BYKdb

Dataset for cluster orphancd of phylum actinobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

241 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A1Q2CI19      ------------------------------------------------------------
A0A512T3M3      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A543PXP1      ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A1H6WL79      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A0A4Y3NEG0      ------------------------------------------------------------
A0A1H6YPK1      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A5Q2FA83      ------------------------------------------------------------
A0A542FTE6      ------------------------------------------------------------
A0A2S5UYV0      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A653YMF0      ------------------------------------------------------------
A0A4V1VGV9      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
A0A4U0RJZ4      ------------------------------------------------------------
A0A4R1FGL9      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A6I2XCV4      ------------------------------------------------------------
A0A5R8VLL6      MGPRHCLINREPGRRVACCRYPQFPHSSPRAPTSSRLYQTSTFGRVLAWQHAEAAPDTGN
A0A538JQF8      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A0Q9TBP0      ------------------------------------------------------------
A0A346XTB0      ------------------------------------------------------------
A0A0G3V3M7      ------------------------------------------------------------
A0A6I3DD56      ------------------------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A6I1G2U1      ------------------------------------------------------------
A0A351ETF8      ------------------------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A346Y185      ----------------------------------------MEAVCLFCWQLWQGSQLERT
A0A259S8H9      ------------------------------------------------------------
A0A0Q5L115      ------------------------------------------------------------
A0A2W1Z497      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A4R8TXC3      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
D8USQ4          ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A6G8FYB9      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      --------------------------------------------MPIDEDQRQGEGLRIL
A0A3L8NYD3      ----------------------------------------MEAAR---------VTVVDF
A0A1M6K628      ----------------------------------------MAIARRKPRTGRDILDLVQL
A0A561E8R3      ------------------------------------------------------MTVTDF
A0A3E2DN22      ------------------------------------------------------MTIVDV
A0A3Q9ULZ9      ------------------------------------------------------MTVIDF
A0A3S9JFL2      ------------------------------------------------------MTVIDL
A0A1Q2CI19      ------------------------------------------------------MSLKDF
A0A512T3M3      ------------------------------------------------------MTLRDY
W6JTW4          ------------------------------------------------------MPLREY
A0A0A0JTY0      ------------------------------------------------------MTLQDY
A0A0A0JXF2      ------------------------------------------------------MTLQDY
E6S8H2          ------------------------------------------------------MTLSEY
A0A0A0JGH0      ------------------------------------------------------MTLQDY
N0E4U7          ------------------------------------------------------MTLRDY
A0A0A0IYK2      ------------------------------------------------------MTLQDY
A0A0Q9L0H3      ------------------------------------------------------MTLQDY
A3TMK0          ------------------------------------------------------MTLQDY
A0A543PXP1      ------------------------------------------------------MTLKDY
A3TMH6          ------------------------------------------------------MTLNDY
A0A1H6WL79      ---------------------------------------MERTTQLLQDDKPQGMSGNDL
A0A101LAM5      ------------------------------------------------------MSGNDL
A0A4Y3NEG0      ---------------------------------------------MLQDDKPQGMSGNDL
