTTNVTTTDNSYRETRV------TQTLQAVAPSAPSS-----------------------
A0A351ETF8      TEFESVARFLDSPDVSA------QVSQLAEVPTIPVS-----------------------
A0A349B7N2      QPAVAVPISGDAFVAAL------QETLGATDPSEPTAIEDGDPDEEDPLLEAFDAGPSEP
A0A346Y185      SRADQIAVDSTLFGSGV------ELFERADVPESPSA-----------------------
A0A259S8H9      E---------------------------AVAPTRPSA-----------------------
A0A0Q5L115      S---------------------------ASVPTSPAS-----------------------
A0A2W1Z497      S---------------------------ATVPTSPSS-----------------------
A0A3L8NYD3      --AARPSGAPVSTLVKL------VATQQAGAPSAPSS-----------------------
A0A1M6K628      --TGEPTD-QLV--VKI------APVEPALTPSRPTS-----------------------
A0A561E8R3      --TGEPAGTQPS--VRI------YPFDNATTPSLPFS-----------------------
A0A1H4I042      -----TPGDGSLPDTRV------VVEQPAAIASSPAV-----------------------
A0A4R7A6D9      -----TPGDGSLPDTRV------VVEQPAAIASSPAV-----------------------
A0A4Q4D4T1      -----GEDAPDLPTLSP------IVIQEGTASSQPVE-----------------------
A0A261FE22      -----QITSDGSSGIQL------SFIQKPYVPSSPSS-----------------------
A0A5C8C085      -----NPNGKNEAPIRL------LPVESAALPSAPVS-----------------------
A0A1E4BP96      -----GTGVAGSAPVTL------IPGDSARLPTAPSS-----------------------
A0A101KZQ4      -----ATKSSSASIVTF------RSFDAAELPTSPSS-----------------------
A0A439DNZ6      -----TPPDGTRPDARV------IVEQRASIPKSPVI-----------------------
A0A0J6YE86      -----TPENSTRADSRV------VVEQRASIPSSPVV-----------------------
A0A5Q5BFU2      -----TPEDGSSPDARV------VVEQRASIANKPVI-----------------------
A0A151BT98      -----SQLLSGAGSVTS------TAVQPAEVPASPAS-----------------------
A0A2Y8ZRF8      -----SQLLSGAGSVTS------TAVQPATVPSSPAS-----------------------
A0A2R9UAT1      -----SDGGKVQAAVRL------VPADTARLPTAPSS-----------------------
A0A4Q5J5D7      ------NPRGEAGALKV------VPIEAAALPSAPVS-----------------------
A0A1Y4CKD6      ------------GNIAF------NLIDEISTPATPVN----------------------E
A0A0Q7KBQ4      -----PTSGNGSPAFVA------RIVGPPSISQTPVA-----------------------
A0A1F1IHY9      -----AGGIAGQSIISL------ETLSDASLPSAPSS-----------------------
A0A542HCT5      -----NPTGKSEQALRI------VPIESAALPASPVS-----------------------
A0A2S8WHZ8      -----VGGSDRATAVKL------QPLGQAVLPSSPVS-----------------------
A0A537WNY9      -----RSGEVGVPTLEL------KELDRPALPQAPVF-----------------------
A0A5B8M469      -----AGGASDTPHLKV------IPLDNATAPSTPVS-----------------------
A0A1Y4CTD2      -----VFSNATLQLVQE------PSVPESPSNTSPLI-----------------------
A0A0Q5M6Z7      -----PEGAIAEPAISF------VALASARPPYFPSS-----------------------
A0A3N3ZPU0      -----ESSEDGTGLVQV------VPVSSASVPESPVS-----------------------
A0A359IQX7      -----TTGTPGQSVVKL------QPYISAAESPNPVS-----------------------
A0A4R8TXC3      -----AVSGNAANNIRV------IPLDNASINPPLVS-----------------------
A0A433EDP2      -----AVSGNAANNIRV------IPLDNASINPPLVS-----------------------
A0A231VTW0      -----AVSGNAANNIRV------IPLDNASINPPLVS-----------------------
A0A433ECD0      -----AVSGNAANNIRV------IPLDNASINPPLVS-----------------------
U7V3Z1          -----AVSGNAANNIRV------IPLDNASINPPLVS-----------------------
A0A1F1J417      -----NPSDTTNTLIRV------IPLDNASVNPPLVS-----------------------
A0A2A8D6P2      -----NPSDTTNTLIRV------IPLDNASVNPPLVS-----------------------
A0A1F0THV9      -----NPSDTTNTLIRV------IPLDNASVNPPLVS-----------------------
A0A5F0M6Y0      -----NPSDTTNTLIRV------IPLDNASVNPPLVS-----------------------
D8USQ4          -----NPSDTTNTLIRV------IPLDNASVNPPLVS-----------------------
E3H5W1          -----NPSDTTNTLIRV------IPLDNASVNPPLVS-----------------------
A0A1F1QKB0      -----NPSDTTNTLIRV------IPLDNASVNPPLVS-----------------------
A0A509JY23      -----NPSDTTNTLIRV------IPLDNASVNPPLVS-----------------------
A0A448USF4      -----NPSDTTNTLIRV------IPLDNASVNPPLVS-----------------------
A0A0Q9LZR0      -----NPTGKAAQALRV------VPIESAALPASPVS-----------------------
A0A1N7E3F1      -----RPTPKSPPTIRV------TVVDDAEVPEDPVA-----------------------
A0A544ZKQ1      -----RPTPKSPPTIRV------TVVDEAEVPKEPVA-----------------------
A0A372P1T1      -----RPTPKSPPTIRV------TVIDEAEVPREPVA-----------------------
A0A5D0Q2X0      -----RPTPKSPPTIRV------TVIDEAEVPREPVA-----------------------
A0A5R8Z2E7      -----RPTPKSPPTIRV------TVIDEAEVPREPVA-----------------------
A0A1L2ZMV4      -----TDSTSSVPVVQI------IPISSALLPSAPSA-----------------------
A0A1S1CAD0      -----AASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
G5ET14          -----AASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1E9DXX2      -----VVSPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1E8S156      -----GATPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1E8S5S2      -----GATPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1S1DFA8      -----GATPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A2I1Z490      -----GATPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1F0DAA9      -----GASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1F0PHK9      -----GASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1F0VZG6      -----GASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1E9G8X4      -----GASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1E9IAW2      -----GASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1E9ZBC9      -----GASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1E9ZDP4      -----GASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1F0R6B5      -----GASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1F0Z7N5      -----GASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1F1D897      -----GASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
D2NP38          -----GASPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1F1FV74      -----AASPTTNNTVRV------IPLNNASVNPPLVA-----------------------
A0A1E9M791      -----AASPTTNNTVRV------IPLNNASVNPPLVA-----------------------
A0A291DEI8      -----AASPTTNNTVRV------IPLNNASVNPPLVA-----------------------
A0A1S1D5T1      -----GATPTGGNTVRV------IPLNNASVNPPLVA-----------------------
A0A1E8TRD6      -----GASPTTSNTVRV------IPLNNASVNPPLVA-----------------------
A0A1F0XT88      -----GASPTTSNTVRV------IPLNNASVNPPLVA-----------------------
A0A1F1EVP5      -----GASPTTSNTVRV------IPLNNASVNPPLVA-----------------------
C6R548          -----GASPTTNNTVRV------IPLNNASVNPPLVA-----------------------
A0A0K2RXS2      -----AASPTTNNTVRV------IPLNNASVNPPLVA-----------------------
A0A1F0KX60      -----AASPTTNNTVRV------IPLNNASVNPPLVA-----------------------
A0A542I3V2      -----TAGQPTPPALPV----GLVPLDKAALPTTPIS-----------------------
A0A2T0UZ65      -----EVKPGTQALVRI------IPIETALLPGAPIG-----------------------
A0A1R4JTI6      -----SEESSAQSIVKV------LPLVQATQPQTPHT-----------------------
A0A4R7TM52      ------SASGGEALVQL------VPGDSAQLPTSPSS-----------------------
A0A542XE74      -----EEQMRGMTSINV------LAYEPAALPSSPVR-----------------------
A0A0G3V3F3      ALNKVEAERRAQPANRV------NVAASAHASSTPIS-----------------------
A0A0Q7QDF6      ----AERAGEDAPDLPT---LSPIVIQEGTASSQPVE-----------------------
A0A3S0V9U6      ----------GSRSVRV------IPLDDAQKPGSPVG-----------------------
A0A2R7Z032      ----RPAGNKAETLVQV------VPLEQAQLPGAPFT-----------------------
A0A1I0W453      ------ENPKEPALTRI------IPLEEAQLPGAPFT-----------------------
A0A1H4LCS9      ------TTPKGDSLATI------VPLEEAQLPGAPFT-----------------------
A0A4Q2RZP8      ------TTPKGDPLARI------VPLEEAALPGAPFT-----------------------
A0A0Q6VV12      ------SNPRRDPLTRV------VPVQPAELPQAPFT-----------------------
A0A495NTA9      ------ANPKTDPLTRI------VPVTPAQLPGAPFT-----------------------
A0A0Q9QB08      ------ENPRGPSLTRI------IPVTPAELPGAPFT-----------------------
A0A4Q2SA86      ------ESPREAPLTRI------VPVEQAQLPTAPFS-----------------------
A0A4Z1C3Z0      ------ENPRGDPLTRI------VAVEPAQLPSAPFS-----------------------
A0A5R8L819      -----GGSSGGGEVVRL------VEGDSARLPSSPSY-----------------------
A0A261FQA1      -----SNETGLFNGLQF------SVIERAVAPSSPVS-----------------------
A0A1Q2CJ92      ----ITGESSGQTVVRI------VPVELAQTPTTPVS-----------------------
A0A2T0S3C8      -----TPRDRTASPIKV------EVVAGPTGGDTPVS-----------------------
A0A4Y8WZJ3      -----AGGIAGQSIISL------ETLSDASLPSAPSS-----------------------
A0A285VUW0      -----PTLAQSGASVAA------QFVDQPTQSSEPVS-----------------------
A0A4Q2JUT1      -----ESSPTGAAPVQV------VTRESASLPTSPAF-----------------------
A0A542J310      -----ESSPTGDAPVKV------VVRESASLPSSPAF-----------------------
A0A444BL03      -----TTGSNAKNIVTI-------VPIESALPGRRIA-----------------------
A0A4Y8X357      ----------PASNVKV------TAMEDALPPQAPSS-----------------------
R4LD52          -----TPPGKQVSSVKV------EVVAGPELADAPVS-----------------------
A0A4T2CD79      -----KAVTQQAGNTVVAAVTFLEPVESAVAPTQPIF-----------------------
A0A4Q4D742      -----PATSGQAAAVTA------RIAADPSFRSSPVA-----------------------
A0A4Q2RU39      ---------DGANLARI------IPLEEAQLPGAPFT-----------------------
A0A4Q2SK58      ---------DGGTLTRI------IPLEEAQLPGAPFT-----------------------
A0A2N3YJR1      -----TAGSGRGAASVT------IVPIESALPGTKIA-----------------------
A0A1C6T1J1      -----TPPSGEPGPIKI------EIVSGPRVSASPVS-----------------------
A0A2W2CFC8      -----TRPDGSAGPIKI------EVISGPGVTPSPVS-----------------------
A0A2W2A4B0      -----DANASGV-GVTV------TQTSPAARPTTPVA-----------------------
A0A4Y9MDA5      -----PVGEDGSPSVRA------DTVAPASVPSAPVS-----------------------
A0A1H7N9P7      -----PAGEDGSPAVRA------TTVAPAGVPGAPVS-----------------------
A0A1M7V0F8      -----PAGEDGSRAVRA------TTVASADVPTAPVS-----------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      PNKPRDALLGAVVGLLLGVLAALLWTLLDTRV----PNETVLSQVVPAPVLGSISRVRGN
A0A2N4T4Q5      ---------------------------MDRRI----RSVEEVRETFGTPVLGIIPEDDRL
A0A1M3LEY6      PNTRLYLSLGLLIGLIVGLAVAILIEVLDTRI----RGEANVRQITDAPILGGIAFDKLA
A0A538AJI7      PPRRLLELASLFIGSLLGIVASLLLERGRPRL----RSWRDLARASGYPVVGRIPPSRAL
A0A538AM15      --------DSAVDDHLVSLVAPAAFE----------------------------------
A0A022KX11      PNPTRNLALGLLAGLVLGLGLAFIRHALDTKV----RGEEDIRAHSDAPMLAGLPLESRG
A0A255G8R8      PKVAQNLALGLLLGLALGFAAALVRERLDTRV----RNEADVAAVTTASQVGSIP-YVAG
A0A4Y5YMQ6      PNKSQDAVLGVVLGAFGALFALSAWALLDRRV----RSVAALEGVTDLPVLGLVP-RRRN
A0A4Q5A868      PKWKLNILVGIVGGLILGVFAALLKDVLSKRI----QDDDEISEYIDAPIIGRIP---EE
A0A0W8I9Y2      ----------------MGLLYAFARFKMDRRI----KSVEEIRDGFGVAVLGVIP---TD
A0A345NSU7      PDPERNLALGALAGLLLGVAFALARQALDQRV----RGTADVEAISDRPVLSTIPMRKAD
A0A4Q5APW3      PKWKLNILVGIVGGLILGVFAALLKDALSKRI----QNDDEISEYIDAPIIGRIPEEELL
A0A4Q5B0V3      PKWKLNILVGIVGGLILGVFAALLKDVLSKRI----QNDDEISEYIDAPIIGRIPEEELL
A0A222TG79      PGIEKNTLIGVAVGLLFGLLAVMFASRLTNRI----QTPADVVEVTESPVLAVVPRFPSA
A0A1Q2CRV2      PKPLQNLAIGGLVGLLLGAGQALLRDVLNTVV----RSRRDIEQVSDQAILGAIPLDE--
A0A2S5WZJ5      PNLQTNLLLGAGIGIVLAYVFVFLRKALDVKV----RTSKDLATATRSGSLGRIPKSPQL
K6WHS4          PRYGRTVLIALTLGICMGIGIVVLVERADTRI----RSEDSVLEVTELPILGDLPDDPAV
A0A1L2ZMQ6      PNVNQAVLIGAVVGLVLGLIWAAIKHLLDRRV----RSVEAIQK-VGMSAVGTLPSDPRL
A0A3L7ADK2      PNVIIALVLATITGTLLAIAYAVIRQHLDRRI----RSADVLEQRYGTSVLGTIPMNPFL
A0A0G3V3M7      -----RLLFGAAIGFIVGLGILLLLEILSARI----RDVPGTEGAARMPVIAEIPVMNLD
A0A3E2DN22      KSVALYVVAGLAAGFLIGAVVAVVRKQFDVKV----RDQATIEELTGSGILSVIPDDKKL
A0A3Q9ULZ9      DNLLLYLALGLVAGLVVGSVIAVIRRMFDVKI----RSQNDVEELTGRGVLAIIPEDRQL
A0A3S9JFL2      ANLPLYLALGLLAGLVLGGVISVIKRMFDVKI----RSQKDVEDLTGHGVMAVIPEDRQL
A0A1Q2CI19      PDRWFRTLLAAVLGLLFGIALALVLERLDSRL----RTREEIAEALDMPIVGVVPKITAA
A0A512T3M3      PGRPQRTGLAAGLGLLLGLAIALVLNRLDSRM----RSREEIQEALGLPIIAEVPKLARG
W6JTW4          PGRPTRTALAALIGLLFGMALAVFVDRIDSRL----RSRTEIQAALGLPIIAEVPKLPRA
A0A0A0JTY0      PGRGPRTAIATLLGVLVGLGLALLLDRLDSRL----RTRSEIHNALQMPIIAEVPRLKRA
A0A0A0JXF2      PGRGPRTAIATLLGLLVGMGLALLLDRLDSRL----RSRSEIGDALSMPIIAEVPRLKRS
E6S8H2          PDRTTRTALAAGLGLLLGLGLALVLDRVDSRL----RTRSEIAAALRLPIIAEVPKMSRS
A0A0A0JGH0      PSRPLRAALAALVGLLLGFALALVLQRVDSRL----RTRDEVHAGLRLPIIAEVPRLKRS
N0E4U7          PSRPLRTAMAAFIGLLLGFALALVIQRVDSRL----RTRDEVHAALRLPIIAEVPRLSQA
A0A0A0IYK2      PGRGPRTAIATVLGLLAGLALALLLDRLDSRL----RTRQEIHGALRMPIIAEIPRLRRS
A0A0Q9L0H3      PGRGPRTAIATLLGLLVGLGLALLLDRLDSRL----RTRGEIASALRMPIIAEIPRLKRS
A3TMK0          PGRGPRTAMATLLGLLVGLGAALVMDRLDSRL----RTRADIHSALRMPIIAEVPRLKRS
A0A543PXP1      PGRAFRTALAAMLGLLAGLALALVLDRLDSRL----RTREEIAAALRLPIIAEVPRLNRS
A3TMH6          PSRPVRAALSAVLGLLLGLALALVLDRLDSRL----RTREEIAAALALPIVAEVPRLGRT
A0A5R8VLL6      PGMGLTALYGAAVGLLLAYASALLRDRLDRRL----RTAAEVENLFSVPVVGTLPVDLRL
A0A1H6WL79      PLLTATIGIGLAGGLLVGLGYALARNHFDRRI----RAASEIERLFGLAVVGTLPLDKRL
A0A101LAM5      PLLTATLGIGLAAGLLIGLGYALARNHLDRRI----RGASEIERLFGLAVVGTLPLDKRL
A0A4Y3NEG0      PLLTATLGIGLAAGLLIGLGYAIARNHFDRRI----RGASEIERLFGLAVVGTLPLDKRL
A0A1H6YPK1      PAIKQNTAVGLMLGLALGVAYAFVRATLDRRL----RSRNDVEIQFGVPVVGTVPWDGAI
A0A2R7MGI0      PNIKIDVAVGGIAGGVLGVVFALVRRTFDRRV----RTVQDITDTVDASVVGVLPVDKEL
A0A2T7WQY4      PNVKVDVAVGAIAGGVLGVVFALVRRTFDRRV----RTVEDITAAVGASVVGVLPIDKEL
A0A1G6GTN3      PNVRLDVTLGALAGGVAGIIFALVRRAFDRRV----RSTHDITDAVDASVVGVLPVDKEL
A0A1N7DLV3      PNEKLAIAVGALAGAVAGVLFALVRRAFDRRV----RSAHDISDSVDVSVVGILPVDKEL
A0A1V2NSB5      PNEKLAIAVGALGGAVVGVLFALVRRTFDRRV----RSTQDISDSVDVSVVGILPVDKEL
A0A0Q5Q5L3      PNVRLDVMIGALLGLVAGVVFALVRRTFDRRL----RSASDITDAVDASVVGVLPVDKEL
A0A0Q6DVM4      PNVRLDVMIGALLGLVAGVVFALVRRTFDRRL----RSASDITDAVDASVVGVLPVDKEL
A0A1R3WWR6      PNVRLDIAIGALVGAMAGTVFALVRRAFDRRI----RSAADITDTIAASVVGILPVDKEL
A0A5Q2FA83      PNLLQNIALGVLAGLALGIGLALLRHFLDTRV----RSELDLRAVSDRPILGALRLLPKG
A0A542FTE6      PNIFSALVVGGVVGLVAAGIFMLVRNTLDRRV----RSVETVEKTAGVAVIGTLIRYEPF
A0A2S5UYV0      PNLRNNLLIGAGLGLVLAYVFVFLRKALDVKV----RNSKDLASAAGVGSLGRIPKSPQL
A0A2S5X9U6      PNLRNNLIIGGAIGLLLAYAFALLRRSLDVKV----RDSKDLAAASGAGTLGRIPKSPQL
A0A2S5ULV5      PNLRNNLIIGGAIGLVLAYAFALLRRSLDVKV----RDSKDLATASGAGTLGRIPKSPQL
A0A653YMF0      PNLRNNLIIGGAIGLVLAYAFALLRRSLDVKV----RDSKDLATASGAGTLGRIPKSPQL
A0A4V1VGV9      PNWMRNLMAGAAIGLLAGIVLVVLRKQLDSRI----RHTSEVEKLTGSGVLGVIPKAPTL
A0A3Q9IY80      PNVRIALALGALAGLVLGIAYAVLRYTLDRRI----RSADAVEKETGLSVVGTIPDEKSF
A0A0F0LP73      PDKRAMIIAGALIGLGVGLLLVLLRRALDVRV----RAHTDVAAIVGAGVLGRVPKFDPD
A0A1F1X071      PDREKFLLAGAAFGLLVALGLAWLRDRNDSRL----RTADDVTDVVGLPTLGALPDAKEL
A0A3R8RWC7      PDREKFLLAGAAFGLLVALGLAWLRDRNDSRL----RTADDVTDVVGLPTLGALPDAKEL
A0A4U0RJZ4      PKWPVNLLIGAFLGLVAGTILVVLRKQLDSRI----RHTSDLEKVTGVGTLGVIPKAKNL
A0A4R1FGL9      PKWPVNLLIGAFLGLVAGTVLVVLRKQLDSRI----RHTSDLEKVTGVGTLGVIPKAKNL
E3B8H1          PKWPVNLLIGAFLGLVAGTVLVVLRKQLDSRI----RHTSDLEKVTGVGTLGVIPKAKNL
A0A0Q5AWK6      PNWLRNLLLGAAGGLVLGFVVAFLRRALDIRV----RTVDQLTELFGVGVLGRIPKAGR-
A0A3N1NLD3      PNWLRNLLLGAAGGLVLGFVLAILRRALDIRV----RTVDDLTQLFGVGVLGRIPKMGKG
A0A3N2FVI8      PNWLRNLLLGAAGGLVLGFVLAILRRALDIRV----RTVDDLTQLFGVGVLGRIPKMGKG
A0A2S5XDQ6      PDWVRNILLGALGGLVLGFGLAFLRRALDIRV----RTVDDLTELFGVGVLGRIPK--AG
A0A2S5XNN6      PDWVRNILLGALGGLVLGFGLAFLRRALDIRV----RTVDDLTELFGVGVLGRIPK--AG
A0A538JQF8      KPRRIRAVIGLLIGLLVGAGVSFAIDFFDPRL----RTRAKVEDLLGLPVVAEIPLLSRR
A0A0Q5JKD6      PNVRLDVTLGALAGGVAGLIFAFVRRAFDRRV----RSAHDITDAVDASVVGVLPVDKEL
A0A0Q9TBP0      PQIVLNLILGALVGLVLGVGAALLRDRLDDVV----HDEEAVRQALDAVVLARVPQWSER
A0A346XTB0      PRPRLTALSFAFLGGVASAMWAYWYAFKSQRV----TSRTDPEIVLGVPPLGEIPLYRMT
A0A2W6DK08      SSTTARTVVGLVLGVVLGCALALALEHFDTRP----RDRAAAGRAYRLPVLAEIPQARHS
A0A2S0LQ32      PDTTKLAGMGGAGGLALGLAVAFLRRALDNKI----RHNSDIEDILQSSVLAVVPRSTDL
A0A2N6V1R5      PDFYKLSGMGALAGLVIGYLVVFMRRLMDNRV----RHNSDVEELLGSSVLAVVPKSTEL
G9PHS6          PDFYKLSGMGALAGLVIGYLVVFMRRLMDNRV----RHNSDVEELLGSSVLAVVPKSTEL
U1PLM7          PDFYKLSGMGALAGLVIGYLVVFMRRLMDNRV----RHNSDVEELLGSSVLAVVPKSTEL
A0A351ETF8      PNVTRNLVVAAAFGMALGIALTYLREVINDKI----EGARSVEQATGLAILGTIPGYQL-
A0A349B7N2      PSPARRGMLGGGLGLVLSVGAVVLFDRFDDRL----RTKEDAEEAFGLPVVAEIP-----
A0A346Y185      PTPVRNAVLACFLGALAAAALAWWRADETATA----DGRNDPSRMLKAPLLGTVPSFEEI
A0A259S8H9      PNKPLIAGIGGGAGLVLGLIALLLRRAMDVRV----RAHTDVAALVGAGVLGRVPRM---
A0A0Q5L115      PNVEVALLLGGLSGLMLAGVYLLVRNTLDRRI----RSAAEVESRFGVGVIGTIPQNDAL
A0A2W1Z497      PDVRAAVTLGVLVGLLLASVYVLVRQALDRRI----RSAAAIEAAFGVPVLGTIPLNPAL
A0A3L8NYD3      PDYRINLLAGGIAGIVAGYLLALVRRQLDSRI----RTVDDMESLVGTSVLTILPESDEL
A0A1M6K628      PNWARNLALGLALGLLCGFGAVVLRRSLDRRV----RQADEVEELTSATALGVVPTAVEL
A0A561E8R3      PDFKKATAEGLLAGLVAGYLWAAFRRQLDSRV----RHQDDVERHLEAPVVGVIPKVPEL
A0A1H4I042      PNLMRNLALGLFAGILFGVACALGREMIDNTV----KKHEDLESITGVAVVGDIPMDKAR
A0A4R7A6D9      PNLMRNLALGLFAGVLLGVACALGREVIDNTV----KKHEDLESITGVAVVGDIPMDKAR
A0A4Q4D4T1      PDARRTYVLFGLAGLLLGLLLAALRNLATATV----TSSDALTEQVKAPVIGAVAQDRHV
A0A261FE22      PNVKGNMMMGAFAALIIAAAGAVIREMSDNSI----HTKAEIQSIVPAPILAAVPKSPTL
A0A5C8C085      PNITRNLAIGFGAGLLLGFAYALVRSQLDRRL----RTASAVEKKFGLSVVGSIPKAPLL
A0A1E4BP96      PNTTLNLALGGLVGLALGIAYAVMRSVLDSRI----REPQDVERNTGASVVGVLPLDHDL
A0A101KZQ4      PNFKIAIAVGLLVGLFMAFAYAMLRHAFDRRI----SSIESVESSTGHSVIGTIPQTDTL
A0A439DNZ6      PKTARNIALGLALGLALGIGLAILRDLLDNTV----KDRQNLEEITGVGVVGSIPLDKER
A0A0J6YE86      PKRARNIAVGLVLGLVLGVGFALIRDLLDNTV----KDRTTLEQIANVGLVGTVPLDKER
A0A5Q5BFU2      PKTARNIVFGLGLGLLLGVGLAVLRDTLDNTV----KDRQALEDVTGAGVVGNIPLSKDR
A0A151BT98      PDLKKALELALAVGLLLGVAMALLRHFMDNRV----RTVEDLETLVQRPVLSIVP---RV
A0A2Y8ZRF8      PDIKRTLELAFAVGLLLGVAMALLRHFMDNRV----RTVEDLEALVQRPVLSIVP---RV
A0A2R9UAT1      PNVRLALAIGGVAGLVVGLMIALLRFTLDRRI----RSAELVERETGVAVVGTVPVEKSF
A0A4Q5J5D7      PRVELNLLIGGVVGVLLGLAYALLRNQLDRRL----RSSQAVERQFGVTVVGAIPTASDL
A0A1Y4CKD6      PSQSRIWGFGVMGGICTAALVVGLIALFNNTI----KTAEDLESVSSMVCLGALPEVRAK
A0A0Q7KBQ4      PNVPLNIAVGLLLSLFVAIAGAVLRDLLDRTV----KTRQEAEELSGGAVLATLPFDRQL
A0A1F1IHY9      PNLPLALSIGGALGLLAGLGVAVVRHVLDNKI----RSAAALESRFGLTILGTVPESTRS
A0A542HCT5      PNTQRNLALGFVLGLILGMGYALLRSQLDRRV----REPEVIERDFGVTVAGAIPETSAL
A0A2S8WHZ8      PNTKLSLALGGVIGLALGLGYALTRNHLDRRI----RSVEAIERL-GVSVVGTIPEDQRL
A0A537WNY9      PRKRLTLIVASLIAVLLGVAAALVRENLGTRI----ETAEDLARIAGVPSYGEVPHEPAV
A0A5B8M469      PKPKLVLPIGALAGLVLGYIVILLRRALDVRV----RAGTDMIELLGTGVLGRVP---RF
A0A1Y4CTD2      AYRYLGAAIAALGAVALIALIYLLRNTV--------KTAEQASDLLDGRVLGTVPFERKR
A0A0Q5M6Z7      PNVQTALVLAILAGIALAVVYGLLRQHFDRRI----RSVEQIERLLGAPVIGTIPASPAL
A0A3N3ZPU0      PDLRLNLLVGVGVGLLLAALYVLARSLFDRKV----RSSEAVANATGLAILGTIPLDKRL
A0A359IQX7      PNWKANLPIGAIAGLVIGYGIAFIRRSIDGRV----RTQAEVEELTGAGVIGVIPKVAEL
A0A4R8TXC3      PNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRI----RTRDDAVKATGSSILGVLPTSDDL
A0A433EDP2      PNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRI----RTRDDAVKATGSSILGVLPTSDDL
A0A231VTW0      PNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRI----RTRDDAVKATGSSILGVLPTSDDL
A0A433ECD0      PNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRI----RTRDDAVKATGSSILGVLPTSDDL
U7V3Z1          PNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRI----RTRDDAVKATGSSILGVLPTSDDL
A0A1F1J417      PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDDAIKATNSNILGVLPVSDDL
A0A2A8D6P2      PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDDAIKATNSNILGVLPVSDDL
A0A1F0THV9      PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDDAIKATNSNILGVLPVSDDL
A0A5F0M6Y0      PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDDAIKATNSNILGVLPVSDDL
D8USQ4          PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDDAIKATNSNILGVLPVSDDL
E3H5W1          PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDDAIKATNSNILGVLPVSDDL
A0A1F1QKB0      PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDDAIKATNSNILGVLPVSDDL
A0A509JY23      PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDDAIKATNSNILGVLPVSDDL
A0A448USF4      PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDDAIKATNSNILGVLPVSDDL
A0A0Q9LZR0      PNTRRNLALGFVLGLMLGLGYALLRSQLDRRV----REPEVVERDFGVTVAGAIPETSAL
A0A1N7E3F1      PQPLTNMALGVLIALFAAVTGLVLRDRLDTTI----KTAETLRQVAKSSVLGLIGYERDA
A0A544ZKQ1      PQPLTNMALGALIALLAAVTVLVLRDRLDTTV----KTAEALQQVARSSILGVIGYERDA
A0A372P1T1      PQPLTNMALGALIALFAAVSGLVLRDRLDTTV----KTAETLQKVARSSILGVIGYERDA
A0A5D0Q2X0      PQPLTNMALGALIALFAAVSGLVLRDRLDTTV----KTAETLQKVARSSILGVIGYERDA
A0A5R8Z2E7      PQPLTNMALGALIALFAAVSGLVLRDRLDTTV----KTAETLQKVARSSILGVIGYERDA
A0A1L2ZMV4      PVLRTNLMYGAIAGLILAALFVFIKHLFDVRI----RSTEQVETTTGHPVLGTVPQDKRL
A0A1S1CAD0      PNYEQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
G5ET14          PNYEQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1E9DXX2      PNYKQNVLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASILGVLPISDDL
A0A1E8S156      PNYQQNVLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASVLGVLPVSDDL
A0A1E8S5S2      PNYQQNVLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASVLGVLPVSDDL
A0A1S1DFA8      PNYQQNVLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASVLGVLPVSDDL
A0A2I1Z490      PNYQQNVLVGAATGLALVYLAIFLRRALDQRI----RTRDDATKATGASVLGVLPVSDDL
A0A1F0DAA9      PNYQQNVLVGAAAGLALVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1F0PHK9      PNYQQNVLVGAAAGLALVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1F0VZG6      PNYQQNVLVGAAAGLALVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1E9G8X4      PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1E9IAW2      PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1E9ZBC9      PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1E9ZDP4      PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1F0R6B5      PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1F0Z7N5      PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1F1D897      PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
D2NP38          PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1F1FV74      PNYQQNVLIGAVAGLGLVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSEDL
A0A1E9M791      PNYQQNVLIGAVAGLGLVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSEDL
A0A291DEI8      PNYQQNVLIGAVAGLGLVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSEDL
A0A1S1D5T1      PNYQQNVLVGAATGLALVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1E8TRD6      PNYQQNVLVGAAAGLALVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1F0XT88      PNYQQNVLVGAAAGLALVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1F1EVP5      PNYQQNVLVGAAAGLALVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
C6R548          PNYQQNVLVGAVAGLALVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A0K2RXS2      PNYQQNVLIGAVAGLGLVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A1F0KX60      PNYQQNVLIGAVAGLGLVYLAIFLRRALDQRI----RTRDDATKATGASILGVLPVSDDL