A0A1H6YPK1      ------------------------------------------------------MEFRDY
A0A2R7MGI0      --------------------------------------------------------MQRV
A0A2T7WQY4      ------------------------------------------------------MDMQRV
A0A1G6GTN3      --------------------------------------------------------MQRV
A0A1N7DLV3      --------------------------------------------------------MQRV
A0A1V2NSB5      --------------------------------------------------------MQRV
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      --------------------------------------------------------MQRV
A0A5Q2FA83      ------------------------------------------------------MQFREF
A0A542FTE6      ------------------------------------------MASTVDEQITPTLDLREF
A0A2S5UYV0      ------------------------------------------------------MTVLDF
A0A2S5X9U6      ------------------------------------------------------MTVLDF
A0A2S5ULV5      ------------------------------------------------------MTVLDF
A0A653YMF0      ------------------------------------------------------MTVLDF
A0A4V1VGV9      ------------------------------------------------------MTALDL
A0A3Q9IY80      ------------------------------------------------------MELRTY
A0A0F0LP73      ------------------------------------------------------MTVLDF
A0A1F1X071      ------------------------------------------------------MTIEDF
A0A3R8RWC7      ------------------------------------------------------MTIEDF
A0A4U0RJZ4      ------------------------------------------------------MTILDL
A0A4R1FGL9      ------------------------------------------------------MTILDL
E3B8H1          ------------------------------------------------------MTILDL
A0A0Q5AWK6      ------------------------------------------------------MTVVDF
A0A3N1NLD3      ------------------------------------------------------MTVVDF
A0A3N2FVI8      ------------------------------------------------------MTVVDF
A0A2S5XDQ6      ------------------------------------------------------MTVVDL
A0A2S5XNN6      ------------------------------------------------------MTVVDL
A0A3L7ADK2      ----------------------------------------MDAETNPDIVNDNDRSLRDF
A0A6I2XCV4      ----------------------------MSTPETPQDFSRANSSPNQPDLFGSSTALRHY
A0A5R8VLL6      HEKGEVMAEEEFFRTGPVAPGPFAMPAHSARQPAGGIGSLSNPEIGGSEASAAGMGVSDY
A0A538JQF8      ---------------------------------------------------------MPF
A0A0Q5JKD6      -----------------------------------------------------------M
A0A0Q9TBP0      ------------------------------------------------------------
A0A346XTB0      -------------------------------------------------MEEQLRRGPSL
A0A0G3V3M7      ------------------------------------------------------MRPADY
A0A6I3DD56      ------------------------------------------------------MRPADY
A0A2W6DK08      ------------------------------------------------------MGIKDY
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A6I1G2U1      ----------MGFVRDKPVHRVGIDSRVGGRSVDAAHERFEHELMGDARGADTTMNAREY
A0A351ETF8      ---------------MSAAVVGVRPVNVAELQHVRGSFCMAEQPSNQDSSSLAVLDLRAH
A0A349B7N2      ------------------------------------------------------------
A0A346Y185      SRWRGGSSWGQRRKACGSSLRVVRVSAEVRGGVHLLEAHRSGRLNPMDSLQAPATSVEAL
A0A259S8H9      --------------------------------------------------------MLDL
A0A0Q5L115      -----------------------------------------MDRPDTEPRPRTL-DLQDY
A0A2W1Z497      ------------------------------------------MAPDARPDERTSRTLADY
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------MTIRDF
A0A2Y8ZRF8      ------------------------------------------------------MTIRDF
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      -------------------------------MNDRRYGLDLSPVRDEEQGLDMAELASNY
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------MSLSKA
A0A542HCT5      ---------------------MPQTNPKGAERPLASVLLHFALLGGALRGEFIGVELTDY
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------MDLRDL
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      -------------------------------------------------MVLDGVTVREA
A0A0Q5M6Z7      --------------------------------------------------------MRDF
A0A3N3ZPU0      -----------------------------------MPQQDTSDEQYLDAPVHIAHRLRAV
A0A359IQX7      ------------------------------------------MLRVGTLETGRPMTLLDF
A0A4R8TXC3      ------------------------------------------------------MTILDF
A0A433EDP2      ------------------------------------------------------MTILDF
A0A231VTW0      ------------------------------------------------------MTILDF
A0A433ECD0      ------------------------------------------------------MTILDF
U7V3Z1          ------------------------------------------------------MTILDF
A0A1F1J417      ------------------------------------------------------MTILDF
A0A2A8D6P2      ------------------------------------------------------MTILDF
A0A1F0THV9      ------------------------------------------------------MTILDF
A0A5F0M6Y0      ------------------------------------------------------MTILDF
D8USQ4          ------------------------------------------------------MTILDF
E3H5W1          ------------------------------------------------------MTILDF
A0A1F1QKB0      ------------------------------------------------------MTILDF
A0A509JY23      ------------------------------------------------------MTILDF
A0A448USF4      ------------------------------------------------------MTILDF
A0A0Q9LZR0      ------------------------------------------------------MELTDY
A0A1N7E3F1      ------------------------------------------------------MELLRY
A0A544ZKQ1      ------------------------------------------------------MELLYY
A0A372P1T1      ------------------------------------------------------MELLYY
A0A5D0Q2X0      ------------------------------------------------------MELLYY
A0A5R8Z2E7      ------------------------------------------------------MELLYY
A0A1L2ZMV4      -----------------------------------------MEYTAENQPQALNHQVRRL
A0A6I3F378      ----------------------------------------------MEPQLTPARTLGDY
A0A1S1CAD0      ------------------------------------------------------MTILEF
G5ET14          ------------------------------------------------------MTILEF
A0A1E9DXX2      ------------------------------------------------------MTILEF
A0A1E8S156      ------------------------------------------------------MTILEF
A0A1E8S5S2      ------------------------------------------------------MTILEF
A0A1S1DFA8      ------------------------------------------------------MTILEF
A0A2I1Z490      ------------------------------------------------------MTILEF
A0A1F0DAA9      ------------------------------------------------------MTILEF
A0A1F0PHK9      ------------------------------------------------------MTILEF
A0A1F0VZG6      ------------------------------------------------------MTILEF
A0A1E9G8X4      ------------------------------------------------------MTILEF
A0A1E9IAW2      ------------------------------------------------------MTILEF
A0A1E9ZBC9      ------------------------------------------------------MTILEF
A0A1E9ZDP4      ------------------------------------------------------MTILEF
A0A1F0R6B5      ------------------------------------------------------MTILEF
A0A1F0Z7N5      ------------------------------------------------------MTILEF
A0A1F1D897      ------------------------------------------------------MTILEF
D2NP38          ------------------------------------------------------MTILEF
A0A1F1FV74      ------------------------------------------------------MTILEF
A0A1E9M791      ------------------------------------------------------MTILEF
A0A291DEI8      ------------------------------------------------------MTILEF
A0A1S1D5T1      ------------------------------------------------------MTILEF
A0A1E8TRD6      ------------------------------------------------------MTILEF
A0A1F0XT88      ------------------------------------------------------MTILEF
A0A1F1EVP5      ------------------------------------------------------MTILEF
C6R548          ------------------------------------------------------MTILEF
A0A0K2RXS2      ------------------------------------------------------MTILEF
A0A1F0KX60      ------------------------------------------------------MTILEF
A0A542I3V2      ---------------------------------------MTGKHEVNSDESAAGMGVRDY