A0A542I3V2      PNIKLALLFGAIGGLLLAYAAALLRHHLDRRL----RSSSEIERLFDVPVIGTLPYDPDI
A0A2T0UZ65      PNVTKYVLAGAVAGAALAYAWIFIRRLSDTRI----RTSKDVEDLTGSSSLGVIPLSNEL
A0A1R4JTI6      PNVRMALALGALVGLVVGLGVAALRSLNDRRI----RGVKVLEETFGLTVLGTIPAMAGL
A0A4R7TM52      PNWRIAVVIGAVIGLAAGIGAAAIRYVVDRRI----RSADIVERETGHAVVGTIPFEKSF
A0A542XE74      PGVIRNLILGGLAGAILGGLIAFGRRALDARI----RSQEQVELLTGKAVLGVVPETKSL
A0A0G3V3F3      PHPTRSAVVAFLLTCILVGELIVASRAIGDRIGRTGDDDADVARITGLPVLGRIPKGEGF
A0A0Q7QDF6      PDARRTYVLFGLAGLLLGLLLAALRNLATATV----TSSDALTEQVKAPVIGAVAQDRHV
A0A3S0V9U6      PNVKKYVLFGAAAGLIIVYLVVFIRRFMDVRV----RTTKDMEESTGLGVLGVLPKTNAL
A0A2R7Z032      PNYRNGAIKGAGGGLVLAYVILIARRLIDRRI----RSVKDVETATGSAVIGIIPKVDAL
A0A1I0W453      PNYESAAMKGALGGLGLAYAFLIGRRLIDRRI----RTTKHVEEATGASVLGIIPKEDSL
A0A1H4LCS9      PNYQKAAMYGAAGGLGLCYAFLVGRRLIDRRI----RSAKHVEEATGASVLGIIPKEDAL
A0A4Q2RZP8      PNYKKGAMQGAAAGLGLCYAVLVGRRLIDRRI----RSAKHVEEATGSSVLGIIPKEDAL
A0A0Q6VV12      PDYAKAAMKGAAGGLALAYAFLIARRLIDRRI----RSVKHVEDATGAAVLGIIPKEDAL
A0A495NTA9      PDYRKAAMKGAAGGLGLAYAFLIARRLIDRRV----RSVKHVEDATGASVLGIIPKEDAL
A0A0Q9QB08      PDYRAAAIKGALGGLALAYAFLIARRLIDRRV----RSAKHVEDATGAAVLGVIPKEDAL
A0A4Q2SA86      PDYPSAALKGALGGLALAYAVLIGRRLIDRRI----RSAKHVEEATGAAVLGIIPKEDSL
A0A4Z1C3Z0      PDYRSAALKGALGGLALAYAVLIARRLLDRRI----RSAAHVEEATGAAVLGVIPTEDSL
A0A5R8L819      PNDRLFAALGVVAGLALGIIYAVARHTLDRRV----RSAETVEKETGRAVVGILPLERTF
A0A261FQA1      PNKPRLIFMGTLAGLVLALVVIVVIDVSDKRV----RDTADIQRILYSPVISSVPKSDTF
A0A1Q2CJ92      PNYVRNLALGAALGLLLGLGIVVGRQSFDRRI----RRAHEAEEVAETSSLGIVPAAAEL
A0A2T0S3C8      PKPLRNLALAALLGLLAGGVAAVLRETLDTTV----KTADALHELAGAPVLAGVPFDADA
A0A4Y8WZJ3      PNLPLALSIGGALGLLAGLGVAVVRHVLDNKI----RSAAALESRFGLTILGTVPESTRS
A0A285VUW0      PNPTRNLAIATLAGLMLGLAYALGMQALDTRL----RSTADVEALTGRPVLSTVPVLPTA
A0A4Q2JUT1      PDVQTALIVGGVLGLGFGIAFAMIRTAADRRI----RNAEDTESKTGVAVVGTIPWVAGF
A0A542J310      PDTQTALIVGGVLGLGFGVAFAMIRTAADRRI----RSAADIEQKTDVAVVGTIPWVAAF
A0A444BL03      PDPPRNVLIGIGLGLLVAYLLVFVRRQLDTRL----RSAQDVEAATGASVLGVVPVTSEL
A0A4Y8X357      PDHLRNALIGGSIGLLAALAAAFLRRLLDVNV----RTTTDATQASGAGLLGAIPQDKTM
R4LD52          PRPVRNLVLAALLGLLTGAAGAVLREVLDTTV----KTVEGLQALAAAPVLAAVPFDDDA
A0A4T2CD79      PNVRLSVIIGALIGLVLAIVYAMVRNVLDRRI----RTAATIQQQFKLAVIGVLPKDAAL
A0A4Q4D742      PNVPLNLAAGLLLSLFLAIAGALVRDLLDRTV----KSRRDVETITSSAVLATLPFYPQV
A0A4Q2RU39      PDYERAAMKGAIGGLGLAYAFLIARRLIDRRV----RSAKHVEEATGAAVLGVIPKEEVL
A0A4Q2SK58      PNYERAAMKGAIGGLGIAYAFLIARRLIDRRV----RSAKHVEEATGASVLGIIPKEEAL
A0A2N3YJR1      PDPRRNTLVGLVGGLFLAYALIFVRRQLDTRV----RSAEDVEKETGASVLGVVPVTPEL
A0A1C6T1J1      PQPLRNFTIGGLLGLVAGVALAVLRGMADVRL----RDAAGLQRVTGSPLLGEIPLDTAA
A0A2W2CFC8      PQPVRNVLIGTLIGLLAGVGLAILRGIADLRV----RDGASLRRVTDSPLLGEIPLDNDA
A0A2W2A4B0      PRTRANAALGGAAGAGLGVLAAFLRWALDTKV----RGRDEVQELWDLPVLGDIGFDPEA
A0A4Y9MDA5      PRTSLNLAVGQLAGLLAGCVAALLRDRLDNRV----RDTGVVAELTSLPVVGSIPTRPAG
A0A1H7N9P7      PRTSLNLAVGVLAGLLLGCGLALARDRLDTRV----RDAAVVAQLTGLPVVGSIPTRPSG
A0A1M7V0F8      PRTSLNLAVGVLAGLLAGCAAALVRDLLDNRV----RDAGVVAELTGVPVVGAIPARSPR
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      -----------GERGLYVAREPLGH-----------------------TSEEFRRIRAAL
A0A2N4T4Q5      -----------ADHREIIETGTSGGRGHHA------------------FSEALRELRTNL
A0A1M3LEY6      -----------PKRPLIVQSEPNSP-----------------------RAEAFRSLRTNL
A0A538AJI7      -----------KQGPLAAFSDLRT-------------------------ASAFRILRANL
A0A538AM15      -------------------------------------------------AEQYRALRHTV
A0A022KX11      -----------SKRGLISVEEDPHGRHA----------------------EAVRRLRTNL
A0A255G8R8      -----------TPEH-PLELGAHTDQRF----------------------EAYRRLRTNV
A0A4Y5YMQ6      -----------PAQG-AAFLISPNGSAA----------------------EAFRQVRSAL
A0A4Q5A868      -----------ELLN-SAKPVIVSEPGS-----P--------------VAEGFRRVRTNL
A0A0W8I9Y2      -----------DRLA-DHREIVETGFSAGRGHHE--------------FSEALRELRTNL
A0A345NSU7      -----------DAHS-IYLELDPFGPQA----------------------EAVRQLRTNM
A0A4Q5APW3      -----------NSTKPVIVSEPGSP-----------------------VAEGFRRVRTNL
A0A4Q5B0V3      -----------NSTKPVIVSEPGSP-----------------------VAEGFRRVRTNL
A0A222TG79      -----------ADSPVSFGAGSSP------------------------ASEAYRRLRTNL
A0A1Q2CRV2      -----------SGDVLVLNSDPHGL-----------------------RAEAYRSMRTNL
A0A2S5WZJ5      -----------MGKNRGANDADAI------------------------AAESFRRLRTNL
K6WHS4          -----------DRNVVNFGVGGSP------------------------AAEAFRHLRTNL
A0A1L2ZMQ6      -----------SRGRQ-VLPVVYSAETRTDRSYHA-------------YSEALRELRTNL
A0A3L7ADK2      -----------RKGSQ-LLSQLTETSTESRHASFA-------------MAESLRELRTNL
A0A0G3V3M7      -----------RSLRF--------QVTTAVDPTSL-------------MAEAYRSFRTSL
A0A3E2DN22      -----------AEQRE----------KSIVHISGV-------------TGEAFRHLRTNL
A0A3Q9ULZ9      -----------SKQRK----------TGDLGLSGI-------------TAEAFRQLRTNL
A0A3S9JFL2      -----------TKQRK----------SGDLELAGI-------------AGEAFRQLRTNL
A0A1Q2CI19      -----------QRRNK--------EILTVTQPLSP-------------YADGYRSVRAAL
A0A512T3M3      -----------QRASA--------GTLVVTEPLSP-------------FADGYRAARTAI
W6JTW4          -----------KRSDA--------YHMVLDQPLSP-------------FADAYRAARAAT
A0A0A0JTY0      -----------QRSRA--------SIAVATDPLSI-------------YSDGYRAARTAL
A0A0A0JXF2      -----------QRNRN--------SIAVVEDPLNL-------------YSDAYRAARTAL
E6S8H2          -----------LRRRR--------SIGVADEPLSP-------------YADGYRGARTAL
A0A0A0JGH0      -----------QKGER--------TITVAVDPLSP-------------YSDAYRAARTAL
N0E4U7          -----------QKRKA--------SIMVAADPLDP-------------YSDAYRAARTAL
A0A0A0IYK2      -----------ERHQG--------AIAVAEDPLSN-------------YSDGYRAARTAL
A0A0Q9L0H3      -----------QRNSA--------SIAVASDPLSN-------------YSDGYRAARTAL
A3TMK0          -----------QRNRA--------TLGVLEDPLSL-------------YADGYRAARTAL
A0A543PXP1      -----------QRSSP--------SIGVAEQPLSP-------------YSDSYRAARTAL
A3TMH6          -----------KRRDK--------TIGVAEQPLSP-------------YADAYRGARTAI
A0A5R8VLL6      -----------TGENKVLGGLPAAPAPGSRPQSPA-------------FSEALRELRTNL
A0A1H6WL79      -----------SEKSS---VLESTSVVHRVPGGHA-------------MAEALRELRTNL
A0A101LAM5      -----------SEKSS---VLESTTGMHRVPGGHA-------------MAEALRELRTNL
A0A4Y3NEG0      -----------SEKSS---VLE-TTGTHRVPGGHA-------------MAEALRELRTNL
A0A1H6YPK1      -----------AKKGP-----------LGAVPGFA-------------FTEAMRQLRTNL
A0A2R7MGI0      -----------ANGRA----VFSFTDIRDGRGSFA-------------HKEAIRELRTNL
A0A2T7WQY4      -----------ANGRA----VFSFTDTHDGRGSFA-------------HKEAVRELRTNL
A0A1G6GTN3      -----------ASGRA----VFSFDDIKDGRGSFA-------------HKEAMRELRTNL
A0A1N7DLV3      -----------AAGRA----VFSFDDIRDGRGSFA-------------HKEAMRELRTNL
A0A1V2NSB5      -----------AAGRA----VFSFDDIRDGRGSFA-------------HKEAMRELRTNL
A0A0Q5Q5L3      -----------AAGRA----VFSFDDIRDGRGSFA-------------HKEAMRELRTNL
A0A0Q6DVM4      -----------AAGRA----VFSFDDIRDGRGSFA-------------HKEAMRELRTNL
A0A1R3WWR6      -----------ASGRA----VFSFDDIRDGRGSFA-------------HKEAMRELRTNL
A0A5Q2FA83      -----------TSPTV----------MSSDPHGVA-------------A-EEYRRLRTNL
A0A542FTE6      -----------DAGRRLATAVSPLSGPARRSHFAI-------------T-EGIRELRTNL
A0A2S5UYV0      -----------MGKNR----------ASNDADAIA-------------A-ESFRRLRTNL
A0A2S5X9U6      -----------MGKNR----------GTNDADAIA-------------A-ESFRRLRTNL
A0A2S5ULV5      -----------MGKNR----------GTNDADAIA-------------A-ESFRRLRTNL
A0A653YMF0      -----------MGKNR----------GTNDADAIA-------------A-ESFRRLRTNL
A0A4V1VGV9      -----------QSRRR---------GGL-GELGTT-------------A-EAFRMLRTNL
A0A3Q9IY80      -----------TADNRLLPVDGISSGSHADLFGVS---------------EAMRELRTNL
A0A0F0LP73      -----------GRSKK---------DAIARAVAH----------------EAHRQIRTGL
A0A1F1X071      -----------ARGKD---------GVLPEPTSFP-------------SREALRKLRTNL
A0A3R8RWC7      -----------ARGKD---------GVLPEPASFP-------------SREALRKLRTNL
A0A4U0RJZ4      -----------QTKSR---------GGL-GALGST-------------S-EAFRMLRTNL
A0A4R1FGL9      -----------QTKSR---------GGL-GALGST-------------S-EAFRMLRTNL
E3B8H1          -----------QTKSR---------GGL-GALGST-------------S-EAFRMLRTNL
A0A0Q5AWK6      -----------RAGRK---------GET--VDRIT-------------A-EAYRALRTGL
A0A3N1NLD3      -----------RVGRR---------GDARAVDGIT-------------A-EAFRALRTGL
A0A3N2FVI8      -----------RGGRR---------GDARAVDGIT-------------A-EAFRALRTGL
A0A2S5XDQ6      -----------RPGRT---------GGRRGTDALT-------------A-EAFRSLRTGL
A0A2S5XNN6      -----------RPGRT---------GGRRGTDALT-------------A-EAFRSLRTGL
A0A538JQF8      ----------ARRVPG---------ILAFNRPLSP-------------LAEGYRVLRTSL
A0A0Q5JKD6      AGGRAVFSFDDIKDGR---------GSFAHK-------------------EAMRELRTNL
A0A0Q9TBP0      -----------SHRDR---------LVTLVDPHSP-------------ASEEYQRLGVNV
A0A346XTB0      ------------SEDQ---------LTGLLRVDPS-------------AAEAYEFVLSSI
A0A2W6DK08      ----------ERRNFA---------VITASEPESS-------------AAEAYRSLRSSI
A0A2S0LQ32      -------------SAK---------GRRNVDGLGQ-------------AAEAIRLLRTNL
A0A2N6V1R5      -------------NAK---------GRQNVDGLGQ-------------AAEALRHLRTNL
G9PHS6          -------------NAK---------GRQNVDGLGQ-------------AAEALRHLRTNL
U1PLM7          -------------NAK---------GRQNVDGLGQ-------------AAEALRHLRTNL
A0A351ETF8      -----------NSDQV---------VEVIERPKSL-------------AAERYEAVLTAI
A0A349B7N2      -----LLRRRQRRNSE---------VVSAERPRSR-------------IAEAYRGLRTSV
A0A346Y185      GLTGSVPTVEAPKSPA---------G------------------------EAYQFLVGAL
A0A259S8H9      -----------RKSGQ---------GRNAALARAV-------------AHEAYRQIRTGL
A0A0Q5L115      AEHGGLVAALPNATAD---------DRHVNFAMS----------------EALRELRTNL
A0A2W1Z497      TDHRQLVDALPNRTPE---------ERRVNFATS----------------EALRELRTNL
A0A3L8NYD3      -----------DRVGD---------DGLVGSQTGP-------------AAEALRQLRTNL
A0A1M6K628      --------------AS---------GVSLVNDSGT-------------AAEALRQLRTNL
A0A561E8R3      --------------AE---------DYRGDTGLGN-------------AAEALRMLRTNL
A0A1H4I042      -----------RGTPAISFGTENSQ-----------------------IAESFRKLRTNL
A0A4R7A6D9      -----------RGAPAISFGTENSQ-----------------------IAESFRKMRTNL
A0A4Q4D4T1      -----------ADHPLISTLSNQHP-----------------------RAEAMRIIRTNL
A0A261FE22      -----------AGRTPAVIVKPRGH-----------------------AAEEFRRLITNL
A0A5C8C085      -----------AHDTNEAANLAVLEAAARGAGQS--------------AAEAFRKLRTNL
A0A1E4BP96      -----------DNRREVLSFTGASGNVVRGA-----------------LTEAIRELRTNL
A0A101KZQ4      -----------DREQRLITSIGGNDRNEEHAGEYA-------------VAESIRELRTNL
A0A439DNZ6      -----------KRSPAKSLDNDNSA-----------------------FAEAFRKLRTNL
A0A0J6YE86      -----------RRHAAIAFENDNSV-----------------------IAEAFRKLRTNL
A0A5Q5BFU2      -----------RKQAAIGFESDNSG-----------------------IAEAFRKLRTNL
A0A151BT98      -----------GGGHRVVDTSDHPSGA---------------------MVEAMRRLRTNV
A0A2Y8ZRF8      -----------GSGQRVVDTSDSPSGA---------------------MVEAMRRLRTNV
A0A2R9UAT1      -----------TAANRLIPVGGQRDERLFA------------------VSEALRELRTNI
A0A4Q5J5D7      -----------ASTDGAGPVAVQDRSGSQRRSE---------------SAEAFRKLRTNL
A0A1Y4CKD6      -----------ARKRSAASRYVSALDKRVSHG----------------FRESARAMGARV
A0A0Q7KBQ4      -----------KKQALTSEGHGA-------------------------LAEAFRVLRTNL
A0A1F1IHY9      -----------ARNRRRRDGGDVINLAGRVDGET----SPKQHQDSFRLTESFKELRTNL
A0A542HCT5      -----------VRKKGGLVPLVVTGPRKDKDPVH--------------SAESFLKLRTNL
A0A2S8WHZ8      -----------TEGRSVVETGSIVHDDRAAHA----------------FSESLRELRTNL
A0A537WNY9      -----------TRLATPEALALDNRLHV--------------------FAEALRDVRTNL
A0A5B8M469      -----------KGKGGVRGGELDRL-----------------------SAESFRQVRTGL
A0A1Y4CTD2      -----------VVRGGDERSVPALVLSSPLVSMG--------------FAEANRRTATRL
A0A0Q5M6Z7      -----------EDRRRVTDSDSGDDAVELFT-----------------ISESLRELRTNL
A0A3N3ZPU0      -----------TAKRGVIPTAPPRKDREAWA-----------------TSEAFRQLRTNL
A0A359IQX7      -----------EQQRVEEGQVSLGE-----------------------ASEAFRHLRTNL
A0A4R8TXC3      -----------TEENIVTGSSSDHI-----------------------AQESIRQLRTNL
A0A433EDP2      -----------TEENIVTGSSNDHI-----------------------AQESIRQLRTNL
A0A231VTW0      -----------TEENIVTGSSNDHI-----------------------AQESIRQLRTNL
A0A433ECD0      -----------TEENIVTGSSNDHI-----------------------AQESIRQLRTNL
U7V3Z1          -----------TEENIVTGSSNDHI-----------------------AQESIRQLRTNL
A0A1F1J417      -----------AEENIVHASNDDHI-----------------------AHESIRQLRTNL
A0A2A8D6P2      -----------AEENIVHASNDDHI-----------------------AHESIRQLRTNL
A0A1F0THV9      -----------AEENIVHASNDDHI-----------------------AHESIRQLRTNL
A0A5F0M6Y0      -----------AEENIVHASNDDHI-----------------------AHESIRQLRTNL
D8USQ4          -----------AEENIVHASNDDHI-----------------------AHESIRQLRTNL
E3H5W1          -----------AEENIVHASNDDHI-----------------------AHESIRQLRTNL
A0A1F1QKB0      -----------AEENIVRASNDDHI-----------------------AHESIRQLRTNL
A0A509JY23      -----------AEENIVRASNDDHI-----------------------AHESIRQLRTNL
A0A448USF4      -----------AEENIVRASNDDHI-----------------------AHESIRQLRTNL
A0A0Q9LZR0      -----------VRKKGGLVPLVVAGTSKEKDPVH--------------SAESFLKLRTNL
A0A1N7E3F1      -----------RRHPLVLRDQGRSV-----------------------RAEAFRSLRTNL
A0A544ZKQ1      -----------KRHPLILRDQGRSS-----------------------RAEAFRSLRTNL
A0A372P1T1      -----------KRHPLILRDQGRSS-----------------------RSEAFRSLRTNL
A0A5D0Q2X0      -----------KRHPLILRDQGRSS-----------------------RSEAFRSLRTNL
A0A5R8Z2E7      -----------KRHPLILRDQGRSS-----------------------RSEAFRSLRTNL
A0A1L2ZMV4      -----------DHHRQVITVGEPGDKQGWA------------------TSEALRELRTNL
A0A1S1CAD0      -----------NEDNIVKGDTDDHI-----------------------AQESIRQLRTNL
G5ET14          -----------NEDNIVKGDTDDHI-----------------------AQESIRQLRTNL
A0A1E9DXX2      -----------NEENIVNGDTDDHI-----------------------AQESIRQLRTNL
A0A1E8S156      -----------NEDNIVKGDTDDHI-----------------------AQESIRQLRTNL
A0A1E8S5S2      -----------NEDNIVKGDTDDHI-----------------------AQESIRQLRTNL
A0A1S1DFA8      -----------NEDNIVKGDTDDHI-----------------------AQESIRQLRTNL
A0A2I1Z490      -----------NEDNIVKGDTEDHI-----------------------AQESIRQLRTNL
A0A1F0DAA9      -----------NEENIVKGNTDDHI-----------------------AQESIRQLRTNL
A0A1F0PHK9      -----------NEENIVKGNTDDHI-----------------------AQESIRQLRTNL
A0A1F0VZG6      -----------NEENIVKGNTDDHI-----------------------AQESIRQLRTNL
A0A1E9G8X4      -----------NEENIVNGNTDDHI-----------------------AQESIRQLRTNL
A0A1E9IAW2      -----------NEENIVNGNTDDHI-----------------------AQESIRQLRTNL
A0A1E9ZBC9      -----------NEENIVNGNTDDHI-----------------------AQESIRQLRTNL
A0A1E9ZDP4      -----------NEENIVNGNTDDHI-----------------------AQESIRQLRTNL
A0A1F0R6B5      -----------NEENIVNGNTDDHI-----------------------AQESIRQLRTNL
A0A1F0Z7N5      -----------NEENIVNGNTDDHI-----------------------AQESIRQLRTNL
A0A1F1D897      -----------NEENIVNGNTDDHI-----------------------AQESIRQLRTNL
D2NP38          -----------NEENIVNGNTDDHI-----------------------AQESIRQLRTNL
A0A1F1FV74      -----------NEENIVKGDTDDHI-----------------------AQESIRQLRTNL
A0A1E9M791      -----------NEENIVKGDTDDHI-----------------------AQESIRQLRTNL
A0A291DEI8      -----------NEENIVKGDTDDHI-----------------------AQESIRQLRTNL
A0A1S1D5T1      -----------SEENIVNGGTDDHI-----------------------AQESIRQLRTNL
A0A1E8TRD6      -----------SEENIVNGDTDDHI-----------------------AQESIRQLRTNL
A0A1F0XT88      -----------SEENIVNGDTDDHI-----------------------AQESIRQLRTNL
A0A1F1EVP5      -----------SEENIVNGDTDDHI-----------------------AQESIRQLRTNL
C6R548          -----------SEENIVNGDTDDHI-----------------------AQESIRQLRTNL
A0A0K2RXS2      -----------NEENIVNGNTDDHI-----------------------AQESIRQLRTNL
A0A1F0KX60      -----------NEENIVNGNTDDHI-----------------------AQESIRQLRTNL
A0A542I3V2      -----------SGALKVLGTERHQLTQAGERNRA--------------FVEALRALRTNL
A0A2T0UZ65      -----------RKARGGRSSG-----------LG----L---------AGESFRQIRTNL
A0A1R4JTI6      -----------GRRAQRNRTQSKDSNAEVESRSALLELTGHTGRDDFHVVEAFKELRTNL
A0A4R7TM52      -----------TSAGRLIPFG----------GGY----DEGIRSKHFRVAEAMRELRTNI
A0A542XE74      -----------KVRKGQASKR----------VSG----A---------AGEALRQLRTNL
A0A0G3V3F3      -----------E------------------------------------TVEAFRVLRTNL
A0A0Q7QDF6      -----------ADHPLISTLS----------NQH----P---------RAEAMRIIRTNL
A0A3S0V9U6      -----------DQNSFLEDAA-----------DH----Q---------SAESLRQLRTNL
A0A2R7Z032      -----------NRTHRGVRGD-----------LG----Q---------AAEAFRQLRTNL
A0A1I0W453      -----------GRSHRGVRGD-----------LG----K---------AAESFRQLRTNL
A0A1H4LCS9      -----------GRGHRGVRGD-----------LG----R---------AAESFRQLRTNL
A0A4Q2RZP8      -----------GRGHRGVRGD-----------LG----R---------AAESFRQLRTNL
A0A0Q6VV12      -----------GRTHRGVRGD-----------LG----R---------AAESFRQLRTNL
A0A495NTA9      -----------DRGHRGVRGD-----------LG----R---------AAEAFRQLRTNL
A0A0Q9QB08      -----------GRVNRGVRGD-----------LG----R---------AAEAFRVLRTNL
A0A4Q2SA86      -----------GRTHRGVRGD-----------LG----R---------AAEAFRQLRTNL
A0A4Z1C3Z0      -----------GRTHRGVRGD-----------LG----R---------AAEAFRLLRTNL
A0A5R8L819      -----------SSASRLL-------------PAG----GSHVPHELFAMSEAMRELRTNI
A0A261FQA1      -----------RGTAPAVISD----------PSS----K---------AAEDIRRLALNL
A0A1Q2CJ92      -----------AGESALVTGS------------S----A---------AAEAIRQIRTNL
A0A2T0S3C8      -----------RSGPLRLTGS----------GHS----P---------RSEALRQLRTNL
A0A4Y8WZJ3      -----------ARNRRRRDGGDVINLAGRVDGET----SPKQHQDSFRLTESFKELRTNL
A0A285VUW0      -----------GRTSSMYIEN---------DPFG----P---------QAEAIRKLRTNL
A0A4Q2JUT1      -----------DSGERLVDTS--AANRTGRTGTF----A---------VSEALRSLRTNL
A0A542J310      -----------NDDNRIVDPA--AANSTGKNGTF----A---------VSEALRSLRTNL
A0A444BL03      -----------RVQGGRGRLD----------HLG----I---------ASESFRQIRTNL
A0A4Y8X357      -----------TAERTDRLGD----------PSP----R---------AAEAVRQLRTNL
R4LD52          -----------KEGPRALLGT----------GHS----A---------RAEALRQLRTNL
A0A4T2CD79      -----------TDENRIVSETGGIHAGSVTVQSR----P---------LAEAFRELRTNM
A0A4Q4D742      -----------KKEP--LSAE----------TGG----N---------LAEAFRVLRTNL
A0A4Q2RU39      -----------GRTHRGVRGD-----------LG----R---------AAEAFRQLRTNL
A0A4Q2SK58      -----------GRSHRGVRGD-----------LG----K---------AAEAFRQLRTNL
A0A2N3YJR1      -----------RAARGRGRLD----------ALG----A---------SAESFRQIRTNL
A0A1C6T1J1      -----------RTAPLIVGEA----------ATS----A---------RAEAVRKLRTNL
A0A2W2CFC8      -----------RTAPLIIGVA----------AAS----A---------RAEAIRKLRTNL
A0A2W2A4B0      -----------SKQPLVLRDA----------RAS----A---------RAEAFRSLRTNV
A0A4Y9MDA5      -----------STPGAVVDAD----------PSG----V---------VAEAFRQLRTNL
A0A1H7N9P7      -----------STAHPAVDAD----------PHG----V---------VAEAVRQFRTNL
A0A1M7V0F8      -----------SAPGAVVETD----------SHS----V---------AAEAFRHLRTNL
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      --------------------------------------------------EEIRRLRTNV
A0A357ZCV8      ------------------------------------------------VQNAAKTLYANI
A0A419GS64      ------------------------------------------------LAESYRTLRANI
A0A538BYZ4      ------------------------------------------------AAEQYRGLRHLV
A0A4R1CW45      ------------------------------------------------RSRPFSLMRTQL
A0A4R5Z7B0      ------------------------------------------------ISEQYRTIRTNI
A0A2V2CXY5      ------------------------------------------------VTEALNQFRINL
A0A2S8MDM2      ------------------------------------------------TAEAFRKLRTNL
A0A357ZDL3      ------------------------------------------------IQNAIKTLYANI
A0A4Y8ZIU8      -------------------------------------------------------LRTNL
A0A0F0KYJ9      ----------------------------------------------------MRELRTNL
A0A510HHA8      --------------------------------------------------EAYRTLRTGL
A0A538BBM6      ------------------------------------------------QREAVRVLRSNL
A0A1I6GVG4      ------------------------------------------------IGEAMRELRTNL
A0A1I6IST1      ------------------------------------------------IGEAMRELRTNL
A0A412JBM5      --------------------------------------------------EAYVRLRTNL
A0A1C2B334      --------------------------------------------------ESYRRIRTNL
R7Y679          --------------------------------------------------EQFRKIRTNL
A0A5Q2F9A3      --------------------------------------------------EAFRRLRTNL
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      --------------------------------------------------------RTNL
A0A023X491      --------------------------------------------------EAYRTLRTSL
A0A4R1BMZ2      --------------------------------------------------EAYRTLRTNL
A0A1Q7WJN6      --------------------------------------------------EALRGVRLNV
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      --------------------------------------------------EQYRVLRHLV
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      --------------------------------------------------EAFRLLRTNL
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      SYS--GV---------------------------------------AEK----VQ-RLMV
A0A2N4T4Q5      SFV--SV---------------------------------------DAP----PR-VVVV
A0A1M3LEY6      QFL--DV---------------------------------------EGG----PR-SFVV
A0A538AJI7      EPQ--LR---------------------------------------EGS----ID-LIVV
A0A538AM15      EQL--HK---------------------------------------ARD----LR-IVAV
A0A022KX11      MFV--DV---------------------------------------TTG----RH-SFVI
A0A255G8R8      QFV--AA---------------------------------------PQG----RT-ALVV
A0A4Y5YMQ6      RFS--AV---------------------------------------EHQ----IG-VLAV
A0A4Q5A868      SFM--APME-------------------------------------DTN----CR-LIVV
A0A0W8I9Y2      SFV--SV---------------------------------------DSP----PK-MIVV
A0A345NSU7      MFV--DV---------------------------------------TTG----KH-SFVI
A0A4Q5APW3      SFM--APVE-------------------------------------DTN----CR-LIVV
A0A4Q5B0V3      SFM--APVE-------------------------------------DTN----CR-LIVV
A0A222TG79      SFI--GV---------------------------------------DSP----HR-RFAV
A0A1Q2CRV2      QFL--AL---------------------------------------DKG----GR-SIVV
A0A2S5WZJ5      RFA--SV---------------------------------------DEE----IR-SMVI
K6WHS4          SFM--DV---------------------------------------DSP----AR-MIAV
A0A1L2ZMQ6      AYM--DV---------------------------------------DNP----PR-VIVV
A0A3L7ADK2      SYV--DV---------------------------------------DNP----PQ-VFVV
A0A0G3V3M7      VAM--WQRHPTNNRPVLAGASEPE----------------------ATP----LR-VLLV
A0A3E2DN22      RFA--NV---------------------------------------DNP----PR-AVVV
A0A3Q9ULZ9      RFI--NV---------------------------------------DHP----PK-AVVI
A0A3S9JFL2      RFI--NV---------------------------------------DHP----PK-AVVV
A0A1Q2CI19      AHG--QAEAAPA----------------R-----------------GHQ----SL-VVLV
A0A512T3M3      SHT--LGRSAKPSDMSPR-----ERRGTR-----------------TNH----TP-WVLV
W6JTW4          THS--VETSRAAAPRGPR-----E--NDP-----------------EPQ----AV-AVLV
A0A0A0JTY0      VHT--TGQVMPGDYTPRRAASEVPEKQ-A-----------------ATG----AR-LIVV
A0A0A0JXF2      SHT--AGQVMPSDYTPRR--STVEPRR-S-----------------ASS----AR-LVLI
E6S8H2          VHT--SSLLVQGD--DRR--PTSPPEPVS-----------------AAS----AS-LILV
A0A0A0JGH0      MHT--VSRQAPGEYMGRR--AARPEPRPV-----------------VEG----AR-LILV
N0E4U7          MHT--VSRKMTGDYTGRR--AATAERGGT-----------------ATG----AR-LILV
A0A0A0IYK2      VHT--TGQIMPGDYTPRR--SAAGARP-A-----------------AKG----AR-LILV
A0A0Q9L0H3      VHT--SGQIMPGDYTPRR--PGGEESR-S-----------------RQG----GR-LVLI
A3TMK0          THT--AGQVMPGDYSPRR--SAIEPRR-P-----------------ANT----AR-LVLI
A0A543PXP1      AHT--ASQHAGASVSSTD--VPRGYAA--------------------AQ----GR-LILV
A3TMH6          VHT--ASQRLSVGSAPRH--LLDGPAT-Q-----------------LEG----AR-VVLV
A0A5R8VLL6      TFL--DV---------------------------------------DNP----PR-IIVV
A0A1H6WL79      NFI--DV---------------------------------------DNP----PR-ILLI
A0A101LAM5      DFI--DV---------------------------------------DNP----PR-ILLI
A0A4Y3NEG0      DFI--DV---------------------------------------DNP----PR-ILLI
A0A1H6YPK1      QFM--NV---------------------------------------DHP----PR-VLVV
A0A2R7MGI0      QYV--DV---------------------------------------DRP----PR-VIVV
A0A2T7WQY4      QYV--DV---------------------------------------DHP----PR-VIVV
A0A1G6GTN3      QYV--DV---------------------------------------DRP----AR-IVVV
A0A1N7DLV3      QYV--DV---------------------------------------DRP----PR-VMVV
A0A1V2NSB5      QYV--DV---------------------------------------DRP----PR-VMVV
A0A0Q5Q5L3      QYV--DV---------------------------------------DRP----AR-IMVV
A0A0Q6DVM4      QYV--DV---------------------------------------DRP----AR-IMVV
A0A1R3WWR6      QYV--DV---------------------------------------DRP----AR-VMVI
A0A5Q2FA83      QFA--DV---------------------------------------TTG----GKHSFVI
A0A542FTE6      AYV--SI---------------------------------------DDP----PS-VVVV
A0A2S5UYV0      RFA--SV---------------------------------------DEE----IR-SMVI
A0A2S5X9U6      RFA--SV---------------------------------------DEE----IR-SIVV
A0A2S5ULV5      RFA--SV---------------------------------------DEE----IR-SIVV
A0A653YMF0      RFA--SV---------------------------------------DEE----IR-SIVV
A0A4V1VGV9      RYI--ST---------------------------------------ERP----PR-SLVI
A0A3Q9IY80      QFM--DV---------------------------------------DNP----PR-IIVV
A0A0F0LP73      RFA--SV---------------------------------------DQE----VR-VVMV
A0A1F1X071      RYI--DV---------------------------------------DNP----PR-SIVV
A0A3R8RWC7      RYI--DV---------------------------------------DNP----PR-SIVV
A0A4U0RJZ4      RYV--LA---------------------------------------EQP----PR-SLVI
A0A4R1FGL9      RYV--SA---------------------------------------EQP----PR-SLVI
E3B8H1          RYV--SA---------------------------------------EQP----PR-SLVI
A0A0Q5AWK6      RFS--SV---------------------------------------DDE----TR-SVVI
A0A3N1NLD3      RFS--SV---------------------------------------DDE----TR-SVVI
A0A3N2FVI8      RFS--SV---------------------------------------DDE----TR-SVVI
A0A2S5XDQ6      RFS--SV---------------------------------------DEE----TR-SVVI
A0A2S5XNN6      RFS--SV---------------------------------------DEE----TR-SVVI
A0A538JQF8      LRM--PTRVFTEAPPTPDASGGHPEVEAAAAVPSGVGEWRPVGDSNGAT----PK-VVLV
A0A0Q5JKD6      QYV--DV---------------------------------------DRP----AR-VLVV
A0A0Q9TBP0      RFM--VATG------------------A------------------QES----AP-IVLL
A0A346XTB0      EFA--LA---------------------------------------DLD----GK-SLLI
A0A2W6DK08      MFT--ENRM------------------NHFDREDMVLDRSAVDT--TQP----PQ-VILV
A0A2S0LQ32      RFV--DV---------------------------------------DNP----PR-AIVM
A0A2N6V1R5      RFV--DV---------------------------------------DNP----PR-AIVM
G9PHS6          RFV--DV---------------------------------------DNP----PR-AIVM
U1PLM7          RFV--DV---------------------------------------DNP----PR-AIVM
A0A351ETF8      EFA--SI---------------------------------------GEP----VS-SVLF
A0A349B7N2      QYM--GVVT------------------SRVGESPSDLRRQQTKRRDRSD----GT-VVLV
A0A346Y185      AFA--LA---------------------------------------ETG----GQ-SVVL
A0A259S8H9      RFA--SV---------------------------------------DQE----VR-VVMV
A0A0Q5L115      AYV--KV---------------------------------------DAQ----PR-VIVM
A0A2W1Z497      SYV--HV---------------------------------------DER----PK-VLVV
A0A3L8NYD3      RFV--DV---------------------------------------DKP----PQ-SIVI
A0A1M6K628      RFV--SV---------------------------------------DTP----VR-SIVV
A0A561E8R3      RFI--DV---------------------------------------DRH----PR-SIVV
A0A1H4I042      SFL--SV---------------------------------------DNP----PR-VIVV
A0A4R7A6D9      SFL--SV---------------------------------------DNP----PR-VIVV
A0A4Q4D4T1      QFL--DV---------------------------------------DRV----SN-VYVV
A0A261FE22      SFV--KN---------------------------------------DRGNR--GN-VLVV
A0A5C8C085      QFM--NV---------------------------------------DNP----PR-IIVV
A0A1E4BP96      QFM--DV---------------------------------------DDP----PR-SIVV
A0A101KZQ4      QFM--NI---------------------------------------DNP----PR-TIVI
A0A439DNZ6      QFL--AV---------------------------------------DNP----PR-VIVV
A0A0J6YE86      QFL--SV---------------------------------------DNP----PR-VIVI
A0A5Q5BFU2      QFL--AV---------------------------------------DNP----PR-VIVL
A0A151BT98      KFV--NV---------------------------------------TND----VP-AVVV
A0A2Y8ZRF8      KFV--NV---------------------------------------TND----VP-AVVV
A0A2R9UAT1      QFM--DV---------------------------------------DHP----PR-VVVV
A0A4Q5J5D7      QFM--DV---------------------------------------DNP----PR-VIII
A0A1Y4CKD6      RDA--LS---------------------------------------ERG----AK-VVLV
A0A0Q7KBQ4      QFA--NL---------------------------------------DAK----VE-SILV
A0A1F1IHY9      QFL--RP---------------------------------------DEA----VS-IVTV
A0A542HCT5      QFM--DI---------------------------------------DNP----PR-IIVV
A0A2S8WHZ8      NYI--DV---------------------------------------DNP----PR-IIVV
A0A537WNY9      LFT--EG---------------------------------------GK-----LR-SVLI
A0A5B8M469      RFS--SV---------------------------------------DGE----VR-CVVV
A0A1Y4CTD2      EAH--LR---------------------------------------SGG----FK-TVLV
A0A0Q5M6Z7      SYI--DV---------------------------------------DQP----PK-VIVV
A0A3N3ZPU0      TFA--NV---------------------------------------DDP----PR-TVVV
A0A359IQX7      RYV--NV---------------------------------------DSP----PK-CIVV
A0A4R8TXC3      RFV--NI---------------------------------------DEP----PR-SFLV
A0A433EDP2      RFV--NI---------------------------------------DEP----PR-SFLV
A0A231VTW0      RFV--NI---------------------------------------DEP----PR-SFLV
A0A433ECD0      RFV--NI---------------------------------------DEP----PR-SFLV
U7V3Z1          RFV--NI---------------------------------------DEP----PR-SFLV
A0A1F1J417      RFV--NI---------------------------------------DNP----PS-SFIV
A0A2A8D6P2      RFV--NI---------------------------------------DNP----PS-SFIV
A0A1F0THV9      RFV--NI---------------------------------------DNP----PS-SFIV
A0A5F0M6Y0      RFV--NI---------------------------------------DNP----PS-SFIV
D8USQ4          RFV--NI---------------------------------------DNP----PS-SFIV
E3H5W1          RFV--NI---------------------------------------DNP----PS-SFIV
A0A1F1QKB0      RFV--NI---------------------------------------DNP----PS-SFIV
A0A509JY23      RFV--NI---------------------------------------DNP----PS-SFIV
A0A448USF4      RFV--NI---------------------------------------DNP----PS-SFIV
A0A0Q9LZR0      QFM--DI---------------------------------------DNP----PR-IIVI
A0A1N7E3F1      QFI--GV---------------------------------------DRQ----PK-SLVV
A0A544ZKQ1      QFI--GV---------------------------------------DRQ----PK-SLVV
A0A372P1T1      QFI--GV---------------------------------------DRQ----PK-SLVV
A0A5D0Q2X0      QFI--GV---------------------------------------DRQ----PK-SLVV
A0A5R8Z2E7      QFI--GV---------------------------------------DRQ----PK-SLVV
A0A1L2ZMV4      TFS--RV---------------------------------------DNP----PR-IIVV
A0A1S1CAD0      RFV--NV---------------------------------------DTP----PR-SFIV
G5ET14          RFV--NV---------------------------------------DTP----PR-SFIV
A0A1E9DXX2      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1E8S156      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1E8S5S2      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1S1DFA8      RFV--NV---------------------------------------DTP----PR-SFIV
A0A2I1Z490      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1F0DAA9      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1F0PHK9      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1F0VZG6      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1E9G8X4      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1E9IAW2      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1E9ZBC9      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1E9ZDP4      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1F0R6B5      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1F0Z7N5      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1F1D897      RFV--NV---------------------------------------DTP----PR-SFIV
D2NP38          RFV--NV---------------------------------------DTP----PR-SFIV
A0A1F1FV74      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1E9M791      RFV--NV---------------------------------------DTP----PR-SFIV
A0A291DEI8      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1S1D5T1      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1E8TRD6      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1F0XT88      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1F1EVP5      RFV--NV---------------------------------------DTP----PR-SFIV
C6R548          RFV--NV---------------------------------------DTP----PR-SFIV
A0A0K2RXS2      RFV--NV---------------------------------------DTP----PR-SFIV
A0A1F0KX60      RFV--NV---------------------------------------DTP----PR-SFIV
A0A542I3V2      RFV--DV---------------------------------------DHR----PR-IILV
A0A2T0UZ65      RFV--SP---------------------------------------DAP----PQ-SIVV
A0A1R4JTI6      QFL--RP---------------------------------------DNP----PR-IIVV
A0A4R7TM52      QFM--DV---------------------------------------DRP----PR-IIVV
A0A542XE74      RFV--SV---------------------------------------DAP----PR-SVVV
A0A0G3V3F3      MVL--EA---------------------------------------AGR----PR-TVAV
A0A0Q7QDF6      QFL--DV---------------------------------------DRV----SN-VYVV
A0A3S0V9U6      RFV--SV---------------------------------------DQP----PR-SIIV
A0A2R7Z032      RFL--DV---------------------------------------DNP----PR-RIVI
A0A1I0W453      RFV--DV---------------------------------------DNE----PR-KIVV
A0A1H4LCS9      RFV--DV---------------------------------------DNE----PR-RIVV
A0A4Q2RZP8      RFV--DV---------------------------------------DNE----PR-RIVV
A0A0Q6VV12      RFV--DV---------------------------------------DNE----PR-KIVV
A0A495NTA9      RFV--DV---------------------------------------DNE----PR-KIVV
A0A0Q9QB08      RFV--DV---------------------------------------DNE----PR-RIVV
A0A4Q2SA86      RFV--DV---------------------------------------DNE----PR-RIVV
A0A4Z1C3Z0      RFV--DV---------------------------------------DNE----PR-RIVV
A0A5R8L819      QFM--DV---------------------------------------DHP----PR-ILVV
A0A261FQA1      DFI--VP---------------------------------------DKTDM--SN-VIVV
A0A1Q2CJ92      RFV--SV---------------------------------------DNP----AK-SIVI
A0A2T0S3C8      QFV--DV---------------------------------------DRP----VK-TLVI
A0A4Y8WZJ3      QFL--RP---------------------------------------DEA----VS-IVTV
A0A285VUW0      VFV--DV---------------------------------------ASD---AGH-SFVV
A0A4Q2JUT1      QFM--DV---------------------------------------DHP----PK-TIVV
A0A542J310      QFM--DV---------------------------------------DHP----PK-TIVV
A0A444BL03      RFV--GV---------------------------------------DDP----PR-SIVV
A0A4Y8X357      RFA--AV---------------------------------------DDP----PR-VVMV
R4LD52          QYV--DV---------------------------------------DRP----VK-TLVV
A0A4T2CD79      RFM--RV---------------------------------------DSP----PR-IIVI
A0A4Q4D742      QFV--KL---------------------------------------DAE----RQ-AILV
A0A4Q2RU39      RFV--DV---------------------------------------DNE----PR-KIVV
A0A4Q2SK58      RFV--DV---------------------------------------DNE----PR-KIVV
A0A2N3YJR1      RFV--GV---------------------------------------DDP----PR-SIVV
A0A1C6T1J1      RFV--DV---------------------------------------HEP----AR-VIAV
A0A2W2CFC8      RFV--DA---------------------------------------DEP----AR-VIAI
A0A2W2A4B0      QFL--AS---------------------------------------RPE---GAR-TLAI
A0A4Y9MDA5      QFV--GV---------------------------------------GDGDREGGR-VTAI
A0A1H7N9P7      QFL--GM---------------------------------------QDEERAGAR-IVAV
A0A1M7V0F8      QFV--GV---------------------------------------QDEDQGGAR-VLAV
A0A1V8PLV6      --------------------------------------------------------MIVI
A0A4R0U4F1      MFV-LPD---------------------------------------EPL----SN-VIVV
A0A357ZCV8      RFL--SP---------------------------------------DKP----IK-SIAI
A0A419GS64      LLT--NV---------------------------------------DSE----IG-SVVV
A0A538BYZ4      EQF--HK---------------------------------------SAR----LS-VLAV
A0A4R1CW45      AKR--LV---------------------------------------EEK----IR-LVGV
A0A4R5Z7B0      QYS--SI---------------------------------------DKE----LK-VLMV
A0A2V2CXY5      GFC-------------------------------------------GDE----VK-TIMV
A0A2S8MDM2      QFL--AI---------------------------------------DSP----PR-VLVV
A0A357ZDL3      RFL--SP---------------------------------------DNP----VK-TIAI
A0A4Y8ZIU8      RFA--AV---------------------------------------DDP----PR-TIAF
A0A0F0KYJ9      VYM--DV---------------------------------------DNP----PR-IIVV
A0A510HHA8      LYA--VV---------------------------------------DAP----PR-VISL
A0A538BBM6      QVA--LA---------------------------------------GLE----NP-IVIV
A0A1I6GVG4      QYM--DV---------------------------------------DNP----PR-IIVV
A0A1I6IST1      QYM--DV---------------------------------------DNP----PR-IIVV
A0A412JBM5      MFCVNGD---------------------------------------GDP----CT-TFLV
A0A1C2B334      AFA--AV---------------------------------------DPA----SR-RILV
R7Y679          TFA--NV---------------------------------------DNS----VR-KILI
A0A5Q2F9A3      QYL--GR---------------------------------------GQG----GN-SFVI
A0A0K8Q3D9      ----------------------------------------------------------MV
A0A2R7RCA1      SFL--DV---------------------------------------DQP----PR-IIVV
A0A023X491      LYS--VV---------------------------------------DEP----PH-VVAV
A0A4R1BMZ2      LYA--LV---------------------------------------DDP----LK-VVTF
A0A1Q7WJN6      AYA--H----------------------------------------GTG----PL-LVSI
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ETL--RK---------------------------------------GAN----LQ-VVAV
A0A2W6VLC6      -----------------------------------------------------PT-TFVI
A0A519G798      QFL--DL---------------------------------------DSR----PR-ALVI
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ----------------------------------------------DNP----PR-ILLV
                                                                            

A0A348NU28      TSVSPGEGKSMFASNLGLTLA-GLR-NNVLIIDADLRRPRVADYF---G-----------
A0A2N4T4Q5      TSSMPGEGKSSITANLAVAIA-STG-RDVVVVDGDLRRPVMTELF---G-----------
A0A1M3LEY6      TSSVPSEGKSTTSANLAIVMA-QSG-ARVLLIDGDLRSPSVADLF---G-----------
A0A538AJI7      SSPAPADGKTTVTTLLGEALS-RLG-MRVLLIDGDLRRPGFARIM---R-----------
A0A538AM15      SSPGVGDGKTTTAINLAGALA-QASEARVLLVDADLRRPSVARLL---A-----------
A0A022KX11      TSAVPGEGKTTTAVNLALAMA-DSG-RRTLLVDADLRNPSVAKTL---G-----------
A0A255G8R8      TSSVPGEGKSVTVANLALAMA-DAG-NRTLLIDADMRRPTVADNF---G-----------
A0A4Y5YMQ6      TSSIAGEGKTTMSVNTALAFA-EMG-NRVLLVDADLRRPNVANVL---G-----------
A0A4Q5A868      TSTGASEGKTTTSVNIAAALA-ENG-AKVLLIDADLRHPSVANKL---D-----------
A0A0W8I9Y2      TSALPGEGKSSITANLAVAIA-STG-RNVVVVDGDLRRPVITDLF---G-----------
A0A345NSU7      SSTLPGEGKTTTAVNLALAMS-DAG-TKVLLIDADLRHPSVGTTL---G-----------
A0A4Q5APW3      TSIGASEGKTTTSVNIAAALA-ENG-AKVLLIDADLRHPSVANKL---D-----------
A0A4Q5B0V3      TSIGASEGKTTTSVNIAAALA-ENG-AKVLLIDADLRHPSVANKL---D-----------
A0A222TG79      TSALEGEGKTTTAVNLAVCLS-EVG-YKVVVVDADLRRPMVAVRL---G-----------
A0A1Q2CRV2      TSSVPGEGKTSTAINLAATLA-AAG-EKVLLIDADLRRPRVAAQL---Q-----------
A0A2S5WZJ5      TSSNAGEGKSTIATSLAQVLA-QSN-TPTILIDADLRRPTVATVL---G-----------
K6WHS4          TSPSPGDGKTTVALNLAASLA-EAG-HSVLLVDADLRNPSVAGRV---N-----------
A0A1L2ZMQ6      TSSVPGEGKSSLSANLAVTIA-HTG-QKVIVVDGDLRRPVVSEMF---S-----------
A0A3L7ADK2      TSPNPGEGKSTLSANLAETLAVNSG-KNVVVIDCDLRRPTLSKIF---N-----------
A0A0G3V3M7      TSPGPAEGKSISVVNIAAAFA-ETG-ISVLLIDGDFRRPQMYKYF---S-----------
A0A3E2DN22      TSANPGEGKSTVSTHLAVVMA-QAG-EKVVLIDADMRRPVQHKAF---G-----------
A0A3Q9ULZ9      TSANPGEGKSTVGSYLARAVA-RSG-QATVLVDADMRRPMQHTAF---G-----------
A0A3S9JFL2      TSANPGEGKSTVCSYLARSVA-RSG-QATVLVDADMRRPMQHTAF---S-----------
A0A1Q2CI19      SSAHVAEGKSTSTANLAASFA-ETG-KQVLVIDADLRSPDVHEKL---D-----------
A0A512T3M3      TSANPGDGKTTSVGNLAASFA-ESG-KSVLVLDADLRSPDTHNVF---D-----------
W6JTW4          TSAQPSEGKTTSVANLAASFA-ESG-RRVLVLDADLRSPDAHNLF---D-----------
A0A0A0JTY0      TSAHAAEGKTTSVANLAASFA-ETG-QRVLVLDADLRSPDVHNVF---D-----------
A0A0A0JXF2      TSAHAAEGKTTSVANLAASFA-ETG-QKVLVVDADLRSPDVHNVF---D-----------
E6S8H2          TSAHPREGKTTSVANLAASFA-ETG-QRILVLDGDLRSPDTHNIF---D-----------
A0A0A0JGH0      TSGNAAEGKTTTVANLAASFA-ETG-QRVLVLDADLRSPNTHTLF---D-----------
N0E4U7          TSANAAEGKTTTVANLAASFA-ETG-QRVLVLDADLRSPDTHSLF---D-----------
A0A0A0IYK2      TSAHAAEGKTTSVANLAASFA-ETG-QRVLVLDADLRSPDAHNVF---D-----------
A0A0Q9L0H3      TSAHAAEGKTTSVANLAASFA-ETG-QTVLVLDADLRSPDIHTAF---D-----------
A3TMK0          TSAHASEGKTTSVANLAASFA-ETG-QQVLVLDADLRSPDAHNAF---D-----------
A0A543PXP1      TSAYPGEGKTTSVANLAASFA-ETG-LRVLVLDADLRSPDTHDLF---D-----------
A3TMH6          TSAHPAEGKTTTVANLAVSFA-ESG-QRVLVLDADLRSPDTHTLF---D-----------
A0A5R8VLL6      TSSVSGEGKSTIAANLASAMA-AAG-DPVIVVDGDLRHPSVAKIF---D-----------
A0A1H6WL79      TSSLPSEGKSTVTSNLAATIA-AAG-RDVIVVDADLRRPTVHQVF---D-----------
A0A101LAM5      TSSLPSEGKSTVTSNLAATIA-AAG-RDVIVVDADLRRPTVHQVF---G-----------
A0A4Y3NEG0      TSSLPSEGKSTVTSNLAATIA-AAG-RDVIVVDADLRRPTVHQVF---G-----------
A0A1H6YPK1      TSPVPGDGKSTMAVMLAAAIA-ESG-RDVVLVDADLRRPTLAKAL---G-----------
A0A2R7MGI0      TSPLPGDGKSTTAANLAVSIA-ATG-QSVILIDADLRRPVMGGVF---G-----------
A0A2T7WQY4      TSPLPGDGKSTTAANLAVSIA-ATG-QSVILIDADLRRPVMGGVF---G-----------
A0A1G6GTN3      TSPLSGDGKSTTAANLAVSIA-ATG-QSVVLIDADLRRPVLGGMF---G-----------
A0A1N7DLV3      TSPLPGDGKSTTAANLAVSIA-ATG-QSVILIDADLRRPVLGATF---G-----------
A0A1V2NSB5      TSPLPGDGKSTTAANLAVSIA-ATG-QSVILIDADLRRPVLGATF---G-----------
A0A0Q5Q5L3      TSPLPGDGKSTTAANLAVSIA-ATG-QSVILVDADLRRPVLGGMF---G-----------
A0A0Q6DVM4      TSPLPGDGKSTTAANLAVSIA-ATG-QSVILVDADLRRPVLGGMF---G-----------
A0A1R3WWR6      TSPLPGDGKSTTAANLAVSIA-ATG-QAVVLIDADLRRPVLGGVF---G-----------
A0A5Q2FA83      SSVMPGEGKTTTAVNLAIALA-DSG-ANVVLVDGDLRNPSVAKAM---G-----------
A0A542FTE6      VSASPGEGKSTVAANLADAVA-ASG-RPVIVVDCDLRKPMIATIY---E-----------
A0A2S5UYV0      TSSNAGEGKSTIATSLAQVLA-QSN-TPTILIDADLRRPTVASVL---G-----------
A0A2S5X9U6      TSANAGEGKSTVSTSLAQVLA-QSN-TPTILIDADLRRPTVATVL---G-----------
A0A2S5ULV5      TSANAGEGKSTVATSLAQVLA-QSN-TPTILIDADLRRPTVATVL---G-----------
A0A653YMF0      TSANAGEGKSTVATSLAQVLA-QSN-TPTILIDADLRRPTVATVL---G-----------
A0A4V1VGV9      TSAMQSEGKSTVAANLARVLS-AAG-QSVVLVDTDLRRPTVHETF---D-----------
A0A3Q9IY80      TSPLPGDGKSTTSANLAITLA-ANG-SKVVLIDGDLRRPMVATIF---R-----------
A0A0F0LP73      TSANLGEGKSSTTRTLARVLA-ESG-QRTLVIDGDLRRPTVAEGF---D-----------
A0A1F1X071      TSSAPGEGKSTVAANLARVMA-RAG-QPTLLVDADLRRPMIAQQF---S-----------
A0A3R8RWC7      TSSAPGEGKSTVAANLARVMA-RAG-QPTLLVDADLRRPMIAQQF---S-----------
A0A4U0RJZ4      TSAVQSEGKSTVASNLARVLA-AAG-QHVVLVDTDLRRPVIHETF---D-----------
A0A4R1FGL9      TSAVQSEGKSTVASNLARVLA-AAG-QHVVLVDTDLRRPVIHETF---D-----------
E3B8H1          TSAVQSEGKSTVASNLARVLA-AAG-QHVVLVDTDLRRPVIHETF---D-----------
A0A0Q5AWK6      TSANQAEGKSTIASGLARVTA-DSG-QRTLLIDADLRRPTVAKML---G-----------
A0A3N1NLD3      TSANQAEGKSTIASGLARVTA-DSG-QRTLLIDADLRRPTVAKLL---G-----------
A0A3N2FVI8      TSANQAEGKSTIASGLARVMA-DSG-QRTLLIDADLRRPTVAKLL---G-----------
A0A2S5XDQ6      TSANQAEGKSTIAAGLARVTA-ESG-QRTLLVDADLRRPSVARML---D-----------
A0A2S5XNN6      TSANQAEGKSTIAAGLARVTA-ESG-QRTLLVDADLRRPSVARML---D-----------
A0A538JQF8      CSPRPREGKTMTVANLAVCLA-ESG-HTVLVLDSDLRAPQAHRLF---G-----------
A0A0Q5JKD6      TSPLPGDGKSTIAANLAVSIA-ATG-QSVVLIDADMRRPVVGGMF---G-----------
A0A0Q9TBP0      TSGQESEGKTVTSCNLAVSAA-RLG-LNVVLIDADFRRASVAPRF---G-----------
A0A346XTB0      TSTLPGDGKTTTTLQLAIAAS-RDR-RRVVLVDADIRARGLTRVL---G-----------
A0A2W6DK08      ASACAAEGKTATVVNLAACFA-EVG-KRVLVLDCDFRGPDAHQYL---G-----------
A0A2S0LQ32      TSANPGEGKSTISAVLAQMLA-ASG-QRTILVDTDLRKPVVHRIF---D-----------
A0A2N6V1R5      TSANPGEGKSTMSAVLAQMLA-SSG-QRTVLIDTDLRKPVVHKIF---G-----------
G9PHS6          TSANPGEGKSTMSAVLAQMLA-SSG-QRTVLIDTDLRKPVVHKIF---G-----------
U1PLM7          TSANPGEGKSTMSAVLAQMLA-SSG-QRTVLIDTDLRKPVVHKIF---G-----------
A0A351ETF8      TSAVPGDGKTTTAVNVAALAS--KY-MNVLLVDGDMRRPRVHRML---G-----------
A0A349B7N2      TSPGPAEGKSTTVVNLAAAYA-ESG-SRVLIVDGDFRRPAVHEFLPEAD-----------
A0A346Y185      TSASPVDGKTVTCLNLAVASA-QDG-RDVVLVDADTRVRGLTRRL---G-----------
A0A259S8H9      TSANLGEGKSETTRALARVLA-ESG-QRTLVIDGDLRRPTIAKGF---E-----------
A0A0Q5L115      TSPQPGDGKSTLAANLAESLAVSSD-QRVVVIDCDLRRPTLSKVL---G-----------