A0A2T0UZ65      ------------------------------------------------------MTFLDF
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------MELQTY
A0A542XE74      ------------------------------------------------------MTILDL
A0A0G3V3F3      ------------------------------------------------------MDLAAH
A0A0Q7QDF6      ------------------------------------------------------MTSRSG
A0A3S0V9U6      ------------------------------------------------------MTLLDF
A0A5R8L819      --------------------------------------------------MRSVVELGVY
A0A261FQA1      ------------------------------------------------------MSIADI
A0A1Q2CJ92      -----------------------------------------------------------M
A0A2T0S3C8      ------------------------------------------------------MDVRDY
A0A4Y8WZJ3      -----------------------------------------------MAPAPPVMSLSKA
A0A285VUW0      ------------------------------------------------------MSVRDL
A0A2R7Z032      ------------------------------------------------------MTFAEF
A0A1I0W453      ------------------------------------------MVGGGAPPRLAGMTFGDF
A0A1H4LCS9      ------------------------------------------------------MTFGDF
A0A4Q2RZP8      ------------------------------------------------------MTFGDF
A0A0Q6VV12      ------------------------------------------------------MTFGDF
A0A495NTA9      ------------------------------------------------------MTFGDF
A0A0Q9QB08      ------------------------------------------------------MTFGDF
A0A4Q2SA86      ------------------------------------------------------MTFGDF
A0A4Z1C3Z0      ------------------------------------------------------MTFGDF
A0A4Q2JUT1      --------------------------------MDPTRSWSTAPRMGRWHDPEVSMELRDY
A0A542J310      ------------------------------------------------------MELRDY
A0A444BL03      ------------------------------------------------------MTLLDF
A0A4Y8X357      ------------------------------------------------------MNLLDF
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------MTLLDF
A0A6G8FYB9      ------------------------------------------------------MTLLDF
A0A4Q4D742      --------------------------------------------------MGVHVELRQF
A0A4Q2RU39      ------------------------------------------------------MTFADF
A0A4Q2SK58      ------------------------------------------------------MTFADF
A0A1C6T1J1      ------------------------------------------------------MDLYRQ
A0A2W2CFC8      ------------------------------------------------------MDPLRQ
A0A2W2A4B0      --------------------------------------------------------MTPL
A0A4Y9MDA5      ------------------------------------------------------MSLSVF
A0A1H7N9P7      ------------------------------------------------------MSLSVF
A0A1M7V0F8      ------------------------------------------------------MTLSAF
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      ------------------------------MS----------------------------
A0A348NU28      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      --------------------------------------MYVTSG------------DDSN
A0A6I3DFP2      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------MQ----------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      MAVVRRFWPVLLIATLVGALCGFGWAALQ-PK------MYQSTSSGLIVTPKSSTVG---
A0A3L8NYD3      VRLTRVNWRVIFATFSLGLVAALLYTLHQ-PV------VYTATSKGYVAVDSGDSVS---
A0A1M6K628      WALARRNWLTLLLATILGVAVGAGISYLQ-PT------LYSATSVGYVVVGNSSTEN---
A0A561E8R3      VRFSRTNALLLLLFTIVGGALMFGYTFTK-PT------LYSATAQGLVSAGGADNTG---
A0A3E2DN22      VRILRRNLALLVICTLAGGLLGAVYQLTR-SE------TFTAKATGMVVAGDSTSVG---
A0A3Q9ULZ9      VRLLRRNLLLLVICGVVGMGAAAAYVFTR-PV------QYVAQSTAMVVAGDSSSVG---
A0A3S9JFL2      VRLLRRNLALLLVCGLVGIAAAAAYVFTR-PV------QYVAESTAMVVAGDSSSVG---
A0A1Q2CI19      LSILRHRWLVIVLCVLIA--AGVVFAITP-AE------RDVSPRIGSYTATSTLLVGSV-
A0A512T3M3      LIVFRHYGALIVATILAA--ATLTWVLTP-AH------AQGPVT--SYTATATLLAAS--
W6JTW4          LRILLHRAPLIAGATVVA--GLLSWFLVP-AG------TQNAPR--SYTATAQMTVDG--
A0A0A0JTY0      FKVFRHRWIIIVICALVA--GAITWFITP-AS------SDTTKKVGSYTATATMLVTAKA
A0A0A0JXF2      IKVFRHRWIVIVLCAVIA--AGVTWLVTP-AS------ADTTKKVGSYTATATILV----