A0A2W1Z497      TSPLPGDGKSTIAANLARSLAVTST-GRVVLIDCDLRRPVLSAVF---G-----------
A0A3L8NYD3      TSANAGEGKSVVTANLARVLA-AAG-QKTILLDGDLRRPMVSTIF---E-----------
A0A1M6K628      TSPSQGEGKSTIAMQLAALLA-ESG-EPTVLIDADLRRPRVAQLF---G-----------
A0A561E8R3      TSPNPGEGKSTVAANLARVLA-AAG-QPVVLIDADLRKPMVATIF---N-----------
A0A1H4I042      TSSIPNEGKSTTAVNIALALV-EVE-NNVLLVDGDMRRSIAHKHL---N-----------
A0A4R7A6D9      TSSIPNEGKSTTAVNIALALV-EVD-NNVLLVDGDMRRSIAHKHL---N-----------
A0A4Q4D4T1      TSSVAGEGKTTTASNLAISLA-QSG-QNVVLVDGDLRRPRLHEVF---G-----------
A0A261FE22      TSAMLGEGKTTVSVNIAATFV-EKG-ESVLLIDADVRHPSVAKAL---G-----------
A0A5C8C085      TSSKPGDGKSTVTANLAAAIA-ASG-APVILVDGDLRRPTVASSF---G-----------
A0A1E4BP96      TSPLPGDGKSTTAANLAMSLA-AAG-QRVVLIDGDLRQPVVASLF---D-----------
A0A101KZQ4      TSALPGEGKSTVAANLAITIA-ASD-QKVVLIDGDLRRPTIAKTF---G-----------
A0A439DNZ6      TSSMPGEGKSTTAINLALVLA-EAE-HNVVLVDGDLRRPRLDKYL---G-----------
A0A0J6YE86      TSSMPHEGKSTTAINIALALA-EAE-HNVVLVDGDMRRPTLSKYL---D-----------
A0A5Q5BFU2      TSSVPHEGKSTTAINIALALA-EAE-HNVVLVDGDMRRPMLHKYL---G-----------
A0A151BT98      TSARPGDGKTTVAANLALAMA-RDG-YRTVLVDGDLRKPGVGSAI---G-----------
A0A2Y8ZRF8      TSARPGDGKTTVAANLALAMS-RDG-HRTLLVDGDLRKPGVASAV---G-----------
A0A2R9UAT1      TSPLPGDGKSTMSANLALAMA-ASG-QQVVLIDGDLRRPMIAAIF---G-----------
A0A4Q5J5D7      TSPQQGDGKSTVAANLAGALA-VSG-EPVILIDGDLRRPTVAEKF---G-----------
A0A1Y4CKD6      TSSIAGEGKSTVAINLAEQLA-QDG-SRVLLVDMDLRSQGDGALL---G-----------
A0A0Q7KBQ4      SSAVPNEGKTLVATNLAMSMA-QSG-RSVLLIDADMRNPNVADLL---G-----------
A0A1F1IHY9      TSAHPGEGKSTVAANLAVPVA-ESG-QRVVLVDGDLRRPVVAENF---G-----------
A0A542HCT5      TSPLPGDGKSTVAMNLAAALS-MSD-RRVILIDGDLRRPVIADSF---G-----------
A0A2S8WHZ8      SSSVPGEGKSSVTANLAVAIA-STG-RNVVLIDADLRRPVQTELF---D-----------
A0A537WNY9      TSPEGSHGKTTISYGLAVTLA-RAG-TSTLLVDGDLRRGRISEMM---N-----------
A0A5B8M469      TSPNQSEGKSTVAARLAAVIA-ESG-QPTLIIDADLRRPSVARQF---D-----------
A0A1Y4CTD2      ASVEENEGKSTVAANLAAALA-ERG-RRVLLIDGDFRKPAQRRIF---DEQNLERPSFSD
A0A0Q5M6Z7      TSSIPGEGKSTLTANLADAIA-SAN-SNVVVIDCDLRRPMQSTLF---S-----------
A0A3N3ZPU0      TSSVAGEGKSSVAANLAVTLG-ALG-QPTVLVDADLRRPVQTELF---G-----------
A0A359IQX7      TSANASEGKSTVAANLARVLA-ESG-QITLLVDADLRRPSQHRTF---D-----------
A0A4R8TXC3      TSAVPSEGKSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N-----------
A0A433EDP2      TSAVPSEGKSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N-----------
A0A231VTW0      TSAVPSEGKSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N-----------
A0A433ECD0      TSAVPSEGKSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N-----------
U7V3Z1          TSAVPSEGKSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N-----------
A0A1F1J417      TSAVPGEGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H-----------
A0A2A8D6P2      TSAVPGEGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H-----------
A0A1F0THV9      TSAVPGEGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H-----------
A0A5F0M6Y0      TSAVPGEGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H-----------
D8USQ4          TSAVPGEGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H-----------
E3H5W1          TSAVPGEGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H-----------
A0A1F1QKB0      TSAVPGEGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H-----------
A0A509JY23      TSAVPGEGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H-----------
A0A448USF4      TSAVPGEGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H-----------
A0A0Q9LZR0      TSPLPGDGKSTVAMNLAAALS-MSD-RRVVLIDGDLRRPVVAESF---G-----------
A0A1N7E3F1      TSCLPGEGKSSTSVNLAITMA-QAG-WRVVLVDADLRRPSVPRYL---G-----------
A0A544ZKQ1      TSCLPGEGKSSTSANLAITMA-QAG-WRVVLVDADLRRPSVPRYL---G-----------
A0A372P1T1      TSCLPGEGKSSTSANLAITMA-QAG-WRVVLVDADLRRPSVPRYL---G-----------
A0A5D0Q2X0      TSCLPGEGKSSTSANLAITMA-QAG-WRVVLVDADLRRPSVPRYL---G-----------
A0A5R8Z2E7      TSCLPGEGKSSTSANLAITMA-QAG-WRVVLVDADLRRPSVPRYL---G-----------
A0A1L2ZMV4      TSALAGEGKSSIAANLAVTIA-QSG-SKVILIDADLRRSVQTDIF---Q-----------
A0A1S1CAD0      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
G5ET14          TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1E9DXX2      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1E8S156      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1E8S5S2      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1S1DFA8      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A2I1Z490      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1F0DAA9      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1F0PHK9      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1F0VZG6      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1E9G8X4      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1E9IAW2      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1E9ZBC9      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1E9ZDP4      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1F0R6B5      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1F0Z7N5      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1F1D897      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
D2NP38          TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1F1FV74      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1E9M791      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A291DEI8      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1S1D5T1      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1E8TRD6      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1F0XT88      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1F1EVP5      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
C6R548          TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A0K2RXS2      TSAVPGEGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A1F0KX60      TSAVPGEGKSTVSLALARAMA-DAG-SPVILIDADLRRPTVAKKL---K-----------
A0A542I3V2      TSPMTSDGKSTVTGNLAVTMA-ATG-EPVVVVDGDLRRPRIAGAF---N-----------
A0A2T0UZ65      TSASPSEGKSTVSSTLASIIA-EDG-RPVVIIDADLRRPNIANIL---E-----------
A0A1R4JTI6      TSAAPAEGKSTVAANAAITLA-QSD-VPTVLVDADLRRPTVAGSF---H-----------
A0A4R7TM52      TSPLPGDGKSTTSANLAIILA-ASG-QRVVLVDGDLRRPMVASVF---G-----------
A0A542XE74      TSPAPGDGKSTIAAQLARLMA-VAG-QPVVLIDCDLRRPTQGDQF---N-----------
A0A0G3V3F3      VSNTQDAGKSFISINLAQSAS-ALD-DKVVLIDADLRRPTIHEQL---S-----------
A0A0Q7QDF6      TSSVAGEGKTTTASNLAISLA-QSG-QNVVLVDGDLRRPRLHEVF---G-----------
A0A3S0V9U6      TSPNPGEGKSTVTSSLAHAFA-KAG-QPTVLIDADLRRPTIAKIF---G-----------
A0A2R7Z032      TSALASEGKSTVSSNLARLVA-QAG-EKVVLIDADLRRPMLATTF---D-----------
A0A1I0W453      TSALAGEGKSTVSSNIARLVA-QAG-TPVLLIDADLRRPMIATTF---E-----------
A0A1H4LCS9      TSALAGEGKSTVSSNIGRLVA-QAG-TPVLLIDADLRRPQIASTF---E-----------
A0A4Q2RZP8      TSALAGEGKSTVSSNIARLVA-QAG-TPVLLIDADLRRPMIASTF---E-----------
A0A0Q6VV12      TSALAGEGKSTVSANIARLVA-QAG-TPVLLIDADLRRPQIATTF---E-----------
A0A495NTA9      TSALAGEGKSTVSSNIARLVA-QAG-TPVLLIDADLRRPMIASTF---E-----------
A0A0Q9QB08      TSALAGEGKSTVSSNVARLVA-QAG-TPVLLIDADLRRPMIATTF---E-----------
A0A4Q2SA86      TSALAGEGKSTVSANIARLVA-HAG-TPVLLIDADLRRPMLATTF---D-----------
A0A4Z1C3Z0      TSALAGEGKSTVSANIARLVA-QAG-TPVLLIDADLRRPMLATTF---E-----------
A0A5R8L819      TSPLPGDGKSTTSANLAVTLA-ASG-QPVVLVDADLRRPMLANIF---G-----------
A0A261FQA1      ASSDASEGKTTIAVNLAAAIA-ERG-RTVLLIDTDLRKPSMAGVL---G-----------
A0A1Q2CJ92      TSSNEGEGKSTLAANIAAMFA-DAG-EPTVLIDADLRRPVQAERL---G-----------
A0A2T0S3C8      TSAMPGEGKSSTACTLAGLFA-EAG-QRVLLIDADLRRPRIADYL---G-----------
A0A4Y8WZJ3      TSAHPGEGKSTVAANLAVTVA-ESG-QRVVLVDGDLRRPVVAENF---G-----------
A0A285VUW0      TSSLSAEGKTTTVVNLGMAMA-ESG-RRVLVLDADLRHPSVASEL---G-----------
A0A4Q2JUT1      TSPLPGDGKSTIACNLALTLA-AAG-STVVLVDGDLRRSMVAKTM---G-----------
A0A542J310      TSPLPGDGKSTVACNLALTLA-AAG-TTVVLVDGDLRRSMVAKTM---G-----------
A0A444BL03      TSANAHEGKSTVSSTLARVLG-EAG-QRVVIVDADLRRPTLAKVF---E-----------
A0A4Y8X357      TSSNPGEGKSTVIGSLAQAVA-ASG-QPVILIDADLRRPRQAGQF---G-----------
R4LD52          TSAVPGEGKSSTACGIAMLFA-QAG-QRVLIVDADLRRPRIAEYL---G-----------
A0A4T2CD79      SSPSPNDGKSTVTANLAVALS-AAG-QKVVVVDGDLRKPMVASTF---N-----------
A0A4Q4D742      SSALPNEGKTLTATNLAISMA-QSG-RSVLLIDADMRNPNVAELL---G-----------
A0A4Q2RU39      TSALPGEGKSTVSANIARLVA-QAG-TKVLLIDADLRRPMIATTF---E-----------
A0A4Q2SK58      TSALPGEGKSTVSANIARLVA-QAG-TPVLLIDADLRRPMIATTF---E-----------
A0A2N3YJR1      TSANAGEGKSTVSATLARVLG-QSG-QSVVIVDADLRRPTLAKVF---D-----------
A0A1C6T1J1      TSALQGEGKTTMSCNLAIALA-EAG-WRVLLVDADLRRPKVADYL---G-----------
A0A2W2CFC8      TSALQGEGKTTLSCNLAITLA-EAG-WRVLLVDADLRRSKVGDYL---G-----------
A0A2W2A4B0      TSSRPSEGKTTTAANLAVALA-ESG-LRTVVIDADLRRPNLANVF---G-----------
A0A4Y9MDA5      TSSRPGEGKSTVAVDLAAALA-ETG-ARVLLVDADLRRPAIAERL---G-----------
A0A1H7N9P7      TSSRSGEGKSTVAVELAAALA-ETG-TRVLLVDADLRRPTIADRL---G-----------
A0A1M7V0F8      TSSRPGEGKSTVAVNLAAALA-ETG-ARVLLVDADLRRPAIADRL---G-----------
A0A1V8PLV6      SSVEPSEGKTTVSVNVAAALA-ENG-AKVLLIDADLRHPSVADHI---G-----------
A0A4R0U4F1      TSAGPSEGKTTLSVNLATAFA-ENG-SKVLLIDADVRNPSVSKAL---G-----------
A0A357ZCV8      TSSVPNEGKSTIALSLAQAIA-TSG-QTVLVVDTDMRRRSLAHYM---R-----------
A0A419GS64      TSPDRGEGKSTICANLAIVMA-QAE-KRVLLIDCDLRLPTQHELF---Q-----------
A0A538BYZ4      SSPASGDGKTTTAINLAGALA-QAPEARVLLVDLDLRRGSVREHL---G-----------
A0A4R1CW45      TSASPAAGKSFLAVNLAASLS-RVLKVPTFLVDLDLRRGCVAEEL---G-----------
A0A4R5Z7B0      TSSGPGEGKSTTAANLAVVFA-QLG-KKVLLVDADLRKPTVHRSF---G-----------
A0A2V2CXY5      TSSLPNEGKSFLVMQLWRMMA-EVG-TPTLLIDCDYRNSEMRTKY---G-----------
A0A2S8MDM2      TSSVPSEGKSTTAINLALALA-EAD-HKVLLVDGDMRRPSLHQYL---D-----------
A0A357ZDL3      TSSVPNEGKSTIALNLAQAIA-GSG-KTVLLVDTDLRRRSLAMYL---N-----------
A0A4Y8ZIU8      TSANPGEGKSTVIGSLAVAVA-ASG-QPVILIDADLRRPRQALQF---G-----------
A0A0F0KYJ9      TSPLPGDGKSTISSNLAVTLA-SSG-QPVVLIDGDLRRPMIGTVF---G-----------
A0A510HHA8      TSPGPTEGKSTVCANLGVVLA-QAN-KSTLLIDGDLRRPSLHAIF---S-----------
A0A538BBM6      TSPNAGEGKTSTCVPLAQSLA-QAG-SRVVLVDLDLRHPDAHRLL---D-----------
A0A1I6GVG4      TSPLPGDGKSTISSNLAVTLA-SSG-QPVVLIDGDLRRPMVDTVF---G-----------
A0A1I6IST1      TSPLPGDGKSTISSNLAVTLA-SSG-QPVVLIDGDLRRPMVDTVF---G-----------
A0A412JBM5      TSGSPSEGKSLTAANTAISFA-MLG-KKTLLVDADVRKPSQQRLW---A-----------
A0A1C2B334      TSASVAEGKTTTAINVAASLA-EYG-HRVVLVDADLRRPTVAKRL---------------
R7Y679          SSPSQSEGKTTTSLNLAASLA-ELG-KSVVLVDADLRRPAVASRL---Q-----------
A0A5Q2F9A3      TSSVPDEGKTSTAINTALVLA-DAG-LRVLLIDADMRRPRVGQSL---R-----------
A0A0K8Q3D9      TSSMQAEGKSTVTANLAVTMA-AAG-ENVVVVDGDLRRPTLTDVF---N-----------
A0A2R7RCA1      TSSVQAEGKSTVTANLAVTLA-AAG-ENVVVVDGDLRRPTLVDVF---N-----------
A0A023X491      TSPGQQEGKSTTCANLAVTLA-QAE-KSVLLLDCDLRKPVVHSIF---E-----------
A0A4R1BMZ2      TSPGPGEGKSTTCANLGVVLA-QAN-KNTLILDCDFRRPVMHRFF---G-----------
A0A1Q7WJN6      TSPGRSDGKSFVASNLALAFA-SVG-YRTLLIDGDVRRGGLHRIL---T-----------
A0A1E2SNF6      ---MPSEGKSTLSANLAVTIA-RGG-QPVVVVDADMRHPTQGKTF---G-----------
Q6ADE8          ---MPSEGKSTLSANLAVTIA-RGG-QPVVVVDADMRHPTQGKTF---G-----------
A0A1Q7CZ24      TSPGVGDGKTTTAINLAGSLA-QAADARVLLVDMDLRRPAVAGQL---G-----------
A0A2W6VLC6      TSSVPGEGKTSSGINIARALA-DVG-THTLLVDADLRRPKTDVYL---G-----------
A0A519G798      TSAVPSEGKTSTATNLAIALA-QTG-LRVLLVDGDLRRPKVASVL---G-----------
A0A519GXS6      -----GEGKTTTAVNLALAYV-ESG-QRVVLVDADLRRPAVANLL---G-----------
A0A520EHH5      TSCIAGEGKSTTAVNLALSLA-ESG-NRVVLVDADLRRPHIADYL---G-----------
                       **:                   .::* * *                       

A0A348NU28      ---L--EGSV-G---LTTVLL----GD-V---SIEDARMTRP---GST-LDV--LPSGSI
A0A2N4T4Q5      ---L--VPGV-G---ITDVLV----GE-A---EVDDVLQVYD---KFPNLQV--LGAGRT
A0A1M3LEY6      ---I--EGGV-G---LTDVLI----GR-A---RLSDVTQAWG---LRN-LSL--LPAGAM
A0A538AJI7      ---V--NPHP-G---LAEVLR----GE-T---PIMEAAQKGW---AEN-VWI--LPTAHD
A0A538AM15      ---I--GGSD-GPGLVNAILD----PR-L---PLERVARPLP---PFN-LSV--IPAGQA
A0A022KX11      ---M--EGSV-G---LTTLLL----GD-A---DLDDVIQTWG---S-AGMDV--LPAGPI
A0A255G8R8      ---L--VGTA-G---LSTILA----GQ-A---TLSDLVQPFS---GHPDLYV--LTSGVV
A0A4Y5YMQ6      ---L--ENAV-G---LASVLV----DA-V---TFDDAVISTA---G---VDV--LTAGEH
A0A4Q5A868      ---I--DGSA-G---LTHVLS----GQ-A---SVKDVVQRYW---K-PNLHV--MPAGPK
A0A0W8I9Y2      ---L--VPGV-G---VTDVLT----GQ-V---QVDEVLQTYD---KFPNLQV--LGAGRT
A0A345NSU7      ---L--EGGV-G---LTTVLL----GD-A---DVHDVVQPWG---G-NNLHV--LTAGEV
A0A4Q5APW3      ---I--DGSA-G---LTHVLS----GQ-A---SVKDVVQRYW---KPN-LHV--MPAGPK
A0A4Q5B0V3      ---I--DGSA-G---LTHVLS----GQ-A---SVKDVVQRYW---KPN-LHV--MPAGPK
A0A222TG79      ---V--NPDI-G---FTDFLS----GR-A---ALEDVLQSTS---FSG-VDA--LAGGQI
A0A1Q2CRV2      ---L--EGAV-G---LTTVLI----GD-A---RLGDVVQPYG---RTP-LDV--LTAGRV
A0A2S5WZJ5      ---I--DGKI-G---LSEVLS----GQ-V---SLEDALVASK---IPG-LYV--LPSGRI
K6WHS4          ---L--TGSV-G---LTTILS----TG-A---TLTDCIQHSS---VAG-LDV--LPSGPI
A0A1L2ZMQ6      ---L--PGDA-G---LTDVLA----GQ-A---ELDDVLQDFE---PVPNLQV--LAAGRI
A0A3L7ADK2      ---A--VEGA-G---LTDVLS----GR-A---ELQQVIQPCG---DSEKLWI--LGAGRI
A0A0G3V3M7      ---G--ATTP-N---LTDIPH----QG-----TAADVLAVAQ---ETGIPNIRFIASAPT
A0A3E2DN22      ---A--EAGV-G---LSQVLA----GD-V---TLDDALMRTE---TKR-LQM--LAAGRI
A0A3Q9ULZ9      ---I--DSRV-G---LSQVLA----GD-V---SLSDALTPTD---VPG-LRV--LVAGRI
A0A3S9JFL2      ---I--DSHV-G---LSQVLA----GD-V---SLEDALNPTD---VPG-MRV--LVAGRI
A0A1Q2CI19      ---V--PQGA-G---VSDLLV----DG-QG--SLNSVIRPTN---IPG-VRV--VTAGTR
A0A512T3M3      ---V--PQGA-G---ISDYLT----DP-DFG-PLSNLVRPTN---LPG-VKI--ITAGTQ
W6JTW4          ---V--PQGA-G---ISDYLV----DS-ALE-HLQQLVRPTN---MPG-VSI--IVAGTQ
A0A0A0JTY0      ---V--PQGA-G---ISDYLS----DV-SGDASLASLMRPTS---VPG-VRI--MSAGSS
A0A0A0JXF2      ---V--PQGA-G---ISDYLS----D--PGGTSLETVVRPTS---VPG-VRI--ITAGTV
E6S8H2          ---V--PQGA-G---ISDYLT----GP-DDT-PLGSLIRPTN---VPG-VRI--ITAGTR
A0A0A0JGH0      ---V--PQGA-G---ISDYIS----DN-EDT-PLEALIRPTN---VPA-VRI--ITAGTR
N0E4U7          ---V--PQGA-G---ISDFIT----DP-GDV-PLEALVRPTS---VPG-VRI--ITAGTR
A0A0A0IYK2      ---V--PQGA-G---ISDFLS----DP-SDDASLGSVVRPTS---VPG-VRI--ITAGTS
A0A0Q9L0H3      ---V--PQGA-G---ISDYLS----DP-SDGAALDAVVRPTS---VPN-VRI--ITAGTS
A3TMK0          ---V--PQGA-G---ISDYLT----DP-GEG-SLSAVVRPTS---VPG-VRI--ITAGTS
A0A543PXP1      ---V--PQGA-G---LSDYLS----RP-EDA-SLEALIRPTS---IPD-VRI--ITAGTR
A3TMH6          ---V--PQGA-G---ISDYLS----RH-NES-SLEALIRPTS---IDG-VRI--MTAGTR
A0A5R8VLL6      ---V--VPGI-G---ITDVLT----GK-A---EVDDVLQQRG---DLPNLSI--LGAGRT
A0A1H6WL79      ---V--LPDV-G---VTDILS----GR-A---SIDDVLQEWG---PNPRLRI--LTAGRI
A0A101LAM5      ---V--LPDV-G---VTDVLS----GR-A---SIDDVLQEWG---PNPHLRI--LTAGRI
A0A4Y3NEG0      ---V--LPDV-G---VTDILS----AR-A---SIDEVLQEWG---PNPHLRI--LTAGRI
A0A1H6YPK1      ---V--SPEA-G---LTSVLA----SQ-A---SIEEVTQQVG---DSGRFSV--VTAGVI
A0A2R7MGI0      ---F--SDDV-G---LSDVLA----AR-A---QIEQVAHQVD---EEGRLFV--VAAGRT
A0A2T7WQY4      ---F--SDDV-G---LSDVLA----SR-A---QIEQVAHQVD---DHGRLFV--VAAGRT
A0A1G6GTN3      ---F--SDDV-G---LSDVLA----GR-A---QIEQVARQVD---QNGRLFV--VAAGRT
A0A1N7DLV3      ---F--SDDV-G---LSDVLA----GR-A---RIEQVAHQVD---ENGRLFV--VAAGRT
A0A1V2NSB5      ---F--SDDV-G---LSDVLA----GR-A---RIEQVAHQVD---EHGRLFV--VAAGRT
A0A0Q5Q5L3      ---F--SDDV-G---LSDVLA----GR-A---QIEQVAHQVD---EHGRLFV--VAAGRT
A0A0Q6DVM4      ---F--SDDV-G---LSDVLA----GR-A---QIEQVAHQVD---EHGRLFV--VAAGRT
A0A1R3WWR6      ---F--SDDV-G---LSDVLA----GR-A---QIEQVAHQVD---ENGRLFV--VAAGRT
A0A5Q2FA83      ---L--EGNV-G---LTTVLL----GR-A---TVAEAAQKWG---DSS-LHV--LPSGAI
A0A542FTE6      ---K--EGAV-G---LTDVLA----GR-A---TPADVAQRVP---GNLDLTV--FTSGPT
A0A2S5UYV0      ---I--DGSV-G---LSEVLS----GQ-V---SLEDALTATK---TPG-LYA--LPSGRI
A0A2S5X9U6      ---I--DGKI-G---LSEVLS----GQ-V---SLEDALVGSK---IPG-LYV--LPSGRI
A0A2S5ULV5      ---I--DGKI-G---LSEVLS----GQ-V---SLEDALVGSK---IPG-LYV--LPSGRI
A0A653YMF0      ---I--DGKI-G---LSEVLS----GQ-V---SLEDALVGSK---IPG-LYV--LPSGRI
A0A4V1VGV9      ---L--ENLV-G---LTEVLT----GQ-A---PLASAIQQGD---HKN-LAV--ITSGRV
A0A3Q9IY80      ---L--VDGV-G---VTDVLA----GR-A---TVEDVAQRVG---RKGNLLV--LGAGKL
A0A0F0LP73      ---L--DGTV-G---LSEVLS----GQ-M---PIGPAIRQTS---DPN-LFV--LPAGGI
A0A1F1X071      ---V--DGEV-G---LSQLLA----AS-V---SLEDVAEPTT---VPL-LTL--LPAGQI
A0A3R8RWC7      ---V--DGEV-G---LSQLLA----AS-V---SLEDVAEPTT---VPL-LTL--LPAGQI
A0A4U0RJZ4      ---V--DNAV-G---LTEVLT----GQ-A---SLRQAIQPGD---HKN-LSI--ITSGRI
A0A4R1FGL9      ---V--DNAV-G---LTEVLT----GQ-A---SLRQAIQPGD---HKN-LSI--ITSGRI
E3B8H1          ---V--DNAV-G---LTEVLT----GQ-A---SLRQAIQPGD---HKN-LSI--ITSGRI
A0A0Q5AWK6      ---I--DGAV-G---LSEVLS----HQ-I---PVEDAIRPTG---TEG-LFA--LPSGHI
A0A3N1NLD3      ---I--DGAV-G---LSEVLS----HQ-I---PVEDAIRPTA---TEG-LFA--LPAGHI
A0A3N2FVI8      ---I--DGAV-G---LSEVLS----HQ-I---PVEDAIRPTA---TEG-LFA--LPAGHI
A0A2S5XDQ6      ---I--DGAI-G---LSEVLS----HQ-I---PVDDAIRPTG---TAG-LYA--LPAGHI
A0A2S5XNN6      ---I--DGAI-G---LSEVLS----HQ-I---PVDDAIRPTG---TAG-LYA--LPAGHI
A0A538JQF8      ---V--QVEP-G---LSDVLS----GS-P---DAPSLADVAQ---DTKVPGVQVIAAGSR
A0A0Q5JKD6      ---F--SDDV-G---LSDVLA----GR-A---QIEQVAHQVD---EHGRLFV--VAAGRT
A0A0Q9TBP0      ---L--GDPP-G---LSDLLV----SE-E---DPSSYLIDIG---VDNLTL---LPAGTL
A0A346XTB0      ---A--DDRV-G---LSDLAA----MD-M---EPNEVLRRYK---FSEQSQIPVVTAGQR
A0A2W6DK08      ---V--SPGT-G---LSNLLR----ST-T---TV-DLSLHVR---QSDIPRVDVVTAGTQ
A0A2S0LQ32      ---I--DGSV-G---LTQVLA----GD-V---PVSDVAQFVK---GHPHLRV--IPAGRI
A0A2N6V1R5      ---L--DGSV-G---LTQILA----GD-M---QLSDVAQKIE---GQPNLRV--VPAGRI
G9PHS6          ---L--DGSV-G---LTQILA----GD-M---QLSDVAQKIE---GQPNLRV--VPAGRI
U1PLM7          ---L--DGSV-G---LTQILA----GD-M---QLSDVAQKIE---GQPNLRV--VPAGRI
A0A351ETF8      ---V--SNSV-G---LSDVLA----GE-A---TRRDARQVFE---RDGIRFDV-ITSGSK
A0A349B7N2      ---V--GRGN-G---LAPVDA----P------DVSGLIGRSH---IPGVSAITHLDERLE
A0A346Y185      ---A--KDTG-G---LPALAD----PR-N---NLSEIIVPLT---ADEGQYVPFIPAKSL
A0A259S8H9      ---I--DEAI-G---LSEVLS----GQ-V---PIGSAIRRTE---EA-NLFV--LPAGGI
A0A0Q5L115      ---V--SEGA-G---LTDVLS----GR-A---QLHQVMQQTE---AASNLWV--VGAGRI
A0A2W1Z497      ---V--ARGA-G---LTDVLS----GR-A---DLADVMQQTD---DVGNLWI--VGSGRV
A0A3L8NYD3      ---L--DPVV-G---LTQVLA----GD-I---DLRATIQDPG---LPN-LDV--IAAGRI
A0A1M6K628      ---I--DGAV-G---LTQVVA----GS-L---TVADALVSTS---QPN-LSV--LPAGRI
A0A561E8R3      ---L--EGSI-G---LTQALA----GD-I---TLHDVMQPTT---TPD-LVV--IPAGRI
A0A1H4I042      ---V--DGAV-G---LSTVLS----GA-V---SLSDALQETQ---FSG-LTV--LAAGAT
A0A4R7A6D9      ---V--DGAV-G---LSTVLS----GA-V---SLSDALQETQ---FSG-LTV--LAAGAT
A0A4Q4D4T1      ---A--EQNV-G---LTSVLV----GK-V---PLDSAVQGTD---VPG-LDV--LTSGTR
A0A261FE22      ---I--SNGV-G---LMQMLT----NQ-V---DAQTAVQQYW---KPE-FQV--LPVEDN
A0A5C8C085      ---L--VEGV-G---LTDVLV----GR-A---SIDDVLQQHH---ELENLSV--LAAGGI
A0A1E4BP96      ---L--PEGA-G---LTDILA----GR-A---TTGDVVQPVQ---GSQNLYI--LASGRV
A0A101KZQ4      ---L--LEGV-G---LTDVLI----GN-A---DIDDVMQPWG---ESGNLVV--LGAGKI
A0A439DNZ6      ---L--VGSV-G---LSTVLA----GR-A---SLEDVLQETA---FPG-VTV--VTSGAV
A0A0J6YE86      ---L--MSKV-G---FSTVLS----GA-V---SIDDSLQKTR---FPG-LSV--LTSGAV
A0A5Q5BFU2      ---L--VGPV-G---FSTVLS----GG-A---SLSEALQNTR---FPG-LTV--LTSGAI
A0A151BT98      ---I--DGSV-G---LTNVLV----HE-V---GLKDVLVEPE---PSLPLFV--LPAGPV
A0A2Y8ZRF8      ---I--DGSV-G---LTNVLV----HE-L---ALKDVLVEPE---PSLPLFV--LPAGPV
A0A2R9UAT1      ---L--VEGA-G---VTDILA----GR-A---EVDDVAQTFG---HLDTLRI--VAAGRT
A0A4Q5J5D7      ---L--VEGA-G---LTDVLI----GR-V---DFEDVAQEHP---DYPNLLL--LAAGGV
A0A1Y4CKD6      ---C--GASH-G---PAEVLE----DSGL---GVDDCIVLLE---ESG-IGF--WGGAGP
A0A0Q7KBQ4      ---L--ENSV-G---LMTVLI----GR-T---SLDEATQVHD---SG--ISF--LGTGPK
A0A1F1IHY9      ---L--ISTV-G---LTDVVL----GR-V---ELADALQTVG---NRPSLQV--LASGPI
A0A542HCT5      ---L--IEGL-G---LTDVLI----GT-V---QFDEVAQQVG---GLPNLRV--LAAGRV
A0A2S8WHZ8      ---M--MDGA-G---LTDVLS----HS-A---DLEDVLQPYG---HLPNLQV--LCSGRI
A0A537WNY9      ---I--TRSP-G---LTEVLI----GD-S---SLDDAIRKTS---NPS-LNV--LTGGRR
A0A5B8M469      ---M--DGTI-G---LSEVLS----GQ-V---PVQEAVRTVG---REN-LMV--LPAGGT
A0A1Y4CTD2      YVLE--DGVA-G---VGPVLN----GR-S---GVYELFQYKA---LRD------------
A0A0Q5M6Z7      ---L--RSGV-G---LTDVLS----GR-V---DLNDALQAPS---DSPHLRV--LGAGRV
A0A3N3ZPU0      ---L--TEGA-G---LTDVLA----GA-A---ELEDVLQDWE---PGSNVHL--LGAGRT
A0A359IQX7      ---L--DGSV-G---LTQVLA----GD-V---SIDDAIQNSE---LAN-LKV--LSAGRI
A0A4R8TXC3      ---V--DAKV-G---LTQVLA----GQ-V---DIAEAVYQLE---ESN-LFV--LTAGRI
A0A433EDP2      ---V--DAKV-G---LTQVLA----GQ-V---DIAEAVYQLE---ESN-LFV--LTAGRI
A0A231VTW0      ---V--DAKV-G---LTQVLA----GQ-V---DIAEAVYQLE---ESN-LFV--LTAGRI
A0A433ECD0      ---V--DAKV-G---LTQVLA----GQ-V---DIAEAVYQLE---ESN-LFV--LTAGRI
U7V3Z1          ---V--DAKV-G---LTQVLA----GQ-V---DIAEAVYQLE---ESN-LFV--LTAGRI
A0A1F1J417      ---I--NAKI-G---LTQVLA----GQ-V---DIAEAVHQVE---DSK-LFV--LPAGRI
A0A2A8D6P2      ---I--NAKI-G---LTQVLA----GQ-V---DIAEAVHQVE---DSK-LFV--LPAGRI
A0A1F0THV9      ---I--NAKI-G---LTQVLA----GQ-V---DIAEAVHQVE---DSK-LFV--LPAGRI
A0A5F0M6Y0      ---I--NAKI-G---LTQVLA----GQ-V---DIAEAVHQVE---DSK-LFV--LPAGRI
D8USQ4          ---I--NAKI-G---LTQVLA----GQ-V---DIAEAVHQVE---DSK-LFV--LPAGRI
E3H5W1          ---I--NAKI-G---LTQVLA----GQ-V---DIAEAVHQVE---DSK-LFV--LPAGRI
A0A1F1QKB0      ---I--NAKI-G---LTQVLA----GQ-V---DIAEAVHQVE---DSK-LFV--LPAGRI
A0A509JY23      ---I--NAKI-G---LTQVLA----GQ-V---DIAEAVHQVE---DSK-LFV--LPAGRI
A0A448USF4      ---I--NAKI-G---LTQVLA----GQ-V---DIAEAVHQVE---DSK-LFV--LPAGRI
A0A0Q9LZR0      ---L--IEGL-G---LTDVLI----GS-V---EFEEVVQQVG---GLPNLSV--LAAGRV
A0A1N7E3F1      ---I--EGGT-G---LTDVLI----ER-A---RLHEVIQTWG---QPG-LSV--LPSGRI
A0A544ZKQ1      ---I--EGGT-G---LTDVLI----ER-A---RLHDVIQTWG---QPG-LSV--LPSGRI
A0A372P1T1      ---I--EGGT-G---LTDVLI----ER-A---RLHDVIQTWG---QQG-LSV--LPSGRI
A0A5D0Q2X0      ---I--EGGT-G---LTDVLI----ER-A---RLHDVIQTWG---QQG-LSV--LPSGRI
A0A5R8Z2E7      ---I--EGGT-G---LTDVLI----ER-A---RLHDVIQTWG---QQG-LSV--LPSGRI
A0A1L2ZMV4      ---L--QSGA-G---LTDLLS----GA-V---DLDDVLQEWS---GDPRLQV--LGAGRV
A0A1S1CAD0      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---ESN-LFV--LPAGRI
G5ET14          ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQVG---ESN-LFV--LPAGRI
A0A1E9DXX2      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---ESN-LFV--LPAGRI
A0A1E8S156      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---ESN-LFV--LPAGRI
A0A1E8S5S2      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---ESN-LFV--LPAGRI
A0A1S1DFA8      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---ESN-LFV--LPAGRI
A0A2I1Z490      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQVD---ESN-LFV--LPAGRI
A0A1F0DAA9      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1F0PHK9      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1F0VZG6      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1E9G8X4      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1E9IAW2      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1E9ZBC9      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1E9ZDP4      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1F0R6B5      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1F0Z7N5      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1F1D897      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
D2NP38          ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1F1FV74      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1E9M791      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A291DEI8      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1S1D5T1      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1E8TRD6      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1F0XT88      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1F1EVP5      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
C6R548          ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A0K2RXS2      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A1F0KX60      ---L--DAKV-G---LTQVLA----GQ-V---EIANAVHQLG---DSN-LFV--LPAGRI
A0A542I3V2      ---L--VPGV-G---VTNVLS----GQ-A---QLVDVIQAPT---VLSNLSV--LGSGPT
A0A2T0UZ65      ---V--SSTV-G---LSEVLS----GQ-M---DYTDAMQATR---HQD-VFV--IAGGQV
A0A1R4JTI6      ---V--EGSV-G---LTNAVV----GN-A---QVDDVLQPVS---EVENLTV--LASGPV
A0A4R7TM52      ---L--VEGV-G---LTDVLA----GR-A---DFEDVAQPVG---QGGNLSV--LGAGLL
A0A542XE74      ---V--DSGV-G---VTQVLA----GD-V---PLEEALVESG---TRG-LQI--LPAGRI
A0A0G3V3F3      ---V--PRTP-G---LTSVLL----GS-----DLSEALRKVA---ESPFLRV--LSSGPP
A0A0Q7QDF6      ---A--EQNV-G---LTSVLV----GK-V---PLDSAVQGTD---VPG-LDV--LTSGTR
A0A3S0V9U6      ---I--DSGV-G---LSQVLS----GQ-V---GIEEAIQRFH---ESE-LYV--VPAGRI
A0A2R7Z032      ---I--DGEV-G---LTQVLA----GD-L---RAGEAMVSSG---IDN-LWL--LPAGRI
A0A1I0W453      ---V--DGAV-G---LTQALA----GD-V---EIRDVIIDSG---MPN-LSL--LPAGRI
A0A1H4LCS9      ---I--DGAV-G---LTQALA----GD-V---DIRDVIVDSG---LTN-LSV--LPAGRI
A0A4Q2RZP8      ---I--DGAV-G---LTQALA----GD-V---DIRDVIVGSG---LSN-LSL--LPAGRI
A0A0Q6VV12      ---I--DGTV-G---LTQALA----GD-V---DVRDVIVGSG---MAN-LSV--LPAGRI
A0A495NTA9      ---I--DGAV-G---LTQALA----GD-V---EVRDVIVGSG---LAN-LSL--LPAGRI
A0A0Q9QB08      ---I--DGAV-G---LTQALA----GD-V---DVRDVIVESG---VAN-LSL--LPAGRI
A0A4Q2SA86      ---I--DGAV-G---LTQALA----GD-V---EVRDVIVESG---MAN-LSL--LPAGRI
A0A4Z1C3Z0      ---V--DGAV-G---LTQALA----GD-V---DVRDVIVQSG---MAN-LSL--LPAGRI
A0A5R8L819      ---I--VADV-G---LTDVLA----RR-S---TWREVSQPAH---TPN-LTV--LAAGRI
A0A261FQA1      ---I--NGKV-G---LAHVLA----RQ-A---KLDEAIQQYW---KPT-FHV--MPAGEQ
A0A1Q2CJ92      ---L--DGAV-G---LSQVLA----GT-I---KLSDAMQATD---HKH-LQV--LPAGRI
A0A2T0S3C8      ---L--EGAV-G---LTTVLA----GR-A---SIADVVQPWS---EG--MWA--LPSGSL
A0A4Y8WZJ3      ---L--ISTV-G---LTDVVL----GR-V---ELADALQTVG---NRPSLQV--LASGPI
A0A285VUW0      ---L--EGAV-G---LTSVLA----GD-A---RAEDVIQRWR---DTE-MYV--LAGGEI
A0A4Q2JUT1      ---L--PSGA-G---LSDVLA----GR-A---ALSEVLQRTP---KSNNLLV--LAAGSV
A0A542J310      ---L--PGGA-G---LSDVLA----GR-A---ALTEVLQRTP---KSNNLLV--LAAGSV
A0A444BL03      ---A--PGSI-G---LSHVLT----DQ-V---DLEDAFQPTD---QEN-VRL--ITSGRT
A0A4Y8X357      ---V--DGRV-G---LSEVLS----GD-V---FLADALITLE---DG--LVL--LPAGRT
R4LD52          ---L--EGAA-G---LTTVLA----GK-A---AVDDVLQRYG---DH--LWV--LPSGFL
A0A4T2CD79      ---V--VGGV-G---VTDLLI----GS-A---ELDDVLQPWG---ERGNLRV--LGAGSI
A0A4Q4D742      ---L--ENSV-G---LLSVLV----GR-T---TIEQAIQPH----VSG-ISF--MGTGPA
A0A4Q2RU39      ---I--DGAV-G---LTQALA----GD-V---EVKDVIVDSG---MTN-LSL--LPAGRI
A0A4Q2SK58      ---I--DGAV-G---LTQALA----GD-V---EVKDVIIDSG---MTN-LSL--LPAGRI
A0A2N3YJR1      ---R--ENTI-G---LSHVLT----DQ-V---SLVDALQATD---QPN-VRL--ITSGRT
A0A1C6T1J1      ---L--DGGV-G---LTDVLV----GD-V---QVGDVVQRWG---DKS-LLV--LPSGST
A0A2W2CFC8      ---I--DSAV-G---LTDVLV----GD-V---PVGDVVQRWG---DKS-LLV--LPAGSA
A0A2W2A4B0      ---I--EGSA-G---LSDILV----GR-V---ELADVLQPWG---RAG-LSV--IPSGTV
A0A4Y9MDA5      ---L--EGAA-G---LTTVLL----GR-A---GLPDLVQEWG---TSG-LHV--LTAGPV
A0A1H7N9P7      ---L--EAAA-G---LTTALL----GR-A---SVADLVQEWG---TAG-LHV--LPSGPV
A0A1M7V0F8      ---L--EAAA-G---LTTVLL----GR-A---TVADLVQDWG---TEG-LHV--LASGPV
A0A1V8PLV6      ---L--EGGA-G---LTHVLS----DQ-A---AVKDAVQRYW---KPN-LHI--LPAGPK
A0A4R0U4F1      ---I--EGAV-G---LTHLIT----NR-V---SSHDAIQRYW---KPN-FHV--LPAGKQ
A0A357ZCV8      ---L--KPSV-G---SYAVLT----GL-A---KLSDAVVSTP---IPN-LFF--LDTEPN
A0A419GS64      ---I--TLDH-G---LTRMISTYDEGD-DPF-AFGDQV-------MDG-LTV--IGSGPP
A0A538BYZ4      ---LGGRQSP-G---LVDAIL----KP-A-L-ALEDVTQLCP---SFN-LSV--VLAGRS
A0A4R1CW45      ---I--EFEA-G---VSDYLL----GE-ME--SLHEVGLHID---GTK-LAV--FPTHTV
A0A4R5Z7B0      ---V--NNLF-G---FTTVLT----KQ-A---TLGSTVLETE---EKD-LYI--LTSGPV
A0A2V2CXY5      ---IGSTEKIIG---GAHYLA----GK-A---DMADVIYQTN---IPN-GYM--IPTTSA
A0A2S8MDM2      ---L--LQPV-G---FSTVLS----GR-A---LLGEALQKTR---FPG-LTV--LTSGSI
A0A357ZDL3      ---L--RAPS-G---LYAVLA----KQ-V---ALNDAVMTTQ---AGN-LFF--LDAEAG
A0A4Y8ZIU8      ---V--DGRV-G---LSEVLN----GD-V---ALQDVLVPVG---DHG-LLL--LPAGRT
A0A0F0KYJ9      ---L--PKGA-G---ISDVLA----GC-A---TIAEVAQRFG---NGQ-LLV--VAAGKV
A0A510HHA8      ---L--RNIN-G---LVNAIT----GE-R---GLQEVLSEP----LPN-LKV--CPSGPV
A0A538BBM6      ---R--PNSV-G---VVDVLR----GN-T---VVEDALQYVPVTRETG-MYF--LSTGSS
A0A1I6GVG4      ---L--PKGA-G---ISDVLA----GR-A---TIAEVAQRFG---NGQ-LLV--VTAGKV
A0A1I6IST1      ---L--PKGA-G---ISDVLA----GR-A---TIAEVAQRFG---NGQ-LLV--VTAGKV
A0A412JBM5      ---G--RNTSTG---LCKYLV----GL-GEL-GLASIE-------GIP-LDI--AFCGVI
A0A1C2B334      ---S--LNNSIG---LTDFLI----GQ-G---DLPDLLQQGG---LDR-LDV--LATGQL
R7Y679          ---A--VSPDIG---LTDYLR----GS-A---PVGDVLQRSG---VGG-FDV--LAAGAL
A0A5Q2F9A3      ---L--EDAA-G---LSTILI----GR-A---SLREVVQVAG---MGT-LQV--LTSGPV
A0A0K8Q3D9      ---L--VPGA-G---VTDVLS----GT-A---DLDDVLQPWGA--LPN-LSV--LGSGRI
A0A2R7RCA1      ---L--VPGV-G---VTDVLT----GT-A---ELADVLQPWGA--LPN-LSV--LGSGRI
A0A023X491      ---L--RNTR-G---VVDALV----GS-E---NVEELWQTP----LDN-LSV--LTSGPV
A0A4R1BMZ2      ---L--RNVW-G---VVDVLV----GK-R---SLPDTMQEV----LVG-LNV--LTCGPI
A0A1Q7WJN6      ---V--SRKP-G---LTDVLA----GD-V---TAEAALQRTP---YSG-LSF--IGCGSR
A0A1E2SNF6      ---I--PNGA-G---LSDVLA----GR-V---SLREVLQDPDVSLHTH-IRV--LTAGRT
Q6ADE8          ---I--PNGA-G---LSDVLA----GR-V---SLREVLQDPDVSLHTH-IRV--LTAGRT
A0A1Q7CZ24      ---L--SGGKRG---LAEALL----AD-SGL-SLEDTVETLA---HFN-LSV--LPAGRA
A0A2W6VLC6      ---I--EGGL-G---LTDVLI----GR-A---RVEDVVIDMA---PRG-FSV--LPAGRI
A0A519G798      ---L--ERSV-G---LTTVLV----GR-S---ELQDSIQKHT---DSG-IYF--LASGPI
A0A519GXS6      ---L--ENAV-G---LTSVLV----ES-I---AVEDAIIATA----TG-LDV--LTAGEE
A0A520EHH5      ---I--VGSV-G---VSSVLA----HD-A---GLDEVVQTTG---HTD-LWA--LGSGPA
                           .                                                

A0A348NU28      PPNPAEMLTSDAMKRLLEEATARY--DYVIIDSPPVMSVADANLLAPFVDGVIVVVDAGK
A0A2N4T4Q5      PPNPTELLASQAMRTMLAELAEDA---FVLVDAPPLLPVTDAALLTASADGALVVATAQG
A0A1M3LEY6      PPNPSELLGSQAMVNLLRHVEKEY--DVVLIDGPPLLPVTDSALLSKQVRGALLIVAAGR
A0A538AJI7      PEA--GDLLARRLTDVLDEARENF--DLVVIDTPPLLSTDDARTIATMAKGILLVVTRGT
A0A538AM15      PPSPYEVLKSPRLGELLEEARLRY--DYVVLDTPPLCPVQDCRVIAHWIDGFLLVVAAHH
A0A022KX11      PPNPSELLGSAPMEALLTRLMQEY--DFVLIDSPPVVPVIDAVVIERLTGGLLMVVGVDR
A0A255G8R8      PPNPTELLDSAQMRALLDEALAEY--DVVLIDSPPLLPVSDGLVLGKLVGGALLVTGIER
A0A4Y5YMQ6      VPNPAQLLASQKMTELVEGLRPRY--DFVVIDTAPLLSVADATIISQYVDSTIVVVNTRK
A0A4Q5A868      PPNASALLNSPIMVELLNNAIAQY--DYVLIDTAPMVVANDAVIFVRRGGSLVMVCRRDQ
A0A0W8I9Y2      APNPTELLSSKAMHAMLETLAED---ALVLVDAPPLLPVTDAALLTASADGAIIVATAQK
A0A345NSU7      PPNPSELLGSSKMHELFERLSEQY--DFILVDTPPVLPVTDAMVIEKLTGGMLMVVASGE
A0A4Q5APW3      PPNASALLNSPIMVELLNNAIERY--DYVLVDTAPMVVANDAVIFVRRGGSLIMVCRRDQ
A0A4Q5B0V3      PPNASALLNSPIMVELLNNAIERY--DYVLVDTAPMVVANDAVIFVRRGGSLIMVCRRDQ
A0A222TG79      PPNPAELLTSQKASEGINSLSSLY--DYVIVDTPPVLPVTDAVIASRLVDGVIVVVRSGA
A0A1Q2CRV2      PPNPAELLGHTRMRALLEDASKLY--DTVIIDSPPLLPVTDAAVLAGETAGVLVVVGSGI
A0A2S5WZJ5      PPNPSEMLGSAAMKSIISLLSTDY---IVVIDAPPLLPVTDAAVLSTRVDGVVLVATAGR
K6WHS4          APNPAELLGSRKASDVFGSLRDSF--EYVVVDTPPCLPVTDAQVVSRLVDGVLVVVRIDK
A0A1L2ZMQ6      PPNPSELLASKTMGKLLEDLSER---AFVIIDAPPLLPVTDGAVLAKASDGALIVVKAGK
A0A3L7ADK2      PPNPSELLGSRAMKELLAALGEQ---SIVILDAPPILPVTDAVVLANSADGVVLVASARN
A0A0G3V3M7      RTDPGTAIEMVKVAARLG--RDIA--DLVIVDSPPILLANDAAELSTFCDATVLMVRAGW
A0A3E2DN22      PPNPSELLGSQRMKDLLTELRKRG--YFVVIDAPPLLAITDAGLLGAIADGTIYVAVVGK
A0A3Q9ULZ9      PPNPSELLGSVRMHNLISRLTKAG--YFVVLDAPPLLAVTDAGLLATSTDGVIMVHVVGG
A0A3S9JFL2      PPNPSELLGSVRMHNLIARLTKAG--YFVILDAPPLLAVTDAGLLATSTDGVIMVNVVGG
A0A1Q2CI19      LAHPTAL--ASRMGPLVASARKRA--DVVIIDSAPLLEAAEVFDILPHVDDVVLVARSGR
A0A512T3M3      LEHPTSL--ASRMVALQEGTRQLA--DVVIVDSAPLLAASEVFDLLPLVDTIMLVVRSGR
W6JTW4          LDHPTSL--ASRMGPLLEEARGLA--DVVLVDTAPLLAASDVFDILPLVDTVLVVVRSGR
A0A0A0JTY0      LAHPAAL--ASRMSHLLDEARGMA--DVVLIDTAPLLEASDVFDILPMVDTLLLVVRSGR
A0A0A0JXF2      LTHPASL--ASRMGGLLEEAREMA--DVVLIDTAPLLEASDVFDILPMVDTILLVVRSGR
E6S8H2          LEHPASL--ASRMGGLLTEARGLA--DVVLVDSAPLLAASDVFDVLPLVDTVLLVVRSGR
A0A0A0JGH0      LTHPASL--ASRMGHLLAEVRELA--DVVIIDSAPLLAASDVFDILPIVDTVVLVVRSGR
N0E4U7          LTHPASL--ASRMGHLLEEVRGMA--DVVIIDSAPLLAASDVFDVLPIVDTVLLVVRSGR
A0A0A0IYK2      LAHPASL--ASRLGSLLEEVRGMA--DVVLIDTAPLLEASDVFDILPMVDTLLLVVRSGR
A0A0Q9L0H3      LAHPAAL--ASRMGQMLEQARDLA--DVILIDSAPLLEASDVFDVLPTVDTLLLVVRSGR
A3TMK0          LAHPASL--ASRMGHLLEEARDMA--DVVLIDTAPLLEASDVFDILPMVDTLLLVVRHGR
A0A543PXP1      LSHPASL--ASRMGGLLSETRGLA--DIVLIDTAPLLAASDVFDLLPLVDTVLMVVRNGR
A3TMH6          LSHPASL--ASLMGGLIAELRDLA--DVVLIDTAPLLAASDVFDVLPVVDTVVVVVRHGR
A0A5R8VLL6      PPNPSELLSSHAMKQLLNSLAER---GIVIIDAPPLLPVTDAVLLAKIADGAIVVVRAGQ
A0A1H6WL79      PPNPSELLGSRAMEHLLKDLAQR---AIVLIDAPPLLPVTDAAVLSRVADGTLVVARARK
A0A101LAM5      PPNPSELLGSRAMEHLLRDLSQR---AMVLIDAPPLLPVTDAAVLSRVADGTLVVARARK
A0A4Y3NEG0      PPNPSELLGSRAMEHLLNELSQR---AMVLIDAPPLLPVTDAAVLSRVADGTLVVARARK
A0A1H6YPK1      PPNPSELVGSDTMRSLLYSFPED---TMVIVDSPPLVPVSDAAVLAARTDGALVVARAGA
A0A2R7MGI0      PPNPTEMVGSQRLQSLARKLAEE---MVVIVDSPPTLAVADAAVIASWADGAVLVVTAGR
A0A2T7WQY4      PPNPTEMVGSQRMQALARKLAED---MVVIVDSPPTLAVADAAVIGSWADGVVLVVTAGR
A0A1G6GTN3      PPNPSEMVGSQRMQALARKLADD---MVVIVDSPPTLAVADAAVIASWADGAVLVVTAGR
A0A1N7DLV3      PPNPSEMVGSQRMQQLARTLADD---MVVIIDSPPTLAVADAAVIANWADGAVLVVTAGR
A0A1V2NSB5      PPNPSEMVGSQRMQQLARTLADD---MVVIIDSPPTLAVADAAVIASWADGAVLVVTAGR
A0A0Q5Q5L3      PPNPSEMVGSKRMQALSRKLAED---LVVIVDSPPTLAVADAAVIASWADGTVLVVTAGR
A0A0Q6DVM4      PPNPSEMVGSKRMQALSRKLAED---LVVIVDSPPTLAVADAAVIASWADGTVLVVTAGR
A0A1R3WWR6      PPNPSEMVGSQRMQALTRKLAEE---LVVIIDSPPTLAVADAAVIASWADGAVLVVTAGR
A0A5Q2FA83      PPNPSELLGSTAMETLFAELLQAY--DYVLVDSPPVLPVIDPILIDRLVGGMLMVISVNT
A0A542FTE6      PPNPSELLGSNAMREFLDSLRRTG--AFVVLDAPPLLAVTDGAVLSTIADGVIMTVDAAS
A0A2S5UYV0      PPNPSEMLGSEAMRSIIRLLSQD---YIVVIDAPPLLPVTDAAILSTRVDGVVLVATAGR
A0A2S5X9U6      PPNPSEMLGSEAMKSIVSLLSKD---YIVVIDAPPLLPVTDAAVLSTRVDGVVLVASAGR
A0A2S5ULV5      PPNPSEMLGSEAMKSIVSLLSKD---YIVVIDAPPLLPVTDAAVLSTRVDGVVLVASAGR
A0A653YMF0      PPNPSEMLGSEAMKSIVSLLSKD---YIVVIDAPPLLPVTDAAVLSTRVDGVVLVASAGR
A0A4V1VGV9      PPNPSELLGSRRMSAVIEALGEE---YFVVLDAPPLLPVTDAGLLAVAADGAAVVYQHGR
A0A3Q9IY80      PPNPSEVLGSERMKNLLRTLAKD---YTVIVDAPPLIPVTDAAVLSHSADGAIIITSVGK
A0A0F0LP73      PPNPSEMLGSTAFQRLLGELRRD---FFIVIDAPPVLPVTDASVMSAFVDGVVFVIAMGR
A0A1F1X071      PPNPSELLGSRRMQELIEELSRQ---YFVIIDAPPVLAVTDAQLLTRHSDGAILVAVPGQ
A0A3R8RWC7      PPNPSELLGSRRMQELIEELSRQ---YFVIIDAPPVLAVTDAQLLTRHSDGAILVAVPGQ
A0A4U0RJZ4      PPNPSELLGSRRMSAVIDALEEE---YFVVLDAPPLLPVTDAGLLSVAASGAAVVYHHGT
A0A4R1FGL9      PPNPSELLGSRRMSAVIDALEEE---YFVVLDAPPLLPVTDAGLLSVAASGAAVVYHHGT
E3B8H1          PPNPSELLGSRRMSAVIDALEEE---YFVVLDAPPLLPVTDAGLLSVAASGAAVVYHHGT
A0A0Q5AWK6      PPNPSEMLGSAAMRTLVERLSKD---YFVIIDAPPILPVTDASIVATVVDGVVFVVASNR
A0A3N1NLD3      PPNPSEMLGSSAMRALIERLAED---YFVIIDAPPILPVTDASIVATVVDGVVFVVASNR
A0A3N2FVI8      PPNPSEMLGSSAMRALIERLAED---YFVIIDAPPILPVTDASIVATVVDGVVFVVASNR
A0A2S5XDQ6      PPNPSEMLGSEAMRALVARLSKD---YFVIIDAPPVLPVTDASIVATVVDGVVFVVASNQ
A0A2S5XNN6      PPNPSEMLGSEAMRALVARLSKD---YFVIIDAPPVLPVTDASIVATVVDGVVFVVASNQ
A0A538JQF8      VANPGRLL--ARAADLVREARNLA--DFVLIDTAPTLIVNDAIDFMPEVDCVIPVLKCGS
A0A0Q5JKD6      PPNPSEMVGSQRMQSLARKLADDM---VVIIDSPPTLAVADAAVIASWADGAVLVVTAGR
A0A0Q9TBP0      PPNPAALLASGQMHLVLEELAAKA--DMIVVDSPPVLTGADTLELAALADMVVVVTRERV
A0A346XTB0      RGDPAALLRTHAFRKGMERIVDSA--ELLIVDSSPLLAVADATIVAGSVDGIVIVVS-HG
A0A2W6DK08      LERPSTL--PARMGNLVMQARELA--DIVLIDSAPMLLANDATDLMPYVDTVLVVSYASR
A0A2S0LQ32      PPNPSELLGSQRMKALLDRLSQEA---VVLLDAPPLLPVTDAALLSALADGAILTFEVGG
A0A2N6V1R5      PPNPSELLGSQRMKALMDYLKDDA---MVIMDAPPLLPVTDAGLLSALADGAILVMEVGG
G9PHS6          PPNPSELLGSQRMKALMDYLKDDA---MVIMDAPPLLPVTDAGLLSALADGAILVMEVGG
U1PLM7          PPNPSELLGSQRMKALMDYLKDDA---MVIMDAPPLLPVTDAGLLSALADGAILVMEVGG
A0A351ETF8      VQDPALLLRGDRWTSLADELFLYD---LVIIDAPPVLAVTDAVLIGRAVNGQILLTRLGA
A0A349B7N2      SVQPADLL--SWIRSTVQQARPTS--DVVLIDTAPFLTVNDARDLLDVADQVVVVARSGK
A0A346Y185      GDDTAAFFRTPGFRQAITRLREVA--DLIIVDSPPLLLASDASAIATNVDGIVVVVS-RG
A0A259S8H9      PPNPSEMLGSAAFQQLLTRLRQDF---FIVVDAPPVLAVTDASVLSSVVDGLVFVVAMGR
A0A0Q5L115      PPNPSELLGSQTFQDLVSTLAEHA---TVILDAPPVLAVTDAVVLAAKADGVLMTASAAR
A0A2W1Z497      PPNPSELLGSRMFRDILASLGEHA---TVVLDAPPILAVTDAVVLAAGADGLVVTVSAQG
A0A3L8NYD3      PPNPSELLGSQRMQSVIEELVAAD--YMVLIDAPPLLPVTDAGLLSGIVDGSILVLAVGK
A0A1M6K628      PPNPSEIVGSKRMADLIAHL-SET--HLVIIDAAPLLPVADAGLVSAVSDGVLLVVQHGK
A0A561E8R3      PPNPSELVGSRRMETAITEL-SKD--HLVIIDAPPLLPVTDAGLLARSADGALLVMHVGR
A0A1H4I042      PPNPSELLASHAAKNLLEELRGKF--DYVIVDSCPLLAVTDAALLAANADGALLLGRYGQ
A0A4R7A6D9      PPNPSELLASHAAKNLLEELRGKF--DYVIVDSCPLLAVTDAALLAANADGALLLGRYGQ
A0A4Q4D4T1      PPNPSEIIQTAAMETVLIELGRRY--DIVLVDAPPLLPVADAALLSVISDGAILVVRHGR
A0A261FE22      QGTAAVMLSSAVMENMIDQAAKHY--DHVIIDTAPMQVSNDASLFAREGATLLLVVAQTV
A0A5C8C085      PPNPSELLGSQAMRRLLTLLSQRA---IVLVDAPPLLPVTDGAVLTTMADGAFIVVSAGR
A0A1E4BP96      PPNPSEVLGSRRMRDLVTSLTEHA---LVIVDSPPTLLVADAAVLSRVTDGALLVTSAGR
A0A101KZQ4      PPNPSELLGSNTFQNLIQSLAQEA---IVLIDAPPLLPVTDAAILTARTDGALVVSRVRK
A0A439DNZ6      PPNPSELLGSLAAKKILDELRTGF--DYVVVDSSPLLAVTDAAILAAASDGVLIVARYGE
A0A0J6YE86      PPNPSELLGSQSARKVLAELRSRF--DYVIIDSTPLLAVTDAAILAAGADGVLIMARFGQ
A0A5Q5BFU2      PPNPSELLGSQSARRLLNELRAQF--DYVIVDSTPLLAVTDAAILAAGADGVLIMARFGH
A0A151BT98      PPNASELLGSSAMQGLFQELVAEF--DFVVFDSPPMLPVVDALELEKLTGNLILVARGGQ
A0A2Y8ZRF8      PPNASELLGSAAMRNLFQELVAEF--DFVVFDSPPMLPVVDALELEKLAGNLILVARGGQ
A0A2R9UAT1      PPNPSEVLGSERMKDLLRELSREA---MVIVDAPPLLPVTDAAVLTHSADGAIVVVGAGR
A0A4Q5J5D7      PPNPSELLGSQTMRQLLTELAKTA---LVIVDAPPLLPVTDAAVLTAVADGAFVVISSGR
A0A1Y4CKD6      VQNPVEVLSDERLPSLFDGLRGQW--DYIVLDASPCGMFQDAAMLANWVDEVLFVVRFDK
A0A0Q7KBQ4      PPNPAEVLDTQAMRDLLHGLRSEY--DVVVIDAPPMLPVADASILMREVDGALMLVRHGS
A0A1F1IHY9      PPNPSEILASDRFNDLINALAEDA---LVIIDAPPLLPVTDAAILARRFDGCLLVVSAGR
A0A542HCT5      PPNPSEMLGSKAMRRLLERLGETC---TVIVDAPPLLPVTDAAVLTASADGALVVVSAGQ
A0A2S8WHZ8      PPNPSELLGSKAMKSLLSELALDA---VVLVDAPPLLPVTDAAILSTSADGILVVVRAGS
A0A537WNY9      LADPGEML-TISFGSVLSQLAEMY--ETIVIDGTPLAPISDARVIARFADASVIVVSAGS
A0A5B8M469      PPNPSEMLGAHAFEALLRELRERF---FVVVDAPPVLPVTDALLVGAVADGTLFVVAVGQ
A0A1Y4CTD2      ---PMAVFSGERLADVMAELSERF--DYIFVDCSPVAAAADAELWMRQVDTVVLVVRQDM
A0A0Q5M6Z7      PPNPSELLGSRTMRELVSALADVA---IVILDAPPLLSVTDAAIMGTIADGVVITVGAKQ
A0A3N3ZPU0      PPNPSELLGSKTMRNLLARMGQDY---MVVIDSPPLLPVTDPSVLAKGADGVVIVTQANK
A0A359IQX7      PPNPSELVGSQRMHNLLIALSENR---TVIVDAPPLLPVTDGGLLTAAADGAILVMATGR
A0A4R8TXC3      PPNPSELLGSDKMRQLVRELSEEF---VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGK
A0A433EDP2      PPNPSELLGSDKMRQLVRELSEEF---VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGK
A0A231VTW0      PPNPSELLGSDKMRQLVRELSEEF---VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGK
A0A433ECD0      PPNPSELLGSDKMRQLVRELSEEF---VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGK
U7V3Z1          PPNPSELLGSDKMRQLVRELSEEF---VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGK
A0A1F1J417      PPNPSELLGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGK
A0A2A8D6P2      PPNPSELLGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGK
A0A1F0THV9      PPNPSELLGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGK
A0A5F0M6Y0      PPNPSELLGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGK
D8USQ4          PPNPSELLGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGK
E3H5W1          PPNPSELLGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGK
A0A1F1QKB0      PPNPSELLGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGK
A0A509JY23      PPNPSELLGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGK
A0A448USF4      PPNPSELLGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGK
A0A0Q9LZR0      PPNPSEMLGSKAMRRLLEGLGETY---TVIVDAPPLLPVTDAAVLTASADGALVVVSAGH
A0A1N7E3F1      PPNPSELLGSRVMRSVLAQLTEEY--DMVIVDAPPLLPVTDAAALGAICDGALLVVRHGK
A0A544ZKQ1      PPNPSELLGSRGMRSVLAQLTEEY--DMVIIDAPPLLPVTDAAALGAICDGALLVVRHGK
A0A372P1T1      PPNPSELLGSRGMRTVLAQLTEEY--DMVIIDAPPLLPVTDAAALGAICDGALLVVRHGK
A0A5D0Q2X0      PPNPSELLGSRGMRTVLAQLTEEY--DMVIIDAPPLLPVTDAAALGAICDGALLVVRHGK
A0A5R8Z2E7      PPNPSELLGSRGMRTVLAQLTEEY--DMVIIDAPPLLPVTDAAALGAICDGALLVVRHGK
A0A1L2ZMV4      PPNPSELLGSRAMKRLLTDLAQES---VVIVDSPPLLPVTDASVLSTSADGVLVVARAGS
A0A1S1CAD0      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
G5ET14          PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1E9DXX2      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1E8S156      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1E8S5S2      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1S1DFA8      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A2I1Z490      PPNPSELLGSDKMRQLINELSEEF---IVVIDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1F0DAA9      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1F0PHK9      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1F0VZG6      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1E9G8X4      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1E9IAW2      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1E9ZBC9      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1E9ZDP4      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1F0R6B5      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1F0Z7N5      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1F1D897      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
D2NP38          PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1F1FV74      PPNPSELLGSDKMRQLIKELSEEF---IVVVDVPPLLPVTDASLLSNSVDGVILVGSIGR
A0A1E9M791      PPNPSELLGSDKMRQLIKELSEEF---IVVVDVPPLLPVTDASLLSNSVDGVILVGSIGR
A0A291DEI8      PPNPSELLGSDKMRQLIKELSEEF---IVVVDVPPLLPVTDASLLSNSVDGVILVGSIGR
A0A1S1D5T1      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1E8TRD6      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1F0XT88      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1F1EVP5      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
C6R548          PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A0K2RXS2      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A1F0KX60      PPNPSELLGSDKMRQLINELSEEF---IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGR
A0A542I3V2      PPNPSELLGTNAMKQLLNTLAAGA---TVLIDAPPLLPVTDAAVLSRAADGVIVVAKAGR
A0A2T0UZ65      PPNPSELLGSARMRQLLQELTRDH---FVILDAPPLLPVTDAALLSGAADGTILVFAVGK
A0A1R4JTI6      PPNPSEILGSDRLEAILRSLAQDH---MVIVDAPPLLPVTDAAILAAKYDGCVLVVTAGR
A0A4R7TM52      PPNPSEVLGSARMRDLLQRLAVDS---TVIIDAPPLLPVTDAAVLAHNADGAMIVASVGK
A0A542XE74      PPNPSELVGSNAMHRLIERLAADH---MVIIDAPPVLAVTDGALLSAAADGTILVTRLGR
A0A0G3V3F3      VEDPSAILGARAFRVVLDTLRAVR---LVVVDTPPSGLFSDALAVASQCDATIFVLDLKN
A0A0Q7QDF6      PPNPSEIIQTAAMETVLIELGRRY--DIVLVDAPPLLPVADAALLSVISDGAILVVRHGR
A0A3S0V9U6      PPNPSELLGSAKMRKLIEELAREY---LVLIDAPPLLPVTDGSLLSTSVDGAILVTKVGS
A0A2R7Z032      PPNPSELLGSLRMSQLIDELARTH---LVLLDAPPLLPVTDAGLLSAFCDGALLVQATGQ
A0A1I0W453      PPNPSELLGSLRMKQFIDDLAHDY---LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGK
A0A1H4LCS9      PPNPSELLGSLRMKQFIEDLSHDY---FVILDAPPLLPVTDAGLLSAFCDGALLVQAAGK
A0A4Q2RZP8      PPNPSELLGSLRMKQFIEDLSHDY---LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGK
A0A0Q6VV12      PPNPSELLGSLRMKQFIDDLSQDH---LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGR
A0A495NTA9      PPNPSELLGSLRMKQFIDDLAQDH---LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGR
A0A0Q9QB08      PPNPSELLGSLRMKQFIDDLSADH---LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGK
A0A4Q2SA86      PPNPSELLGSLRMKQFIDELSHDY---FVILDAPPLLPVTDAGLLSAFCDGALLVQAAGK
A0A4Z1C3Z0      PPNPSELLGSLRMKQFIDELSHDY---FVILDAPPLLPVTDAGLLSAFCDGALLVQAAGK
A0A5R8L819      PPNPSELVGSERMNLLLHELAAEA---IVILDAPPLLPVTDAAVLSRQADGAIIVVTAGK
A0A261FQA1      QANPSILINSKAMNMLLHAAAKQY--DNVIVDSTPMSVANDSAVFAKEGGTLLMVVGQGV
A0A1Q2CJ92      PPNPAEMVGSSRMRSLIEHLSKAH---MVIIDAPPLLPVTDATLLSASADGAVVVVQSGT
A0A2T0S3C8      PPNPSELLGSQHMADLLEQFREQY--DMVIVDCPPLLPVTDGAVVAARADGALLLARSHK
A0A4Y8WZJ3      PPNPSEILASDRFNDLINALAEDA---LVIIDAPPLLPVTDAAILARRFDGCLLVVSAGR
A0A285VUW0      PPNPSELLGSRAMERLFKQFLRDF--DFVLVDSPPILPVTDALVMSRLTGGLLMVVSAAS
A0A4Q2JUT1      PPNPSEVLGSERMHTLIADLTKHA---TVIIDAPPLLPVTDGAVLAHQADGALVVVTLGK
A0A542J310      PPNPSEVLGSERMHTLISDLTKHA---TVIIDAPPLLPVTDGAVLAHQADGALIVVTLGK
A0A444BL03      PPNPSELLGSARMHELVRELTVDN---IVILDAPPLLPVTDAGVLSASCDGSLLVFAVGR
A0A4Y8X357      PPNPSEQLGSSRMRELLEALSETH---MILVDAPPVLPVTDSTLLANAVDGTILVVRHGT
R4LD52          PPNPSELLGSQHMALLMDELRTAF--DTIIVDCPPLLPVTDAAVVAARADGALLLARSHK
A0A4T2CD79      PPNPSELLGSHGMTTLLRELALDA---IVLVDAPPLLPVTDAAILAAISDGAIIVVSAGR
A0A4Q4D742      APNPAEVLESRAMRDLLARVRNEF--DTVIIDAPPMLPVADASILLTEVDGALLLVRHGS
A0A4Q2RU39      PPNPSELLGSLRMKQLIDELAEEY---LVILDAPPLLPVTDAGLLSAFCDGALLVQASGK
A0A4Q2SK58      PPNPSELLGSLRMKQMIDDLALDY---LVILDAPPLLPVTDAGLLSAFCDGALLVQASGK
A0A2N3YJR1      PPNPSELLGSARMHDLVRELSVD---NIVILDAPPLLPVTDAGVLSASCDGALFVFAVGK
A0A1C6T1J1      PPNPSELLGSKAMADLLLGLRESA--DIVIIDTAPLLAVTDGVVVAVQSDGALLVSQQGR
A0A2W2CFC8      PPNPSELLGSKAMADLLLALRESA--DIVIIDTAPLLAVTDGVVVAVQADGALLISQHGR
A0A2W2A4B0      PPNPSELVGSPAFTALIEDVAALF--DVVIVDTPPLGSVTDAALVSRAVQNMLLVVASGR
A0A4Y9MDA5      PPNPSELLGSPAMRRLLEAAREEY--DHVVVDTAPVLPVADAAILSRSVDGVLLLANVTR
A0A1H7N9P7      PPNPSGLLGSPVMRRLLERLRDDY--DHVVLDTAPVLPVSDAAVLSRSVDGLVVLADVTR
A0A1M7V0F8      PPNPSELLGSPAMRRLLERLRDEY--DHVVLDTAPVLPVADAAILSRSVDGLLVLANATR
A0A1V8PLV6      PLNASMLLNSKTMSKLLDTALHTY--DYVIVDTAPMVVANDAAVFGAKSNGIVLVSGRDM
A0A4R0U4F1      TMNPSILLNSRAMKALVEQVSGAY--DYVIIDTAPMQVANDAAVFAKEGPELLLVAGLGV
A0A357ZCV8      IPSPTDVLSSKSFAKLVEVLESNF--EYVIFDTPPVGTFVDAAIIGTLVDGVIFVVRPKH
A0A419GS64      PPNPSEIISSRRFRKFIKNASAAY--DTVIIDTPPVGIVSDAAIISTMVDGTILVLDLKG
A0A538BYZ4      PATHYELLKSPRLGELLGEARHRY--DYVLLDTPPVVVVPDCRVIEKWVDGFLLVVAARK
A0A4R1CW45      SMDSAEAIASGRFDTLVETMRKHTGEAVVIFDLPPVFANDDAVLSTRALDGYIMVVDSGR
A0A4R5Z7B0      PPNPAELLSSKSMEQFIEEAKEQF--DYVLFDTPPLLAVADPQILANKVDASVFVVFSGK
A0A2V2CXY5      IANPTILLEGTRFSHMIESCAKTF--SYVLVDTPPLGSVADALNVAPHCDGTVLVVRSGA
A0A2S8MDM2      PPNPSELLGSQSARRLLSELRSQY--DYVVVDSTPLLAVTDAAIMAAGADGVLVIARHGS
A0A357ZDL3      IPNPVDILSSNRFKALVKTLREGF--DYVVFDSPPLGPFVDAAIVGALVDGVVMVVRPRH
A0A4Y8ZIU8      PPNPSEQLGSARMRDLLTALAE-T--HMVLVDAPPVLPVTDSTLLSTAVDGTVLVVRHGK
A0A0F0KYJ9      PPNPSEVLGSARMRELLKSIAR-E--AIVIVDAPPLVPVTDAAVLAHSADGAIIVGTVGK
A0A510HHA8      PPNPAELLSSNRFSALVEEARETF--DYVLIDSPPVEPVADPLILATQADGVLVVLDGQR
A0A538BBM6      VSNPTELLGAGRTARLLGALAEQA--DLVLVDTAPVLPVADTLVVGRFAAGALLVIEARA
A0A1I6GVG4      PPNPSEVLGSARMRELLKSIAR-E--AIVIIDAPPLIPVTDAAVLAHSADGAIIVGTVGK
A0A1I6IST1      PPNPSEVLGSARMRELLKSIAR-E--AIVIIDAPPLIPVTDAAVLAHSADGAIIVGTVGK
A0A412JBM5      PPNPSELLSSTRMKRFLEASRKAY--DYVIVDTAPINTVADAQILSPLVDGVILVALSQK
A0A1C2B334      PPNPAELLGSSRARELFDTLAASY--DYVIVDTPPILPVSDGAVVSQWVPNAILVVRADS
R7Y679          PPNPAELLGSRRTGQLLDELCELY--DYVLVDSPPVLPVTDAVVVSQWVDGGIIVVRAGG
A0A5Q2F9A3      PPNPAELLGSISMVRLLECATHEY--DAVVIDAPPLLPVTDAAILSGMTTGALLVVGSGE
A0A0K8Q3D9      PPNPSELLGSRAMKNMLQALAQ-N--ATVLIDAPPLLPVTDAAVLSRIADGAIVVIRAGK
A0A2R7RCA1      PPNPSELLGSQAMKNMLNALAE-N--AIVLIDAPPLLPVTDAAVLSRAADGAIVVIRTGR
A0A023X491      PPNPAELLGSERFGALLGDLARRF--EYVLIDVPPVQVVSDAAIVAAQADGVILVFDAQS
A0A4R1BMZ2      PPNPAELLSSQRFAEFVARVRAEF--DYVLIDAPPVGLVSDPVVISTQGDGVMLVLDAHS
A0A1Q7WJN6      RHRGPELLSSAAMPRLVASLRPHY--EAIIVDTPPLVAGVDAFVLGTVTGALVLVLRAGM
A0A1E2SNF6      PPNPSELLGSRTMRELLAALSE-L--AVVIVDAPPLLPVTDAAVLSKSVDGVLLVVNAKR
Q6ADE8          PPNPSELLGSRTMRELLAALSE-L--AVVIVDAPPLLPVTDAAVLSKSVDGVLLVVNAKR
A0A1Q7CZ24      TVAPYELLKSPRLEALLDEARQRY--DYIVLDTPPFVPVPDCRVITKSVDGFLVVVTVHR
A0A2W6VLC6      PPNPSELLSSPRMKQLIAQLSLAY--DVVIIDAPPLLPVSDAAVLAKQTRGALVLVGAGR
A0A519G798      PPNPTEVLQSRAAQELFDRVSQMF--DMVIIDGPPLLPVSDAAIMARDVDGAILVVRHGK
A0A519GXS6      APNPAELLASQRMRVLLEGLREEY--DLVVVDTAPVLSVSDATVISQYVDATVIVVNTRR
A0A520EHH5      PPNPSELLGSSTAQSLLRDLGRAF--DYVVVDSPPLLPVTDAATLATQCDGTILVTRYGD
                                            :..*  *     :                   

A0A348NU28      TRRNQLIQAAASLESAGGRIVGLVLNKVR-RK---------------RKESAYYTANTDA
A0A2N4T4Q5      TTVDELGKALGNIEHVRGRVLGVVLNHVP-TT---------------GADAGFYGYYGKS
A0A1M3LEY6      THRGQVHGSVEALQNVGAHVAGVVLTMLP-TR-----------------GPDAYGYGRYG
A0A538AJI7      LAR-SVNEAVVAIEALQAPLMGIVANRFK-ES-----------------SVPYYY-----
A0A538AM15      TPR-RLVEEALNVVE-RGKMLGLVFNGGD-HA-----------------PASFYGYYGY-
A0A022KX11      TKKRDLAAALKQLETVGAHVSGFARNFVA-SK---------------GSDYRYGYHR---
A0A255G8R8      VKKPQLAESLAALGTVDVKVQGVVLNMVR-RK---------------ERGDAYGYYA---
A0A4Y5YMQ6      TTRAQLERCLAALRGVGANLAGLVLNNVR-EQ---------------KKEK----YL---
A0A4Q5A868      TLKRDLREISEELATLDLSANGVIFNCAR-ES---------------KKSLEYSNYY---
A0A0W8I9Y2      TTTDELSKALENLHQVHGNVLGVVLNRVP-TT---------------GADAGYYGYYGKS
A0A345NSU7      TRKRHVSEAMRVLETTGTHVAGFVLTKAP-AQ-----------------PSAYYSYYGGE
A0A4Q5APW3      TLKRDLREISEELTTLDLSANGVIFNCAR-ES-------------KKSLEHSNYYYYYSD
A0A4Q5B0V3      TLKRDLREISEELTTLDLSANGVIFNCAR-ES-------------KKSLEHGNYYYYYSD
A0A222TG79      SRRPDLESMLSHLGRANAAVVGVVLGDAQ-SR------------------AGYYANSYAL
A0A1Q2CRV2      VRRPELTASLEVLERVEARVLGLVFNRVK-RS---------------EGEAYGYRHSYYS
A0A2S5WZJ5      TRREDASAARDMIDQVNGRLLGTVLNMVP-PR----------------DTADGYEYRRNR
K6WHS4          SAKHELSDTTRQMDTAGVHAMGVVINGTP-VR----------------QSPYRFRY----
A0A1L2ZMQ6      PTIDELAKATENLDRVGANKLGVILNQVP-TRG---------------AEASRYGYYGKY
A0A3L7ADK2      TTYEQFGRAQQLIKRGGAHLLGTVLNRVP-TSG---------------QDAHQYGYYGGT
A0A0G3V3M7      TRRGGVVAASDLLRRLEATTVGVVLVGAE-HGA--------RAGYYGYYGYYGYGYGYAH
A0A3E2DN22      THRDQVSLVAKRLEQVGAPLLGSVLTRVP-RKK--------MGDVLYGYGAANYGYGSYY
A0A3Q9ULZ9      THKEQVTLCTKRLEQVGAVLLGSVLTRAP-RKA--------MGDVLYGYGAGSFGYSSYN
A0A3S9JFL2      THKEQVTLCTKRLEQVGAVLLGSVLTRAP-KKA--------MGDVLYGYGAGSFGYSSYN
A0A1Q2CI19      LSAASAQRTKEMLARFNIPVVGAVIVGAP-LRK----------------GDIGYGSGYGY
A0A512T3M3      LSETSGNRVSELLGRFRVPVSGVLLIGTS-RSR----------------GH-GYGYGYGY
W6JTW4          ITHAAGSRLAELLGRFKVPVSGVLLIGSK-ASR----------------SR-SYGYGYGY
A0A0A0JTY0      LTEVAGNRVAELVGRFQVPVSGVLIVGAP-TKR----------------AD-AYGYGYGD
A0A0A0JXF2      LTEPDGNRVAELVGRFQVPVSGVILVGAK-ARR----------------GD-AYGYGYGE
E6S8H2          LTEVAGHRVSELLGRFQVPVAGVVVVGAQ-SKR----------------SA-GYGYGYGY
A0A0A0JGH0      LTDVAARRVAELLGRFQVPISGVVLVGAR-GRR----------------AD-GYGHSYGY
N0E4U7          LTDVAAHRVAELLGRFQVPISGVVLVGAR-GRR----------------AD-GYGYGYGH
A0A0A0IYK2      LTELAGNRVAELVGRFQVPVSGVILLGAP-EKR----------------AD-AYGYGYGE
A0A0Q9L0H3      LTEVSGNRVAELVGRFQVPVSGVIIVGAQ-TMR----------------AD-AYGYGYGE
A3TMK0          LTEVAGNRVAELVGRFQVPVSGVIIVGAK-AKL----------------GD-TYGYGYGD
A0A543PXP1      ITEVAGRRVSELLGRFNVPVSGVLIVGVR-TE--------------------RSTYGYGR
A3TMH6          ITDVAGRRVAELLGRFHVPVTGVVIVGAP-TRG----------------AG-RYGYGYGS
A0A5R8VLL6      TTKEQLTKSLGNIRKVNATILGTLLNCVP-AKE-----------------FEGYSYYSPE
A0A1H6WL79      TTRDTLYRALSNLTRVQGRVLGVILNCVA-TKG---------------QGDLNYGYYGAY
A0A101LAM5      TTRDTLYRALGNLTRVRGRVLGVILNCVA-TKG---------------PGDLNYGYYGAY
A0A4Y3NEG0      TTRDTLFRALGNLTRVRGRVLGVILNCVA-TNG---------------PGDVNYGYYGAY
A0A1H6YPK1      TSADMLEEALRILDRVQGRALGVILDGVA-PVG-------------PRVKHYGYGNTSPG
A0A2R7MGI0      TTDDMLTRAIENISKTRGRLLGIVLNRVP-LRG-----------PDSSYYGARYGGHYGY
A0A2T7WQY4      TTDDMLTRAVDNLSKTRGRLLGIVLNRAP-LRG-----------PDSSYYGARYGGAYGY
A0A1G6GTN3      TTDDMLTRATENIAKTRGHLLGVVLNRMP-VRG-----------VDSGYYGAQYGGYYGY
A0A1N7DLV3      TTDDMLQRAVGNIAKTRGRLLGVVLNRVP-LRG-----------ADSNYYGSQYGGYYGY
A0A1V2NSB5      TTDDMLQRAVGNIAKTRGRLLGVVLNRVP-LRG-----------ADSNYYGSQYGGYYGY
A0A0Q5Q5L3      TTDDMLTRATANIAKTRGHLLGVVLNRAP-LRG-----------ADSGYYGMQYGGYYGY
A0A0Q6DVM4      TTDDMLTRATANIAKTRGHLLGVVLNRAP-LRG-----------ADSGYYGMQYGGYYGY
A0A1R3WWR6      TTDDMLSRATENISKTRGHLLGVVLNRAP-LRG-----------VDSTYYGGRYGGYYGY
A0A5Q2FA83      TLKRDLAQAVKQLRTVDAKVAGFALNRMP-NDD----------------SASRYGGYYAY
A0A542FTE6      STQDQLQRAVGAVHRVGGKILGVVLNRVP-ERG----------------ADAQYYGYYGQ
A0A2S5UYV0      TRREDVGAARDMLSQVHGRLLGTVLNMVP-PRD----------------TADGYEYRRNR
A0A2S5X9U6      TRREDVSAARDMLKQVHSRMLGTVLNMVP-PRD----------------TADGYEYRRNR
A0A2S5ULV5      TRREDVMAARDMLKQVHSRMLGTVLNMVP-PRD----------------SADGYEYRRNR
A0A653YMF0      TRREDVAAARDMLKQVHSRMLGTVLNMVP-PRD----------------SADGYEYRRNR
A0A4V1VGV9      THREQVGLCAKILEQVGAHYYGSILNMTP-PKQMGSTIYG---YGAGNYGGATYGYGYGS
A0A3Q9IY80      TTFEALTKALQNLERAGSRALGVVLNRVP-RK-----------------GRGGY-HDYRY
A0A0F0LP73      TRKTEVVEARTQLAQIRARILGVVLNFVA-MRN----------------SANGYGY-YRK
A0A1F1X071      TRTAAMQKAVEAIRAVNGTVYGAVLNRAS-TGRLNRLAYGDAVYGYSAYGKYGYGALGGY
A0A3R8RWC7      TRTAAMQKAVEAIRAVNGTAYGAVLNRAS-TGRLNRLAYGDAVYGYSAYGKYGYGALGGY
A0A4U0RJZ4      THKEQIALCTKILDQVGAHYFGSILNMTP-PRSMGSTVYG---YGAGNYATAGYGYGYGY
A0A4R1FGL9      THKEQIALCTKILDQVGAHYFGSILNMTP-PRSMGSTVYG---YGAGNYATAGYGYGYGY
E3B8H1          THKEQIALCTKILDQVGAHYFGSILNMTP-PRSMGSTVYG---YGAGNYATAGYGYGYGY
A0A0Q5AWK6      TRRPEVTAARRILAQVRGRVLGTVLNMVT-AQD----------------GDTGY-YYYDR
A0A3N1NLD3      TRRPEVTAARRIVQQVRGRVLGTVLNMVS-AQD----------------GDAGYSYYYDR
A0A3N2FVI8      TRRPEVTAARRIVQQVRGRVLGTVLNMVS-AQD----------------GDAGYSYYYDR
A0A2S5XDQ6      THRPEVVAARRIVQQVRARVLGTVLNMVT-ARD----------------GDTGY-YYYDR
A0A2S5XNN6      TRRPEVVAARRIVQQVRARVLGTVLNMVT-ARD----------------GDTGY-YYYDR
A0A538JQF8      TTNDAAFRMGELLVRMGARVLGVVLVGVP-TS----------------------------
A0A0Q5JKD6      TTDDMLTRATDNIAKTRGHLLGVVLNRMP-LRG-----------ADSGYYGSQYGGYYGY
A0A0Q9TBP0      SRRRQLVAVRETLRQVSVESVGIVYNGVG-DS-------------ARATYSY--------
A0A346XTB0      TPFSELQKVKERLKFVSTPLLGYVFNRSD-SST-----------AGAYGYGYGVAEDDDG
A0A2W6DK08      TTSEEARRASELLARTRAPAIGVALVGVK-GR----------------------------
A0A2S0LQ32      TYKEQARLTGKILGQVDARLLGVVLNRAS-RRS-----------MGSVYYGYGYGSYGHH
A0A2N6V1R5      TYKEQARLCGKIFKQVDGRLLGVVLNRAS-RRN-----------LGSVYYGYGYGGYGQN
G9PHS6          TYKEQARLCGKIFKQVDGRLLGVVLNRAS-RRN-----------LGSVYYGYGYGGYGQN
U1PLM7          TYKEQARLCGKIFKQVDGRLLGVVLNRAS-RRN-----------LGSVYYGYGYGGYGQN
A0A351ETF8      TKRSDLAEAAKLLATNGSRSLGVVVNRDQ-ES-------------PDKYSYYGQY-----
A0A349B7N2      TSRQSADRMSELLARLSAKVVGVVL------------------------VGSGDTPATKR
A0A346Y185      TSMKLLEEMRERLDRIGTPVLGYIYTKAK-LD-------------GAGYGDYAYRY-GYS
A0A259S8H9      TRRVEIVEARTQLEQVRARVLGVVLNLVS-LR-------------GGD-NGYGYYRKNSR
A0A0Q5L115      TTFDQLDRALQLVTRGGGDVLGVVLNRVP-TK-------------GRDAREYGYF--GGS
A0A2W1Z497      TTIDQLGRALQLVARGGGTVLGAVLNRVP-TR-------------GQDARDYGYY--GGA
A0A3L8NYD3      TYKEQARLAAKVLQQVGGHVLGSVLNRAP-LGG---------------IGGVVYGYGHAT
A0A1M6K628      TLREQIALATRNLDNVDAALLGFVMNQVP-KKD---------------LGAAAFGYGYSG
A0A561E8R3      TRAEHIRLCARILTQVGGRLFGGVMNLTP-PKN---------------MGSAVYGYGYSG
A0A1H4I042      TRRDQLKNATDALQNVGAALLGSVFVMTP-PR-------------------------SRS
A0A4R7A6D9      TRRDQLKNATDALQNVGAALLGSVFVMTP-PR-------------------------SRS
A0A4Q4D4T1      TGHDQVRAASERITTVGGRLLGTIISMSP-KK---------------ETARYGYGYGYDD
A0A261FE22      GRKKVLRDVAHEFKVSRVKISGVAFNRVA-HE---------------RSRKGNYYYYEES
A0A5C8C085      TLDNELEASLEHIKAVNGTTLGIVFNGVA-AR---------------DAYTSAYYYSQDA
A0A1E4BP96      TTHEMLQRSLENIAKVNGRLLGVVLNKAT-RR-----------------GRPDYGYAYGS
A0A101KZQ4      TTYDELESALNNLQRVNAHALGLILNGVP-LK---------------GAQASNYGY----
A0A439DNZ6      TKREQLAHAVGNLRSVGAPILGAVFTITP-TR---------------GGASDNYSYYGYS
A0A0J6YE86      TKREQLAHAVGSLESVGAPLLGAVFTMVP-TR---------------GTGSYSYNYGYYG
A0A5Q5BFU2      TTHEQLTHAVGSLESVGAALLGAVFTMIP-TR---------------NNASYSYGYYGYG
A0A151BT98      VSRRELQITLKALETVDANLSGTVLNYAD-HF------------------SDDYGYGSKY
A0A2Y8ZRF8      VSRRELQVTLKALETVDANLSGTVLNYAD-SF------------------SDDYGYGHKY
A0A2R9UAT1      TTIDVLKKAMNNLERAGGRALGVVLNRVP-RS-----------------GGGYYDYRYTG
A0A4Q5J5D7      TVDTELRDALANLDAVRGRALGVILNRVA-RR---------------DAAAGYYGGTYEL
A0A1Y4CKD6      VGRHNVQDALSMLDGERASVLGYVLNGCP-QTA-----------GSYGYGYGRYGY-GKY
A0A0Q7KBQ4      TTREQLRLAVARIETVGGKLFGTILNRTP-RR---------------AGDVYGYGYGYGY
A0A1F1IHY9      TTYDEFSKAVSSIRKIDGEVLGAVLNRVP-AS---------------GTAASAYQYYGAT
A0A542HCT5      TLDTQLRDALANLAAVNGHTLGVVLNRVS-PK---------------SSSAGYYS-----
A0A2S8WHZ8      TTGDELGKAIENLKKVDANILGAILNQVP-TK---------------GAGAAQYGY----
A0A537WNY9      ATRRQLRTAIERLSVISVRPTAVVLNDAP-I--------------------------GDS
A0A5B8M469      TRKAEVTAARRLLEQAKSRLLGVVLNKVP-VN---------------DRDGGYSYYHNNR
A0A1Y4CTD2      TDVRVINDTVDVAWKSAGDFSGFVLNAFQ-GE---------------------WSLTHGR
A0A0Q5M6Z7      VTGEQLEKAYRSVVRVNGKVLGVVLNKIP-PR---------------GIDSHDYGYYRSN
A0A3N3ZPU0      TNLDDLTKAVARLHTVGATILGAVLNQVP-RK---------------GSGANEYGYYSDA
A0A359IQX7      TYKEQLRVCARILKQVNGRLLGSVMNLAP-LR---------------GIGAVVYGY-GYG
A0A4R8TXC3      SHREQMTEATNNLNKVNANLFGLVLNRAP-RK---------------GLGNSYYGFGYAN
A0A433EDP2      SHREQMTEATNNLNKVNANLFGLVLNRAP-RK---------------GLGNSYYGFGYAN
A0A231VTW0      SHREQMTEATNNLNKVNANLFGLVLNRAP-RK---------------GLGNSYYGFGYAN
A0A433ECD0      SHREQMTEATNNLNKVNANLFGLVLNRAP-RK---------------GLGNSYYGFGYAN
U7V3Z1          SHREQMTEATNNLNKVNANLFGLVLNRAP-RK---------------GLGNSYYGFGYAN
A0A1F1J417      SHREQMTEAVAVLERVNSHLFGVVLNKAP-RK---------------GLGNSYYGFGYAN
A0A2A8D6P2      SHREQMTEAVAVLERVNSHLFGVVLNKAP-RK---------------GLGNSYYGFGYAN
A0A1F0THV9      SHREQMTEAVAVLERVNSHLFGVVLNKAP-RK---------------GLGNSYYGFGYAN
A0A5F0M6Y0      SHREQMTEAVAVLERVNSHLFGVVLNKAP-RK---------------GLGNSYYGFGYAN
D8USQ4          SHREQMTEAVAVLERVNSHLFGVVLNKAP-RK---------------GLGNSYYGFGYAN
E3H5W1          SHREQMTEAVAVLERVNSHLFGVVLNKAP-RK---------------GLGNSYYGFGYAN
A0A1F1QKB0      SHREQMTEAVAVLERVNSHLFGVVLNKAP-RK---------------GLGNSYYGFGYAN
A0A509JY23      SHREQMTEAVAVLERVNSHLFGVVLNKAP-RK---------------GLGNSYYGFGYAN
A0A448USF4      SHREQMTEAVAVLERVNSHLFGVVLNKAP-RK---------------GLGNSYYGFGYAN
A0A0Q9LZR0      TLDTQLRDALANLATVNGHTLGVVLNRVS-PK---------------SSSAGYYSG----
A0A1N7E3F1      TRNEQVLRAGELLSSINARLVGTVLNFVP-AK---------------HGSY--YGYGYGY
A0A544ZKQ1      TRREQVLRAGELLSSINARLVGTVLNFVP-AK---------------HGSYYGYGYGYGY
A0A372P1T1      TRREQVLRAAELLSSINARLVGTVLNFVP-AK---------------HGSYYGYGYGYGY
A0A5D0Q2X0      TRREQVLRAGELLSSINARLVGTVLNFVP-AK---------------HGSY--YGYGYGY
A0A5R8Z2E7      TRREQVLRAGELLSSINARLVGTVLNFVP-AK---------------HGSY--YGYGYGY
A0A1L2ZMV4      TSIEALKKATDRLDRVNGHVLGVVLNQVP-RK---------------GSSAGQYGYYSDS
A0A1S1CAD0      SHREQMTEASNILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
G5ET14          SHREQMTEASNILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1E9DXX2      SHREQMTEASNILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1E8S156      SHREQMTEASNILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1E8S5S2      SHREQMTEASNILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1S1DFA8      SHREQMTEASNILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A2I1Z490      SHREQMTEASSILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1F0DAA9      SHREQMTEAASILKKVNANLFGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1F0PHK9      SHREQMTEAASILKKVNANLFGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1F0VZG6      SHREQMTEAASILKKVNANLFGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1E9G8X4      SHREQMTEAANILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1E9IAW2      SHREQMTEAANILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1E9ZBC9      SHREQMTEAANILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1E9ZDP4      SHREQMTEAANILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1F0R6B5      SHREQMTEAANILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1F0Z7N5      SHREQMTEAANILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1F1D897      SHREQMTEAANILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
D2NP38          SHREQMTEAANILKKVNANLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1F1FV74      SHREQMTEASSILKKVNANLFGLVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1E9M791      SHREQMTEASSILKKVNANLFGLVLNRAP-RK---------------GLGNSYYGFGYAS
A0A291DEI8      SHREQMTEASSILKKVNANLFGLVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1S1D5T1      SHREQMTEAASTLKKVNANLFGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1E8TRD6      SHREQMTEAASTLKKVNANLFGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1F0XT88      SHREQMTEAASTLKKVNANLFGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1F1EVP5      SHREQMTEAASTLKKVNANLFGMVLNRAP-RK---------------GLGNSYYGFGYAS
C6R548          SHREQMTEAASTLKKVNANLFGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A0K2RXS2      SHREQMTEAASILKKVNAKLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A1F0KX60      SHREQMTEAASILKKVNAKLLGMVLNRAP-RK---------------GLGNSYYGFGYAS
A0A542I3V2      TTRDEFERSLRALQKVQAPVLGAIFNCVP-TK---------------GVD-------SYA
A0A2T0UZ65      THKDQVEACAKMIQQVGGRILGIVLNMAP-KR---------------GMGSVMYGD-GYS
A0A1R4JTI6      TTRDELAKSLGNLEKVNGDVLGTVLNRVP-TR---------------GKEAGYYGYYGKS
A0A4R7TM52      TTVERLQKAIQNLDRAGARCLGVVINRVP-VR---------------GRGKGYDEYRYSG
A0A542XE74      THRAALEQSTKLLDQTKARLLGVVLNAAS-KR---------------SLTDSAYSYTGYT
A0A0G3V3F3      SKQQQVRQALEELQRAGANVVGVVVNRTE-VV---------------NRSAYYEA-----
A0A0Q7QDF6      TGHDQVRAASERITTVGGRLLGTIISMSP-KK---------------ETARYGYGY-GYD
A0A3S0V9U6      TRRDQAEGAKAMIDKVQGNVLGAVMNMAP-AK---------------GIGSQYYGF-GYG
A0A2R7Z032      TYIEQSEHCRRILDQVGSRLLGIVLNKAP-LK---------------GVGAIAYGD-GYG
A0A1I0W453      TQIEQSQSCRRILDQVGSRLLGVVLNKAP-VK---------------GASAIAYGG-GYG
A0A1H4LCS9      TQIEQSQHCRRILDQVGGRLLGVVLNKAP-IK---------------GAAAIAYGG-GYG
A0A4Q2RZP8      TQIEQSQHCRRILDQVGSRLLGVVLNKAP-VK---------------GAAAIAYGG-GYG
A0A0Q6VV12      TQIEQSQQCRRILDQVGSRLLGVVLNKAP-VK---------------GASAIAYGG-GYS
A0A495NTA9      TQIEQSQHCRRILDQVGSRLLGVVLNKAP-VK---------------GATAIAY-G-GYG
A0A0Q9QB08      TQIEQSQQCRRILDQVGSRLLGVVLNKAP-VK---------------GAASIAYGG-GYG
A0A4Q2SA86      TQIEQSQHCRRILDQVGSRLLGVVLNKAP-VK---------------GAAAIAYGG-G--
A0A4Z1C3Z0      TQIEQSQHCRRILDQVGSRLLGVVLNKAP-VK---------------GAAAIAYGG-G--
A0A5R8L819      TTYDLLKRALANIEKVGGRALGVVLNRVP-KR---------------GGGYYGGHY-GRE
A0A261FQA1      AQKKTLKASAEEFELVGVKPAGAVVDMVK-EQ---------------RGKGD---Y-YYS
A0A1Q2CJ92      TRREQLEVAAHKLRQVDGNLLGVVLNKVA-KK---------------DLGEATFGY-GYG
A0A2T0S3C8      TTSSQIQTAARALQSVDARLLGCVFNMVS-AK---------------GPEG----Y-YYE
A0A4Y8WZJ3      TTYDEFSKAVSSIRKIDGEVLGAVLNRVP-AS---------------GTAASAYQY-YGA
A0A285VUW0      TRRRHLQEALRTLEAAEAEVSGFVLTKTP-AE---------------RSGSYNYQY-YGR
A0A4Q2JUT1      TTYDLLEKALDTLRKARGRALGIVLNKAP-IR---------------GADAATYSY-EYR
A0A542J310      TTYDLLDKALDTLRKARGRALGVVLNKVP-MR---------------GTDSATYSY-EYR
A0A444BL03      THKEQAELAARMMGQVGGRVLGVVLNMAP-KR---------------RAGGVMYGY-GYG
A0A4Y8X357      TRKEHVEVARDMLARVHARVLGVVLNGVP-AS---------------GVGSD---Y-YGG
R4LD52          TTTAQVSNAVTALQSVDARLLGCVLNMVA-AK---------------GPDAY---H-YYD
A0A4T2CD79      TTTDELERALAGISMGGGRTLGVVLNRVP-TK---------------GAGGRGYGY-YHG
A0A4Q4D742      TTREQLRLAVERVETVGGQLFGCVLNRTP-RR---------------ASDDA---Y-GYG
A0A4Q2RU39      THIEQSQHCRRILDQVGSRLLGVVLNKAP-VK---------------GANAIVYG----G
A0A4Q2SK58      TQIEQSQHCRRILDQVGSRLLGVVLNKAP-IK---------------GANAIVYGG-GYG
A0A2N3YJR1      THREQARLAARMMGQVGGRVLGVVLNLAP-KG---------------RAGAVMYGY-GYG
A0A1C6T1J1      TSRTQVAAAARALHAVSVRLLGCVLNMAK-VP---------------KA-DA---Y-QYE
A0A2W2CFC8      TARTQVAAAARALNAVSVRLLGCVLNMAK-LA---------------KA-EA---Y-QYE
A0A2W2A4B0      VRRAEVSSSIESLATVGASVQGVVVTMAR-SR---------------GARDA---Y-AVY
A0A4Y9MDA5      VRRAQLTEALRSLAQVEAGVQGVVLNQVH-RE---------------A--DV---Y-GYA
A0A1H7N9P7      VRRAQLSQSLHSLAQVQATVLGVVLNQVR-RE---------------A--EV---Y-GYA
A0A1M7V0F8      VRRPQLTETLRSLAQVGGTVLGVVLNQVR-RD---------------E--DV---Y-GYA
A0A1V8PLV6      TMKRDLKEIAVQLDNLNVPVMGFVFNFAKERK---------------VSANGNYYYYYDE
A0A4R0U4F1      TEKKLLRQTGRELSTLSIDPVGLAMNYGE-TE---------------KPQKGGYYY----
A0A357ZCV8      TKRKEMAFAYDQLGKADVHILGACANYRE-SV---------------ASESY--------
A0A419GS64      GHRNMSVRAKKTLEKVNANILGLVMNNLKIDK---------------DARPYQY------
A0A538BYZ4      TPRKLLEEALTVMDP--AKILGLVFNGED-RP---------------LSLYYGGAEYYGE
A0A4R1CW45      TSRRQLADAMEMLNPVPC--LGTVLNRYA-GG---------------MLDSYGYGSAN--
A0A4R5Z7B0      TEIDQAKKAKELLENAQSKLVGVVLNHKE-VK---------------SNDYYYY------
A0A2V2CXY5      TPRKLVDNSVQLLKRTETPLLGIVLNRAD-MN---------------SKSNMYYHRYYRS
A0A2S8MDM2      TKKDQLTHAVSSLHSVGAPVLGAVFTMMP-TR---------------GSSSYGYSYSY--
A0A357ZDL3      TKRKDLLFAYDQLKKSESRILGACASYND-RA---------------SADSYYAYYTV--
A0A4Y8ZIU8      ARKEHVEVARDMLAGVNARVLGVVLNGTP-AS---------------GVGSDYYG-----
A0A0F0KYJ9      TTYEVLGKAIGNLERAGARALGLVLNKVP-RR---------------GSGAAYYGYQY--
A0A510HHA8      TRKGSLRKALHDLRSVKANVLGTVMNNFD-GG---------------RGG----------
A0A538BBM6      TPVPSISRAKDALTRNQTRILGLVLNRLK-AQ---------------DSG-YSYGY----
A0A1I6GVG4      TTFEVLGKAIGNLERAGARALGLVLNKVP-RR---------------GSGAAYYGYQY--
A0A1I6IST1      TTFEVLGKAIGNLERAGARALGLVLNKVP-RR---------------GSGAAYYGYQY--
A0A412JBM5      STRGELNAAIDSVSRAGGNLCGVVINGMD-MK---------------ATK-YSYRYKYED
A0A1C2B334      TKRPELAAAWQQWKATNVRLVGVVVNDAS-DR---------------AGA-YHNTY----
R7Y679          TTRQELVASLAQLHASRVSILGVVLNGVN-LK---------------ARD-NRYGY----
A0A5Q2F9A3      VRAPQLAAALESLESVEGRLLGIVLNKLR-GK---------------DVGYSAYRN----
A0A0K8Q3D9      TTQVELENSLGNLQKVRGRVLGAVLNYVP-TK---------------GTDAYAY------
A0A2R7RCA1      TTQEQLAQSLGNLDKVKGRILGAVLNYVP-TK---------------GTDAYSY------
A0A023X491      TRKLSVRRSIRTIESVGAKVLGTVMNNAR-PA---------------RNG----TY----
A0A4R1BMZ2      TGKGALRKSLHSLEAVGANIIGTVMNNVR-GG---------------KGGYYRYGY----
A0A1Q7WJN6      SDRDVATAKLDVLDRLPVRLLGAVVNDVR-S-----------------------------
A0A1E2SNF6      TKIDQLGKALRTLDQAAGKLTGVVLNRVP-RR---------------GADAVNYGY----
Q6ADE8          TKIDQLGKALRTLDQAAGKLTGVVLNRVP-RR---------------GADAVNYGY----
A0A1Q7CZ24      TPWGVLTEALDLIDP--AKVVGLVVNGDD-TR---------------RSSYYDVY-----
A0A2W6VLC6      VTRNQLQESLEGLRAVGATVAGVVLSMAP-TR---------------GPDAYGYG-----
A0A519G798      TTKEQLKQATMRLEQVDANLLGVMVNMTP-KR---------------GGKGYGYG-----
A0A519GXS6      TGKAKIEQAVAALQSVRANLAGIVLNNVA-VS-----------------RRDSYYYTSDR
A0A520EHH5      TRREELTRAAANLENVGASLLGVVMSMVP-AT---------------GRGRDQYGYDFEP
                                     .                                      

A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      YYASDDS------------------------------------------GGDAPEAPLRP
A0A1M3LEY6      YGAYGYG-----------------------------------------YGYGRTAQAGFS
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      -------------------------------------------------------YGGAP
A0A022KX11      -YEEEMT-----------------------------------------RRARKAARTEPR
A0A255G8R8      -YGSEPG-----------------------------------------RQRSSSAATGRR
A0A4Y5YMQ6      -YTMEP------------------------------------------------------
A0A4Q5A868      YYYSDSN-----------------------------------------KKRSKKGRFSLK
A0A0W8I9Y2      YYANSDD-----------------------------------------QPAPKTGAQPVV
A0A345NSU7      HASTRPD-----------------------------------------GPRKRK------
A0A4Q5APW3      SSKKGRFSLK--------------------------------------------------
A0A4Q5B0V3      SSKKGRFSLK--------------------------------------------------
A0A222TG79      EYGQVGV-----------------------------------------RDSAER------
A0A1Q2CRV2      DHPRAAP-----------------------------------------KKGDRKSKKRRA
A0A2S5WZJ5      SYYVTADRKGMPVMKSIKRGHEQPEAFAVQTDASAAQTPQPTFAAVAPAAAPARESLAPT
K6WHS4          --------------------------YGVNVENNA-------------------DDMSVD
A0A1L2ZMQ6      YSKKETK-----------------------------------------AKAAADLQEPSV
A0A3L7ADK2      YYANEET-----------------------------------------PATTATAQPSDE
A0A0G3V3M7      PGEVPKM-----------------------------------------SRLFPWRKPTNG
A0A3E2DN22      GDYGKRG-----------------------------------------------------
A0A3Q9ULZ9      SYYTDKN-----------------------------------------GKKKRRKKKMSL
A0A3S9JFL2      AYYTDEN-----------------------------------------GKKKRRKKRMSL
A0A1Q2CI19      GYGETKG-----------------------------------------KAKGKR------
A0A512T3M3      GESGRRR-----------------------------------------SEKPVD----H-
W6JTW4          G-SPRST-----------------------------------------SKKPRSGGHGP-
A0A0A0JTY0      DRMSKRK-----------------------------------------AKRARKGARSRQ
A0A0A0JXF2      TRKAKKK-----------------------------------------VKRERKLAEKR-
E6S8H2          GYG-----------------------------------------------------YGD-
A0A0A0JGH0      GDTARPQ-----------------------------------------RDSPSPKMELD-
N0E4U7          GDT-KKR-----------------------------------------KGARSARVEAD-
A0A0A0IYK2      NRQSKRK-----------------------------------------AKRARK-RAQS-
A0A0Q9L0H3      NRQSKKK-----------------------------------------ARRGRK-RQQL-
A3TMK0          ARKTKKK-----------------------------------------VKRGRRLADQR-
A0A543PXP1      GYGYGYG-----------------------------------------VSKQKR-GRSI-
A3TMH6          GYGQGYD-----------------------------------------AERSKGIRRVL-
A0A5R8VLL6      PDSLD-------------------------------------------STSSPEKAAARD
A0A1H6WL79      VSADE-------------------------------------------SRDTIPPRSGMN
A0A101LAM5      GSAED-------------------------------------------LKDHQPPAPSTT
A0A4Y3NEG0      GSAEN-------------------------------------------PQDDTPPVPGTV
A0A1H6YPK1      LSSLGGA-----------------------------------------PAQHDEDDSWEH
A0A2R7MGI0      GESHA-T-----------------------------------------GAEGIKRSTRRG
A0A2T7WQY4      SEPDA-D-----------------------------------------TRKGAKRTRGRD
A0A1G6GTN3      GAERS-------------------------------------------STKAWWRFRRRG
A0A1N7DLV3      GAPSSGV-----------------------------------------DRPRWWRRPWRR
A0A1V2NSB5      GAPGSGA-----------------------------------------ERTRWWRRPWRR
A0A0Q5Q5L3      GIGRT-------------------------------------------EKSTWWRRVLRK
A0A0Q6DVM4      GIGRT-------------------------------------------EKSTWWRRVLRK
A0A1R3WWR6      GAPRG-------------------------------------------TTRSWWRFGRRP
A0A5Q2FA83      GRSKKDK-----------------------------------------SKREAVASRHGS
A0A542FTE6      KAYYTPT-----------------------------------------QRPKVEDDAPPP
A0A2S5UYV0      SYYVTAD-----------------------------------------KKGMPVFKSSKG
A0A2S5X9U6      SYYVTAD-----------------------------------------KKGMPKFKAVKG
A0A2S5ULV5      SYYVTAD-----------------------------------------KKGMPKFKAVKG
A0A653YMF0      SYYVTAD-----------------------------------------KKGMPKFKAVKG
A0A4V1VGV9      SE----D-----------------------------------------PSAATAPTPSPE
A0A3Q9IY80      AGDYYRS-----------------------------------------KGGEDGFDIDLT
A0A0F0LP73      NSHYYAQ-----------------------------------------TSRNDDAAGDDE
A0A1F1X071      DESAVVP-----------------------------------------DAEEVDVEQAGG
A0A3R8RWC7      DESAVVP-----------------------------------------DSEEVDVEQAGG
A0A4U0RJZ4      GYGHTDE-----------------------------------------SDEASALTPAHE
A0A4R1FGL9      GYGHTDE-----------------------------------------SDEASALTPAHE
E3B8H1          GYGHTDE-----------------------------------------SDEASALTPAHE
A0A0Q5AWK6      KNSYYTQ-----------------------------------------PQQAATENAAVG
A0A3N1NLD3      KNPYYAE-----------------------------------------PDGGRSRGRSAG
A0A3N2FVI8      KNPYYAE-----------------------------------------PDGGRSRGRSTG
A0A2S5XDQ6      KNAYYAE-----------------------------------------PQPATGRKR---
A0A2S5XNN6      KNAYYAE-----------------------------------------PQPATGRKR---
A0A538JQF8      ----------------------------------------------RRVRSPYGRPPQYQ
A0A0Q5JKD6      GVPSSSPNGRWRLGL---------------------------------RRRGKKAEVVDA
A0A0Q9TBP0      ------------------------------------------------------------
A0A346XTB0      QRRLLPGSRRRNGGNEGTRG----------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      YYYGERPRGWRRL----LPG-------------------------------GRRHTRHQE
A0A2N6V1R5      YYYYEEDEKRKLLGFIPLPGHRKRKRENQIVSIQEEEVHPLPKDKQSNRRSSRRAARSEA
G9PHS6          YYYYEEDEKRKLLGFIPLPGHRKRKRENQIVSIQEEEVHPLPKDKQSNRRSSRRAARSEA
U1PLM7          YYYYEEDEKRKLLGFIPLPGHRKRKRENQIVSIQEEEVHPLPKDKQS-RRSSRRAARSEA
A0A351ETF8      ------------------------------------------------------------
A0A349B7N2      YYYSK-------------------------------------------------------
A0A346Y185      YAYGYGE-----------------------------------------------------
A0A259S8H9      YYMKSHRAATAEDGDDAVDAFAAMANLSPAPLGDAAATAEAPRDGGATVEEGTFTTSSGP
A0A0Q5L115      YYYYEGD---------------------------------VGTGGAVGAGAGSGTAPA--
A0A2W1Z497      YYAGDDDGSEPAPGTD--------------------GGAEHGTDGDAEARAARGARPSGG
A0A3L8NYD3      HS-QDYY-----------------------------------------SAYDRTGGDRSN
A0A1M6K628      AS-PRYY-----------------------------------------YAEDDGRRRPAA
A0A561E8R3      KKYNGYG-----------------------------------------YGYGDSPAPTPA
A0A1H4I042      AYGGAYY-----------------------------------------YYGDNRGSNSRH
A0A4R7A6D9      AYGGAYY-----------------------------------------YYGDKRGSNSRH
A0A4Q4D4T1      GKGRRRR-----------------------------------------------------
A0A261FE22      ETKAKKS-----------------------------------------SKRSSRKASASA
A0A5C8C085      DPSAKKR-----------------------------------------PKADKEPKPKKG
A0A1E4BP96      GAADTRP-----------------------------------------AFVPR-------
A0A101KZQ4      ---AYKA-----------------------------------------YYRQDTKGRRSA
A0A439DNZ6      YGD---------------------------------------------------GTSNSA
A0A0J6YE86      EDEGRRG-----------------------------------------GNSSTRGGSAES
A0A5Q5BFU2      EEA---T-----------------------------------------GQQARHGLPTET
A0A151BT98      GYGEQEM-----------------------------------------AASGRTRSRRSD
A0A2Y8ZRF8      GYGEQPP-----------------------------------------AARG--QSRRTG
A0A2R9UAT1      DYYQADQ-----------------------------------------TPYDEAVHNPPN
A0A4Q5J5D7      SDKDKVP-----------------------------------------AAVGATDEADAT
A0A1Y4CKD6      GYGSYGD-----------------------------------------GYGGLADEVDEG
A0A0Q7KBQ4      GQEQHEP-----------------------------------------IGEQARRMVGAL
A0A1F1IHY9      YYTASQQ-----------------------------------------QDVAGRS-----
A0A542HCT5      -----GS-----------------------------------------YAALEEHSKQQQ
A0A2S8WHZ8      ----YGK-----------------------------------------YYYSNTEQDPKA
A0A537WNY9      SYYHMGP-----------------------------------------EKTSMPRRGRRS
A0A5B8M469      SYYTRPE-----------------------------------------SGKRRRDAAKKV
A0A1Y4CTD2      GYSAY-------------------------------------------------------
A0A0Q5M6Z7      YYTSNAD-----------------------------------------ESGEAQPVASIE
A0A3N3ZPU0      YYYSSSS-----------------------------------------RH----------
A0A359IQX7      TYTYSSK-----------------------------------------YYRYARDTAQQR
A0A4R8TXC3      SYVGYAT-----------------------------------------YYGYSKDGTKKK
A0A433EDP2      SYVGYAT-----------------------------------------YYGYSKDGTKKK
A0A231VTW0      SYVGYAT-----------------------------------------YYGYSKDGTKKK
A0A433ECD0      SYVGYAT-----------------------------------------YYGYSKDGTKKK
U7V3Z1          SYVGYAT-----------------------------------------YYGYSKDGTKKK
A0A1F1J417      SYVGYAS-----------------------------------------YYGYSKDGKKKV
A0A2A8D6P2      SYVGYAS-----------------------------------------YYGYSKDGKKKV
A0A1F0THV9      SYVGYAS-----------------------------------------YYGYSKDGKKKV
A0A5F0M6Y0      SYVGYAS-----------------------------------------YYGYSKDGKKKV
D8USQ4          SYVGYAS-----------------------------------------YYGYSKDGKKKV
E3H5W1          SYVGYAS-----------------------------------------YYGYSKDGKKKV
A0A1F1QKB0      SYVGYAS-----------------------------------------YYGYSKDGKKKV
A0A509JY23      SYVGYAS-----------------------------------------YYGYSKDGKKKV
A0A448USF4      SYVGYAS-----------------------------------------YYGYSKDGKKKV
A0A0Q9LZR0      ---NYGP-----------------------------------------LQETPQRAVRSE
A0A1N7E3F1      EADPVEQ-----------------------------------------ETSSRTPQPQTP
A0A544ZKQ1      GYDSAAQ-----------------------------------------ETVSETPQPQAP
A0A372P1T1      GYDAAAQ-----------------------------------------EATPETPQPQAP
A0A5D0Q2X0      GYDAAAQ-----------------------------------------EATPETPQPQAP
A0A5R8Z2E7      GYDAAAQ-----------------------------------------EATPETPQPQAP
A0A1L2ZMV4      YYYTSTD-----------------------------------------GQRTRRQSGKRR
A0A1S1CAD0      AYVGYAT-----------------------------------------YYGYGKEGDKKS
G5ET14          AYVGYAT-----------------------------------------YYGYGKEGDKKS
A0A1E9DXX2      AYVGYAT-----------------------------------------YYGYGKEGDKKS
A0A1E8S156      AYVGYAT-----------------------------------------YYGYGKEGDKKS
A0A1E8S5S2      AYVGYAT-----------------------------------------YYGYGKEGDKKS
A0A1S1DFA8      AYVGYAT-----------------------------------------YYGYGKEGDKKS
A0A2I1Z490      AYVGYAT-----------------------------------------YYGYGKEGDKKS
A0A1F0DAA9      AYVGYAT-----------------------------------------YYGYGKEGDKKS
A0A1F0PHK9      AYVGYAT-----------------------------------------YYGYGKEGDKKS
A0A1F0VZG6      AYVGYAT-----------------------------------------YYGYGKEGDKKS
A0A1E9G8X4      AYVGYAT-----------------------------------------YYGYGKDGDKKS
A0A1E9IAW2      AYVGYAT-----------------------------------------YYGYGKDGDKKS
A0A1E9ZBC9      AYVGYAT-----------------------------------------YYGYGKDGDKKS
A0A1E9ZDP4      AYVGYAT-----------------------------------------YYGYGKDGDKKS
A0A1F0R6B5      AYVGYAT-----------------------------------------YYGYGKDGDKKS
A0A1F0Z7N5      AYVGYAT-----------------------------------------YYGYGKDGDKKS
A0A1F1D897      AYVGYAT-----------------------------------------YYGYGKDGDKKS
D2NP38          AYVGYAT-----------------------------------------YYGYGKDGDKKS
A0A1F1FV74      TYVGYAT-----------------------------------------YYGYGKDGDKKS
A0A1E9M791      TYVGYAT-----------------------------------------YYGYGKDGDKKS
A0A291DEI8      TYVGYAT-----------------------------------------YYGYGKDGDKKS
A0A1S1D5T1      SYVGYST-----------------------------------------YYGYGKDGDKKS
A0A1E8TRD6      SYVGYST-----------------------------------------YYGYSKDGDKKS
A0A1F0XT88      SYVGYST-----------------------------------------YYGYSKDGDKKS
A0A1F1EVP5      SYVGYST-----------------------------------------YYGYSKDGDKKS
C6R548          SYVGYST-----------------------------------------YYGYGKDGDKKS
A0A0K2RXS2      AYVGYAT-----------------------------------------YYGYSKDGDKKS
A0A1F0KX60      AYVGYAT-----------------------------------------YYGYGKEGDKKS
A0A542I3V2      YYGAYTA-----------------------------------------APEAASSGSADR
A0A2T0UZ65      TYYSHGS-----------------------------------------YEYYKSGPKKGR
A0A1R4JTI6      YYSSSAT-----------------------------------------PDQDFDVTSRNA
A0A4R7TM52      DYYAAPA-----------------------------------------ATTVPLDSPGAA
A0A542XE74      GYYKDYY-----------------------------------------AAAEPEQQSPER
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      DGKGRRR-----------------------------------------R-----------
A0A3S0V9U6      GYRSEYK-----------------------------------------SYYGRSGQGSES
A0A2R7Z032      -YGGYGA------------------------------------------QAEYASREAYS
A0A1I0W453      GYGGYGG-----------------------------------------YRAEYTSREAYS
A0A1H4LCS9      GYGGYGG-----------------------------------------YKSEYASREAYS
A0A4Q2RZP8      GYGGYGG-----------------------------------------YKAEYASREAYS
A0A0Q6VV12      GYGGYGG-----------------------------------------YRAEEATREAYS
A0A495NTA9      GYGGYGG-----------------------------------------YKAEEETREKYS
A0A0Q9QB08      TYGGYGG-----------------------------------------YEADDTSREADA
A0A4Q2SA86      -YGGYGG-----------------------------------------YQAEYASQEADA
A0A4Z1C3Z0      -YGGYGG-----------------------------------------YQAEYASLEAES
A0A5R8L819      YYASAEV-----------------------------------------QAVSAVPAVTPA
A0A261FQA1      DKAAKHS-----------------------------------------SQGTSEKSHEPT
A0A1Q2CJ92      SYTSKYY-----------------------------------------RTDEAQKPHRRE
A0A2T0S3C8      QYGMTSQ-----------------------------------------HRRGAWRDRMRA
A0A4Y8WZJ3      TYYTASQ-----------------------------------------QQDVAGRS----
A0A285VUW0      ETPVTAG-----------------------------------------ETRGSRRQSGGA
A0A4Q2JUT1      RDYTSSG-----------------------------------------SEGTTEASPETG
A0A542J310      HDYTTPA-----------------------------------------TEVTPAV-----
A0A444BL03      GYASYAS-----------------------------------------------DTKTRK
A0A4Y8X357      GLGSHED-----------------------------------------EYHAYYRAPAES
R4LD52          EYSTRGR---------------------------------------------GSRRAGPV
A0A4T2CD79      SYSEDAP-----------------------------------------VVGALIANGRLT
A0A4Q4D742      YGHGYGY-----------------------------------------------GSALPQ
A0A4Q2RU39      GYGGYGG-----------------------------------------------GYKSEY
A0A4Q2SK58      GYGGYGG-----------------------------------------------GYKSEY
A0A2N3YJR1      GYATYAS-----------------------------------------------DTKSRR
A0A1C6T1J1      AYRVVAG-----------------------------------------------LGTPSV
A0A2W2CFC8      AYQVL---------------------------------------------------SSSL
A0A2W2A4B0      GADVPPE-----------------------------------------------TQRSHR
A0A4Y9MDA5      ADAAAEA-----------------------------------------------RRPLPA
A0A1H7N9P7      ADVVAGT-----------------------------------------------DRPVPT
A0A1M7V0F8      AEAQPPA------------------------------------------------RVGEL
A0A1V8PLV6      ------------------------------------------------GGKKSRKKSKHK
A0A4R0U4F1      ------------------------------------------------YGDESDDNGRKR
A0A357ZCV8      ------------------------------------------------YAYYSADGKRVK
A0A419GS64      ------------------------------------------------------------
A0A538BYZ4      ADGRLAR-----------------------------------------GAGIARWLQWAK
A0A4R1CW45      ------------------------------------------------YDSYYSE-----
A0A4R5Z7B0      ------------------------------------------------YGAK--------
A0A2V2CXY5      SYYYNS------------------------------------------YGSRSQKQK---
A0A2S8MDM2      ------------------------------------------------YGTETPRHAPP-
A0A357ZDL3      ------------------------------------------------TGHRVRDKYNED
A0A4Y8ZIU8      ------------------------------------------------GGYASKGDDYHA
A0A0F0KYJ9      ------------------------------------------------HGDYYRNDGQEL
A0A510HHA8      ------------------------------------------------YAYHQGYTR---
A0A538BBM6      ------------------------------------------------YGYGEPEPNGER
A0A1I6GVG4      ------------------------------------------------HGDYYRSDEQEL
A0A1I6IST1      ------------------------------------------------HGDYYRSDEQEL
A0A412JBM5      KYGGAKD-----------------------------------------YGYGYGYGYGNS
A0A1C2B334      ------------------------------------------------YGDTDTPRMASQ
R7Y679          ------------------------------------------------YAQASREGVTA-
A0A5Q2F9A3      ------------------------------------------------RSGQGPEPRRVA
A0A0K8Q3D9      ------------------------------------------------HGTYTS------
A0A2R7RCA1      ------------------------------------------------YGTYTS------
A0A023X491      ------------------------------------------------GGYTYSYGEAAG
A0A4R1BMZ2      ------------------------------------------------GGYTYK------
A0A1Q7WJN6      ------------------------------------------------GGDYRQYSYYLA
A0A1E2SNF6      ------------------------------------------------YGAKYGYGYYHD
Q6ADE8          ------------------------------------------------YGAKYGYGYYHD
A0A1Q7CZ24      ------------------------------------------------AGSSRG------
A0A2W6VLC6      ------------------------------------------------YGSYGTYS----
A0A519G798      ------------------------------------------------YGYGYGYG----
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      GRVPTPP-----------------------------------------TQSAPVRTNRH-
                                                                            

A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      AKEVPDAGTAAPASRAPDTGSTAALETESPADAAVSDLPADESERFDLAAWQRPGKGTHR
A0A1M3LEY6      QIISPAESPGRRQSSAVPPSGPARTTAQARQESV--------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      QTAQTSPNGHDRGRLGRTVARVGHMLQRRRRGGR--------------------------
A0A022KX11      AKQRARG-----------------------------------------------------
A0A255G8R8      AAPSGQRPDDLVLTPRQARE----------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A0W8I9Y2      AAPAAKQPWGTAPRAESSDAHQPAGASTRQEPTVPSAED----AAPAPRAERSNGQGSAE
A0A345NSU7      -----RRQGKRDKRMSKSRPHAEAAASARAERAVDGGEALEFRSRARQRLDRRNGSG---
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A1Q2CRV2      RAEVAA------------------------------------------------------
A0A2S5WZJ5      RPSASSAPRATPAASQPTPPPQTPGSELPSRRSRRGA-----------------------
K6WHS4          KVGTSSAS----------------------------------------------------
A0A1L2ZMQ6      TDNPPTEQIQTPASVASRSRHNEG----------------------------------TR
A0A3L7ADK2      STVVEGDSATPIAAATPLAAPEEATSRRTVRRSGH-------------------------
A0A0G3V3M7      AGTVRRKPDPEQVGVSASNQGANSSSEAFDDPSF--------------------------
A0A3E2DN22      -YSSYGSEEQESRESIAVVQEAQ-----------------------------------PA
A0A3Q9ULZ9      EEDYFGAVEPAPLGSHPTQDQPSSEGEQEDATSGGSQ---------------------PS
A0A3S9JFL2      EEDYFGRVELAPVNSRPTEDEPT-----------------------------------PS
A0A1Q2CI19      -GGARAVA--------------------------------------------------DE
A0A512T3M3      -RAQRGAFDPAADEDGQSSDIDT--------HG-------------------------SS
W6JTW4          -RSAHGTSASRRDRLGRAEAPSTIRGGGEARHD-------------------------AA
A0A0A0JTY0      SGPVGP------------------------------------------------------
A0A0A0JXF2      -GPVAPATPSTSSRPTTGPAEETRSRDAV-----------------------------GT
E6S8H2          -KKKGKARKRLPSSAVQGPPELSE----------------------------------ER
A0A0A0JGH0      -PRQQPSAPSVAVPQHASAPEVDR----------------------------------WS
N0E4U7          -RSLRPTRADAST-QFAGSEDGAR----------------------------------PF
A0A0A0IYK2      -RSARSAAEQETTFVDSRTPGASPVHSAESRDTSRNPEDAPDDLQLDVTPGGEVPTATDE
A0A0Q9L0H3      -RAAEPVA--------------------------------------------------DE
A3TMK0          -RPAAPVV--------------------------------------------------TE
A0A543PXP1      -GGAQGAR--------------------------------------------------AK
A3TMH6          -PGRRGTTDG------------------------------------------------SS
A0A5R8VLL6      KTASPDKAARPQPANSRETRSPVSEVGRDKFSKSSTS---------------------F-
A0A1H6WL79      PTSQPGHAGVSVDGNGFEAHSPWQGPAKAAEITSQAM---------------------LS
A0A101LAM5      TTSASRRS----------------------------------------------------
A0A4Y3NEG0      LSAPAGAL----------------------------------------------------
A0A1H6YPK1      DEALRKVFPEDVLHRADDVPVLAERDDELVFGQAPEG---------------------AE
A0A2R7MGI0      ARGVAAKSGPAETGPRRRSNAAPDDARAL-------------------------------
A0A2T7WQY4      RRPSSVMGAPGATGPRRRSGTASDDARVG-------------------------------
A0A1G6GTN3      QTTPVAAAEDREAGSRTQPADPPPENVSGLRTLAPVT---------------------TP
A0A1N7DLV3      ATVEKKDAGEQAPGPRRRSAELPPSNVRGLRTLAPGR---------------------KG
A0A1V2NSB5      QVGDAGDAGASAPGPRRRSAELPPSNVSGLRTLSARR---------------------NP
A0A0Q5Q5L3      SSTEPGAAEEH--GKRRTSADLPAENVSALRPLSHRR---------------------TK
A0A0Q6DVM4      SSTEPGAAEEH--GKRRTSADLPAENVSALRPLSHRR---------------------TK
A0A1R3WWR6      RTADSENTTDT--GPRRQSADPPPENVRGLRTLSHGR---------------------TS
A0A5Q2FA83      LEEAVPVTSAAIPGSPSGTEQDEETVRAARTALSSLF---------------------TE
A0A542FTE6      QAPPIANTTNLRPEDLP-------------------------------------------
A0A2S5UYV0      HVDLLE---PQPEKNASAAISLAPRPNSQSSEQPPQA---------------------VV
A0A2S5X9U6      HADPSEQFRAQNDAVPAQRESLAP----SQPAQVRSA---------------------PV
A0A2S5ULV5      HTDPSEHFGAQPDVAAPQRESLSP----SRPAQPAAE---------------------QA
A0A653YMF0      HTDPSEHFGAQPDVVAPQRESLSP----SRPSQPATG---------------------QA
A0A4V1VGV9      VRDLTLTEGRSSADLPGKEDAARLRQPAPQAPTPPEP---------------------AT
A0A3Q9IY80      EDTAGTMVSAGAPGAASTPSPSSATRPASG------------------------------
A0A0F0LP73      VAALISEAELSPAAFDGEPPAPEESGAEDEGASRERR---------------------AS
A0A1F1X071      PAEPGPASAPA------------------------------------------------E
A0A3R8RWC7      PAEPGPVSAPAAAVAAPDAPRPADTEAPRRAAQASPR---------------------PE
A0A4U0RJZ4      LADITLHAPESSPAAGPQADRGNAGAPFDTTRHDPMR---------------------GA
A0A4R1FGL9      LADITLHAPESTPAAGPQVDRGNAGVPLDTTRHDPMR---------------------GE
E3B8H1          LADITLHAPESTPAAGPQVDRGNAGVPLDTTRHDPMR---------------------GE
A0A0Q5AWK6      RS----------------------------------------------------------
A0A3N1NLD3      RRAAAEEPARSLPAVRPAEPARAVEPERT-------------------------------
A0A3N2FVI8      RRAAAEEPARSLPAVRPAEPARAVEPERTRAAEPERA---------------------AE
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A538JQF8      LNLPSWKSPAGGGIRRATKARSAKKAAKKSSARAPAK---------------------TG
A0A0Q5JKD6      EQEATPRRRSGGLPPENVSGLRTLSQRRMSATAEGEA---------------------TS
A0A0Q9TBP0      ----TSRERAVTGTDAAPDSAPTRAGKDQAGDPVPSA---------------------GT
A0A346XTB0      ------------------------------------------------------------
A0A2W6DK08      -----------------------------------------------------------S
A0A2S0LQ32      PAETQEHVPAAS------------------------------------------------
A0A2N6V1R5      PAQVPAQLPAATITSSPVSSRTSAASPRVSTVVNPEP---------------------VS
G9PHS6          PAQVPAQLPAATITSSPVSSRTSAASPRVSTVVNPEP---------------------VS
U1PLM7          PAQVPAQLPAATITSSPVSSRTSAASPRVSTVVNPEP---------------------VS
A0A351ETF8      ------------------------------------------------------------
A0A349B7N2      -------------------------------DPTSEP---------------------LP
A0A346Y185      -------------------------------TPDDRR---------------------PQ
A0A259S8H9      ADIITDGDAADAGEEASPAIVRPHGSNGRAAAARARR---------------------SV
A0A0Q5L115      --------SREAVTAPAPVV-----------APTPPA---------------------AP
A0A2W1Z497      SRLTPSLPDRDASVPRSPVV-----------SPYDPS---------------------LE
A0A3L8NYD3      GNTLRARFLYRRMRRREEREQAQRE---------------------------------QT
A0A1M6K628      EVS-------------GARQGRGRS---------------------------------QS
A0A561E8R3      QPS-------------PPATPAAPT---------------------------------AT
A0A1H4I042      SRKT--------------------------------------------------------
A0A4R7A6D9      SHKT--------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      PATQARPQVQAQAPRSARTAVSGK------------------------------------
A0A5C8C085      KKPAPDSFEPGPGPEPSDQTDNGPDDRPGRRVASWSN-----------------------
A0A1E4BP96      ------------------------------------------------------------
A0A101KZQ4      VANPVANDEA--------------------------------------------------
A0A439DNZ6      VATTPRMKVMRRLRRYRPAYQSPGTDPASENEN---------------------------
A0A0J6YE86      SKTTSANASESRDRSAGDLPARPVTQRRYKTT----------------------------
A0A5Q5BFU2      RVEKSSPSSATSAQGDSEVAEPAGTRQTRETD----------------------------
A0A151BT98      KRG---------------------------------------------------------
A0A2Y8ZRF8      KRG---------------------------------------------------------
A0A2R9UAT1      NVDGITRPVVETQPAATGDPQDQLAPLRRTRRRAG-------------------------
A0A4Q5J5D7      EVSSKHRRRTA-------------------------------------------------
A0A1Y4CKD6      VKPVVEPEIVEEEVVPPRGKHFRV------------------------------------
A0A0Q7KBQ4      GRGESRSSSGRRVSR---------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      THEPAGR-----------------------------------------------------
A0A2S8WHZ8      DAKPSRRLQDPVPVDQPVISSNRFGEIPGLGAHAGSSEPEFRRLRRRR------------
A0A537WNY9      SERLASRR----------------------------------------------------
A0A5B8M469      TPVPAPHEVASPATAAQARATAAAGRSGMPQARLVEPQMPAPVAPAPAAPTPVTSPSAGP
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      AGGDTSVDGQANEQRSRRASRS--------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      GRRAGKPKADRPARAK--------------------------------------------
A0A4R8TXC3      VKSRKKAKK---------------------------------------------------
A0A433EDP2      VKSRKKAKK---------------------------------------------------
A0A231VTW0      VKSRKKAKK---------------------------------------------------
A0A433ECD0      VKSRKKAKK---------------------------------------------------
U7V3Z1          VKSRKKAKK---------------------------------------------------
A0A1F1J417      SSGAHGA-----------------------------------------------------
A0A2A8D6P2      SSGAHGA-----------------------------------------------------
A0A1F0THV9      SSGAHGA-----------------------------------------------------
A0A5F0M6Y0      SSGAHGA-----------------------------------------------------
D8USQ4          SSGAHGA-----------------------------------------------------
E3H5W1          SSGAHGA-----------------------------------------------------
A0A1F1QKB0      SSGAHGA-----------------------------------------------------
A0A509JY23      SSGAHGA-----------------------------------------------------
A0A448USF4      SSGAHGA-----------------------------------------------------
A0A0Q9LZR0      AGTAATR-----------------------------------------------------
A0A1N7E3F1      MPV---------------------------------------------------------
A0A544ZKQ1      MPV---------------------------------------------------------
A0A372P1T1      IPV---------------------------------------------------------
A0A5D0Q2X0      IPV---------------------------------------------------------
A0A5R8Z2E7      IPV---------------------------------------------------------
A0A1L2ZMV4      AASSSSK-----------------------------------------------------
A0A1S1CAD0      SKKSSTKK----------------------------------------------------
G5ET14          SKKSSTKK----------------------------------------------------
A0A1E9DXX2      SKKSSAKK----------------------------------------------------
A0A1E8S156      SKKSSTKK----------------------------------------------------
A0A1E8S5S2      SKKSSTKK----------------------------------------------------
A0A1S1DFA8      SKKSSTKK----------------------------------------------------
A0A2I1Z490      SKKSSTKK----------------------------------------------------
A0A1F0DAA9      SKKSSTKK----------------------------------------------------
A0A1F0PHK9      SKKSSTKK----------------------------------------------------
A0A1F0VZG6      SKKSSTKK----------------------------------------------------
A0A1E9G8X4      SKKSSAKK----------------------------------------------------
A0A1E9IAW2      SKKSSAKK----------------------------------------------------
A0A1E9ZBC9      SKKSSAKK----------------------------------------------------
A0A1E9ZDP4      SKKSSAKK----------------------------------------------------
A0A1F0R6B5      SKKSSAKK----------------------------------------------------
A0A1F0Z7N5      SKKSSAKK----------------------------------------------------
A0A1F1D897      SKKSSAKK----------------------------------------------------
D2NP38          SKKSSAKK----------------------------------------------------
A0A1F1FV74      SKKSSAKK----------------------------------------------------
A0A1E9M791      SKKSSAKK----------------------------------------------------
A0A291DEI8      SKKSSAKK----------------------------------------------------
A0A1S1D5T1      SKKSSAKK----------------------------------------------------
A0A1E8TRD6      SKKSSAKK----------------------------------------------------
A0A1F0XT88      SKKSSAKK----------------------------------------------------
A0A1F1EVP5      SKKSSAKK----------------------------------------------------
C6R548          SKKSSAKK----------------------------------------------------
A0A0K2RXS2      SKKSSTKK----------------------------------------------------
A0A1F0KX60      SKKSSTKK----------------------------------------------------
A0A542I3V2      DVERDRPGTEKDGAEI--------------------------------------------
A0A2T0UZ65      RRAAKKAKDRVGAGRRG-------------------------------------------
A0A1R4JTI6      GSTRE-------------------------------------------------------
A0A4R7TM52      ASPSVTEGEPRVLADQPSRRSRRTSALSQD------------------------------
A0A542XE74      SRADDVEDAEPTSSRAARKRRRSKNTVG--------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A3S0V9U6      AGTKK-------------------------------------------------------
A0A2R7Z032      TAGKGKRRSK--------------------------------------------------
A0A1I0W453      TAGKGRRRKEAKAKAAKVDKVEKVDTAEKPSASEKAGTS---------------------
A0A1H4LCS9      TAGKGRRKLLKVGKKD--------------------------------------------
A0A4Q2RZP8      TAGKGRRKLTKLGRKS--------------------------------------------
A0A0Q6VV12      TAGKGRRRKLVRSSSDKA------------------------------------------
A0A495NTA9      TAGKG-RRKLVKSLKG--------------------------------------------
A0A0Q9QB08      TAGGGRRRKHPKKAAKNAAKKDAE-------AEAQTEADAGV------------------
A0A4Q2SA86      TAGKGWRKKADKGDKAADAEQAE--------AAAEAEKAARS------------------
A0A4Z1C3Z0      SAGKGWRKKADKADKPDKADKPDKPAQAEQAEAGEAEKATRS------------------
A0A5R8L819      AGDNPADGQGLRRRSRRSA-----------------------------------------
A0A261FQA1      EKAEQ-------------------------------------------------------
A0A1Q2CJ92      RARRVTKLVETDDQAAELAEPRRPVA----------------------------------
A0A2T0S3C8      PATTELRDLMACGEPESAPERRLDEPIGSGR-----------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      RRLARRKGARAARR----------------------------------------------
A0A4Q2JUT1      KPDSKRRGRKRA-AKDAELVTEPPANERGSRD----------------------------
A0A542J310      --ESVRPGNVEAPAKDDELVPEAPRRG-GRRS----------------------------
A0A444BL03      DYAKAASRGKHAE-----------------------------------------------
A0A4Y8X357      RKAEAPLDGAGTDAAAEARGSTVAEERRG-------------------------------
R4LD52          APVRVAVGRLPELMGAGRPGKERSKVGSAS------------------------------
A0A4T2CD79      PTIPVTAAESADSTARAESTELKDPTAAL-------------------------------
A0A4Q4D742      AVRPEQPEKSGDEASTLSRS----------------------------------------
A0A4Q2RU39      KSVEVYSTAGKGRRRKPAKAEKAEKAEKSEKAGKS-------------------------
A0A4Q2SK58      KSREAYSTAGKGRRRREAKVDKADTPVTPDKPARPVKAGRTSKR----------------
A0A2N3YJR1      DYEKASRGRHGTD-----------------------------------------------
A0A1C6T1J1      PADRATSGRHAEHAAAGVS-DRTQELTRLPR-----------------------------
A0A2W2CFC8      PVDRATAGRHAEQTAADEPVDNAEELTRLSR-----------------------------
A0A2W2A4B0      SAVPGSTSEVTP------------------------------------------------
A0A4Y9MDA5      ARVPAPAAEPVGPVGVGARKK---------------------------------------
A0A1H7N9P7      APAPLPAARSAEAADRPASRR---------------------------------------
A0A1M7V0F8      PAVPVPAGRIGQL-----------------------------------------------
A0A1V8PLV6      S-----------------------------------------------------------
A0A4R0U4F1      QIQHKKSEKMKKD-----------------------------------------------
A0A357ZCV8      DRPAADAASQL-------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A538BYZ4      RGGDALRRQRSRRGP---------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      GAYEFLGGEQESVKVEGLSAAVALDTAAPDPAADYVSLAGKGGKKKSKKSRRA-------
A0A4Y8ZIU8      YYQAPRDAESRSAGETTPEAGAGR------------------------------------
A0A0F0KYJ9      PTGTVRGDNANIYAKSK-------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A538BBM6      PAGE--------------------------------------------------------
A0A1I6GVG4      PSGTVRGDS--------PRRRGESEAA---------------------------------
A0A1I6IST1      PSGTVRGDSLAPTRPRMPRRASKTRVGS--------------------------------
A0A412JBM5      GHRRQARGRSGQS-----------------------------------------------
A0A1C2B334      RSRSHDIAQVGLRR----------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      RRAAGEEPADRQRVIA--------------------------------------------
A0A0K8Q3D9      -----------AVAPSVLGEDADLLQRDSDASGS-WVGENYEVDHAMIEEYVPPRRRVKS
A0A2R7RCA1      -----------APTSA----PGPVAEAEPDLTGPFWEGPGESVQ---VPESVSAGRRARG
A0A023X491      S-----------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A1Q7WJN6      GYEVADEDELREPAQSLLRDPQ--------------------------------------
A0A1E2SNF6      ASLTAGPEAAPAPAATPVPTPAEPDAADRDATDPHSTSGSVPEPVPAEPANRGRRAARHG
Q6ADE8          ASLTAGPEAAPAPAATPVPTPAEPDAADRDATDPHSTSGSVPEPVPAEPANRGRRAARHG
A0A1Q7CZ24      --------ARGRGAWSRA------------------------------------------
A0A2W6VLC6      -------ASVPDTGWSVSHAAAEASAGVAGAARTESTAGREGTPHREAPFS---------
A0A519G798      -------PDKPRN-----------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      A-----------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A0W8I9Y2      HESFGLEAWGRSGSSTGSTAQGH-------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      GTSSQSMTVTKPAPDNFDEIVFRGTRAKRSDES---------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A0G3V3M7      ------------------------------------------------------------
A0A3E2DN22      EGLVRVPKKDRADTDTEITP--------RRAK----------------------------
A0A3Q9ULZ9      RAVRTNGSDT-DQIPAGLRPVGPQPKPARRAR----------------------------
A0A3S9JFL2      RVTSSSASRSQENRPADLTPVGPRPRPARRAR----------------------------
A0A1Q2CI19      KPEASLV-------EPAEDVQAQRSK----------------------------------
A0A512T3M3      GPRSAA--------VPGSGARSPRANRATG------------------------------
W6JTW4          GPRPAV--------VEASPDDSV-SDRSGG------------------------------
A0A0A0JTY0      --PTGHMGDFF---DDAEQPESRRSRRTSSSA----------------------------
A0A0A0JXF2      ADPTTTVDPVLGVDDDDVEPDSRRTRRRASSL----------------------------
E6S8H2          VPESRS--------ARREASRKRSSRRTSSSA----------------------------
A0A0A0JGH0      LPPRVD--------DPQDAAPSRRSRHSSH------------------------------
N0E4U7          SPQADG--------APDDAALSRRARRTSSSA----------------------------
A0A0A0IYK2      AHAATR--------GEVGEERRRSRRRSSSSA----------------------------
A0A0Q9L0H3      LHPPTT--------GDERPRESRHDRRTSSSL----------------------------
A3TMK0          SEPDDF--------LDDASRESRRTRRASSA-----------------------------
A0A543PXP1      RPAHDV--------DSKSDPDSRQTRRTSSSSL---------------------------
A3TMH6          TPPHPA--------ESEPGAESRRDRRTTSA-----------------------------
A0A5R8VLL6      ------------------------------------------------------------
A0A1H6WL79      GLGHAIAGPSNSLTNSSDTPSFLAPESQWRSPS----------------DG-RGRRSAPP
A0A101LAM5      ----PDADAVNPVPDIREASPFLGSVSTWRAPQ----------------DGSRGRRSAPP
A0A4Y3NEG0      ----AD-NPATPLPEPREASTFLAPDSPWRAPQ----------------DGSRGRRSAPP
A0A1H6YPK1      KGPGGHESIDETHSEERPPGEISFGHSVDAVEV----------------AVSGRSAVRDT
A0A2R7MGI0      ------HAGE------------------------------------------VFRDLG--
A0A2T7WQY4      ------ASGE------------------------------------------VRRSRG--
A0A1G6GTN3      AVPGGEVTDEITVPATSGETAAGTLP-----------------------R--RRTRRG--
A0A1N7DLV3      SPVPGDSGGE-GVVPVAAPAADVPDD-----------------------RTSRRRQRG--
A0A1V2NSB5      VAASGDFTGE-GAVAVAPPAAVVADE-----------------------RTPRRRRRG--
A0A0Q5Q5L3      DRDAGEATSEVEVVRTSEPPVDAGAP-----------------------R--RRRTTP--
A0A0Q6DVM4      DRDAGEATSEVEVVRTSEPPVDAGAP-----------------------R--RRRTTP--
A0A1R3WWR6      ASNQDDSSGE-NVASVTTAPSPVGRR-----------------------R--QR------
A0A5Q2FA83      DPDDTQFSMPAITSEPVTQGTPLAAPAPASSPD--------ETIDAPSPALSRGRRFAE-
A0A542FTE6      --------------RRTRRNPPTIAPSDEMNDA----------------PAERSHLA---
A0A2S5UYV0      AQQQ----------APASETPSDLSSTPEVQGA----------------PTRRSRRGA--
A0A2S5X9U6      VPAQ----------LETQSAEP------VSEQP----------------QSRRSRRGA--
A0A2S5ULV5      APSQ----------PQAGPVPSSAPTAVATEQP----------------QSRRSRRGA--
A0A653YMF0      VPEQ----------AQAAPVQASAPTAVATEQP----------------QSRRSRRGA--
A0A4V1VGV9      AVRAPSAPSRAGASEASGPNVAPHGRQSGEAPSPQG-------------PRTRRARRRAD
A0A3Q9IY80      --------------VTGSPAATGTATPTVVATD----------------STRRSRRSKR-
A0A0F0LP73      RSRTVSDDAASSRATHARPRIAQTGQRS---------------------TPVRARRAKDA
A0A1F1X071      PGPVVEP------------DGHEPEGDSAAAAR----------------TSPRGRRAAST
A0A3R8RWC7      AQPVAHPARAADESAPVEHDENEPEGDSAPAAR----------------TSPRGRRAAST
A0A4U0RJZ4      SSEAPSASAN----VECAPREATPATSGSDGAP----------------PSRRSRRFRAN
A0A4R1FGL9      SSQAPSASAN----VERAPRQATPATSDSDGAP----------------PSRRARRFRAN
E3B8H1          SSQAPSASAN----VERAPRQATPATSDSDGAP----------------PSRRARRFRAN
A0A0Q5AWK6      --------------ARRSPRTQALEPVESRAER----------------PTASRRTLR--
A0A3N1NLD3      --------------RAAEPERTRVAEPERAVEPARSLEHVVRAAPKAEVPSSFRRPAR--
A0A3N2FVI8      PERAAEPERAAEPERAAEPERTRVTEPERAAEPARSLEHVVRAAPKAEVPSSFRRPAR--
A0A2S5XDQ6      --------------AAAAPRRSELAPVESRALP----------------PQTSRRAAR--
A0A2S5XNN6      --------------AAAAPRRSELAPVESRALP----------------PQTSRRAAR--
A0A538JQF8      PDTTNASADEPVVHEAPAAGPGSRVSDGKPRLRWSWSAGAEDFLGREGPA----------
A0A0Q5JKD6      EIAVASTAEPDTVDTMSRRRARRG------------------------------------
A0A0Q9TBP0      PPPSGDTHHGSAPTGHRDTPPVAPAGHGDSRKTAVAEPGDDVA-----------------
A0A346XTB0      -----SHRDADRDADRDADPDGEGA-----------------------------------
A0A2W6DK08      YRNLMSYSNGSRGSDRDARFAAVISANDRAHSDRHWRRAEMSELIWHPSTPAPNGFLPER
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      VPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGAPQASVPTR
G9PHS6          VPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGAPQASVPTR
U1PLM7          VPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGAPQASVPTR
A0A351ETF8      ---------AEQTAETADA-----------------------------------------
A0A349B7N2      PPTDGQEQRGIESDELDALDAEGELPEVHPADR---------------------------
A0A346Y185      KEVKPRRRPGGRHREKATTK----------------------------------------
A0A259S8H9      PPVEVAEPVGERVDGEDEAHDAAKPRYARRNARP--------------------------
A0A0Q5L115      TPAPVPAPAGAAAAAAAAAAPGGEPAPARVPASPASPAAPTSPAVPASPVEAPGGALTRR
A0A2W1Z497      LPSRRSRRRAAAVGGTDDTRP---------------------------------------
A0A3L8NYD3      LRERTAARENEHGQPPVELTSIAGKRRSS-------------------------------
A0A1M6K628      TPRPRRVAADDQRVEVVDASADAVVMEPASTQL---------------------------
A0A561E8R3      MGTQPATAGDNITDQELGLSRRDRRSKQGK------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      VEPKPVDSQQESPWPFTELDLPDPSLSDQASDPSQLTSRRSGRRASGLPRGDQ-------
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A4R8TXC3      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
D8USQ4          ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A348NU28      ---------
A0A2N4T4Q5      ---------
A0A1M3LEY6      ---------
A0A538AJI7      ---------
A0A538AM15      ---------
A0A022KX11      ---------
A0A255G8R8      ---------
A0A4Y5YMQ6      ---------
A0A4Q5A868      ---------
A0A0W8I9Y2      ---------
A0A345NSU7      ---------
A0A4Q5APW3      ---------
A0A4Q5B0V3      ---------
A0A222TG79      ---------
A0A1Q2CRV2      ---------
A0A2S5WZJ5      ---------
K6WHS4          ---------
A0A1L2ZMQ6      ---------
A0A3L7ADK2      ---------
A0A0G3V3M7      ---------
A0A3E2DN22      ---------
A0A3Q9ULZ9      ---------
A0A3S9JFL2      ---------
A0A1Q2CI19      ---------
A0A512T3M3      ---------
W6JTW4          ---------
A0A0A0JTY0      ---------
A0A0A0JXF2      ---------
E6S8H2          ---------
A0A0A0JGH0      ---------
N0E4U7          ---------
A0A0A0IYK2      ---------
A0A0Q9L0H3      ---------
A3TMK0          ---------
A0A543PXP1      ---------
A3TMH6          ---------
A0A5R8VLL6      ---------
A0A1H6WL79      S--------
A0A101LAM5      S--------
A0A4Y3NEG0      RQV------
A0A1H6YPK1      MHLRRLFRT
A0A2R7MGI0      ---------
A0A2T7WQY4      ---------
A0A1G6GTN3      ---------
A0A1N7DLV3      ---------
A0A1V2NSB5      ---------
A0A0Q5Q5L3      ---------
A0A0Q6DVM4      ---------
A0A1R3WWR6      ---------
A0A5Q2FA83      ---------
A0A542FTE6      ---------
A0A2S5UYV0      ---------
A0A2S5X9U6      ---------
A0A2S5ULV5      ---------
A0A653YMF0      ---------
A0A4V1VGV9      LGE------
A0A3Q9IY80      ---------
A0A0F0LP73      NDLDPDATA
A0A1F1X071      WGR------
A0A3R8RWC7      WGR------
A0A4U0RJZ4      DDA------
A0A4R1FGL9      DDA------
E3B8H1          DDA------
A0A0Q5AWK6      ---------
A0A3N1NLD3      ---------
A0A3N2FVI8      ---------
A0A2S5XDQ6      ---------
A0A2S5XNN6      ---------
A0A538JQF8      ---------
A0A0Q5JKD6      ---------
A0A0Q9TBP0      ---------
A0A346XTB0      ---------
A0A2W6DK08      RP-------
A0A2S0LQ32      ---------
A0A2N6V1R5      RSLRERRNG
G9PHS6          RSLRERRNG
U1PLM7          RSLRERRNG
A0A351ETF8      ---------
A0A349B7N2      ---------
A0A346Y185      ---------
A0A259S8H9      ---------
A0A0Q5L115      EIRERERTR
A0A2W1Z497      ---------
A0A3L8NYD3      ---------
A0A1M6K628      ---------
A0A561E8R3      ---------
A0A1H4I042      ---------
A0A4R7A6D9      ---------
A0A4Q4D4T1      ---------
A0A261FE22      ---------
A0A5C8C085      ---------
A0A1E4BP96      ---------
A0A101KZQ4      ---------
A0A439DNZ6      ---------
A0A0J6YE86      ---------
A0A5Q5BFU2      ---------
A0A151BT98      ---------
A0A2Y8ZRF8      ---------
A0A2R9UAT1      ---------
A0A4Q5J5D7      ---------
A0A1Y4CKD6      ---------
A0A0Q7KBQ4      ---------
A0A1F1IHY9      ---------
A0A542HCT5      ---------
A0A2S8WHZ8      ---------
A0A537WNY9      ---------
A0A5B8M469      ---------
A0A1Y4CTD2      ---------
A0A0Q5M6Z7      ---------
A0A3N3ZPU0      ---------
A0A359IQX7      ---------
A0A4R8TXC3      ---------
A0A433EDP2      ---------
A0A231VTW0      ---------
A0A433ECD0      ---------
U7V3Z1          ---------
A0A1F1J417      ---------
A0A2A8D6P2      ---------
A0A1F0THV9      ---------
A0A5F0M6Y0      ---------
D8USQ4          ---------
E3H5W1          ---------
A0A1F1QKB0      ---------
A0A509JY23      ---------
A0A448USF4      ---------
A0A0Q9LZR0      ---------
A0A1N7E3F1      ---------
A0A544ZKQ1      ---------
A0A372P1T1      ---------
A0A5D0Q2X0      ---------
A0A5R8Z2E7      ---------
A0A1L2ZMV4      ---------
A0A1S1CAD0      ---------
G5ET14          ---------
A0A1E9DXX2      ---------
A0A1E8S156      ---------
A0A1E8S5S2      ---------
A0A1S1DFA8      ---------
A0A2I1Z490      ---------
A0A1F0DAA9      ---------
A0A1F0PHK9      ---------
A0A1F0VZG6      ---------
A0A1E9G8X4      ---------
A0A1E9IAW2      ---------
A0A1E9ZBC9      ---------
A0A1E9ZDP4      ---------
A0A1F0R6B5      ---------
A0A1F0Z7N5      ---------
A0A1F1D897      ---------
D2NP38          ---------
A0A1F1FV74      ---------
A0A1E9M791      ---------
A0A291DEI8      ---------
A0A1S1D5T1      ---------
A0A1E8TRD6      ---------
A0A1F0XT88      ---------
A0A1F1EVP5      ---------
C6R548          ---------
A0A0K2RXS2      ---------
A0A1F0KX60      ---------
A0A542I3V2      ---------
A0A2T0UZ65      ---------
A0A1R4JTI6      ---------
A0A4R7TM52      ---------
A0A542XE74      ---------
A0A0G3V3F3      ---------
A0A0Q7QDF6      ---------
A0A3S0V9U6      ---------
A0A2R7Z032      ---------
A0A1I0W453      ---------
A0A1H4LCS9      ---------
A0A4Q2RZP8      ---------
A0A0Q6VV12      ---------
A0A495NTA9      ---------
A0A0Q9QB08      ---------
A0A4Q2SA86      ---------
A0A4Z1C3Z0      ---------
A0A5R8L819      ---------
A0A261FQA1      ---------
A0A1Q2CJ92      ---------
A0A2T0S3C8      ---------
A0A4Y8WZJ3      ---------
A0A285VUW0      ---------
A0A4Q2JUT1      ---------
A0A542J310      ---------
A0A444BL03      ---------
A0A4Y8X357      ---------
R4LD52          ---------
A0A4T2CD79      ---------
A0A4Q4D742      ---------
A0A4Q2RU39      ---------
A0A4Q2SK58      ---------
A0A2N3YJR1      ---------
A0A1C6T1J1      ---------
A0A2W2CFC8      ---------
A0A2W2A4B0      ---------
A0A4Y9MDA5      ---------
A0A1H7N9P7      ---------
A0A1M7V0F8      ---------
A0A1V8PLV6      ---------
A0A4R0U4F1      ---------
A0A357ZCV8      ---------
A0A419GS64      ---------
A0A538BYZ4      ---------
A0A4R1CW45      ---------
A0A4R5Z7B0      ---------
A0A2V2CXY5      ---------
A0A2S8MDM2      ---------
A0A357ZDL3      ---------
A0A4Y8ZIU8      ---------
A0A0F0KYJ9      ---------
A0A510HHA8      ---------
A0A538BBM6      ---------
A0A1I6GVG4      ---------
A0A1I6IST1      ---------
A0A412JBM5      ---------
A0A1C2B334      ---------
R7Y679          ---------
A0A5Q2F9A3      ---------
A0A0K8Q3D9      ---------
A0A2R7RCA1      ---------
A0A023X491      ---------
A0A4R1BMZ2      ---------
A0A1Q7WJN6      ---------
A0A1E2SNF6      ---------
Q6ADE8          ---------
A0A1Q7CZ24      ---------
A0A2W6VLC6      ---------
A0A519G798      ---------
A0A519GXS6      ---------
A0A520EHH5      ---------
                         

© 1998-2020Legal notice