E6S8H2          LKVFRQRWLIIAITTLVA--GAVMWVTSP-AV------ADTSQKASSYTATATLLV----
A0A0A0JGH0      IRIIRQRWIVIVICAAVA--GLVTWFLTP-AN------ASSVKDAPSYTATATVLV----
N0E4U7          LTIARRRWPIIVACALVA--AAVTWFLTP-AQ------TDEAEVAPSYTATATLLV----
A0A0A0IYK2      IKVFRHRWMVILVCALVA--GAVTWFVTP-AS------ADTTKKVGSYAATATILV----
A0A0Q9L0H3      IKVFRHRWPVILICALVA--GAATWFITP-AS------SDTTKKVGSYTATATLLV----
A3TMK0          IKVFRHRWPVILICALVA--GAATWFITP-AS------SDTTKKVGSYTATATILV----
A0A543PXP1      LKVFRHRWPVIVACALSA--AAIMWLVTP-AQ------TATAQKASSYTATATLLV----
A3TMH6          LKAFRRRWLVIALCAVVA--GAVMWTVTP-AH------PEVTRSTGSYTATATLLV----
A0A1H6WL79      LSVVRSHWLGILVITVLMTGGSLGWYALQ-PK------VYAAESSGIVVAAGAENLG---
A0A101LAM5      LSVVRSHWLGILFITVLMVGGSLGWYALQ-PK------VYSAESSGIVVAAGAENLG---
A0A4Y3NEG0      LSVVRSHWLGILLITVFMVGGSLGWYTLQ-PK------IYSAESSGIVVTAGAENLG---
A0A1H6YPK1      LDVLRSRWLSIAVCTLVVGAVAYLWSDMQ-PR------VYSTSAEALVTPAGSL------
A0A2R7MGI0      VRILRAYWKTIGALLALGALAGLGWSALQ-PR------VYTADASGYVATVSSDGSTG--
A0A2T7WQY4      VRILRAYWMTIGALFALGALVGLGWSALQ-PR------VYTADASGYVATVSSDGSTG--
A0A1G6GTN3      VRILRAYWKAIVALIATGALAGLGWSSLQ-PR------VYTADASGYVAAVASDGSTG--
A0A1N7DLV3      ARILRAYWKAIVALTLAGGLAGLGWSALQ-PR------VYTADASGYVASVSSDGSTS--
A0A1V2NSB5      ARILRAYWKAIVALTLAGGLAGFGWSALQ-PR------VYTADASGYVASVSSDGSTG--
A0A0Q5Q5L3      MRILRAYWKAIVVMTVLGGLAGLGWSATQ-AR------VYSADASGYVAAVASDGSTG--
A0A0Q6DVM4      MRILRAYWKAIVVMTVLGGLAGLGWSATQ-AR------VYSADASGYVAAVASDGSTG--
A0A1R3WWR6      VRILRAYWKAIVALTIAGGLVGLAWSAVQ-PR------VYTADASGYVAAVASDGSTG--
A0A5Q2FA83      LAILGSRWKTVLVSLLLVVAATVATTLRI-TP------TYEATTRVFFSAEATAKTGTN-
A0A542FTE6      LRAVRAYWVGALGILLICIAIAALWTLTQ-PR------VWTSVATGVVQTTGGGDAG---
A0A2S5UYV0      LRLTGRSWRTLLIGVAIGLLAAFGYTQVQ-PH------VFTANSSGFVMAGPAAEG----
A0A2S5X9U6      LRLTGKSWKILAVGAIVGLLAAFGYTQIQ-PK------EYEANSAGFVVASGNAEL----
A0A2S5ULV5      LRLTGKSWKILAIGVIVGLLAAFGYTQIQ-PK------VYEADSAGFVIAGSSGEF----
A0A653YMF0      LRLTGKSWKILAVGVIIGLLAAFGYTQIQ-PK------VYEADSAGFVIAGGSAEL----
A0A4V1VGV9      VRIMRANLKLLALAALIGTLLAAGYTLTR-PT------LYSASSTAQVIAGNSIDAN---
A0A3Q9IY80      LRILRAHWLGLIVLVVVGVVSAFGWTLLQ-PK------VYSADASG-IVAPVRTELSGND
A0A0F0LP73      LVLIRRGWFFLALGLLFGALGGFVTAQLT-PP------VYTAQATGFIAGTGG-------
A0A1F1X071      LRLLLRNLLLLVAGLVLGAATGYGLSFTQ-ST------TYSASALGYVSASAQSDENGDP
A0A3R8RWC7      LRLLLRNLLLLVAGLVLGAAAGYGLSFTQ-ST------TYSASALGYVSASAQSDENGDP
A0A4U0RJZ4      VRIIRTNLKLLLLSMLLGIVVAAGYTLTR-PV------EYQATSTAQIMAGASNDAS---
A0A4R1FGL9      VRIIRTNLKLLLLSMLLGIVVAAGYTLTR-PV------EYQATSTAQIMAGASNDAS---
E3B8H1          VRIIRTNLKLLLLSMLLGIVVAAGYTLTR-PV------EYQATSTAQIMAGASNDAS---
A0A0Q5AWK6      IAFIRRNWKALVVAVLVGVTAMAAFSFVT-PK------VYESSSAGFVIAATDGSSA---
A0A3N1NLD3      IAFIRRNWKILVVAVLVGVSAMAAFSAVS-PK------VYDSSSAGFVIAATDGSSA---
A0A3N2FVI8      IAFIRRNWKIIVVAVLVGVSAMAAFSAVT-PK------VYDSSSAGFVIAATDGSSA---
A0A2S5XDQ6      IAFIRRNWRTLVGAVLVGALAMAAFSFLT-PK------VYESSSAGFVIAASDGSSA---
A0A2S5XNN6      IAFIRRNWRTLVVAVLVGALAMAAFSFLT-PK------VYESSSAGFVIAASDGSSA---
A0A3L7ADK2      VRMIRTYWMGALLIIALSIASGAVWTLFQ-PQ------VFEAKATGIVQAPRGNDPS---
A0A6I2XCV4      AAVVRRRWRWIAAGLVLGMVGGLISTVIA-TS-TAPKSSYFKATNTIVEADGSG------
A0A5R8VLL6      ARVARTYWKHITVITLIVTVLATAWSAFR-PR------VFAAEATAIVLAVGTDNVS---
A0A538JQF8      PRSVRAAHTLIL------------------------------------------------
A0A0Q5JKD6      VRVVRAYWKAIVALIVVGGLAGLGWSSLQ-PR------VYTADASGYVAAVASDGSTG--
A0A0Q9TBP0      ---------MALLVLLAAVAVSCAYSLAA-TP------LYIATADVLIEPSGAD--I---
A0A346XTB0      LESLWRYRVVVAGVTLFMGLLGYVVGLQE-DV------RYVAQGTLFLADPNLGDEL---
A0A0G3V3M7      LRIVRRRWWVLLVTVVIAMTFALLTRPSS-AA------TAKASRPGVSFRATTTLIS---
A0A6I3DD56      LRIIRRRWWVLLVTVVIAMTFALLTRPSS-SE------TIRANRPGVSFRATTTLIS---
A0A2W6DK08      LTALQRRWPVVVVAGLLGLLIGYLVAPGA-ANQLSGKGSYVATATVLQAPDVKE------
A0A2S0LQ32      ---MKVNAVFIICCVVVGGLLGFGYAKTQ-PK------LYQSSAQATIVIAGTD------
A0A2N6V1R5      --MTRVNLGFLILCVLLGLAGGFGYASAQ-PW------TYTATSQAMVVVPGTD------
G9PHS6          --MTRVNLGFLILCVLLGLAGGFGYASAQ-PW------TYTATSQAMVVVPGTD------
U1PLM7          --MTRVNLGFLILCVLLGLAGGFGYASAQ-PW------TYTATSQAMVVVPGTD------
A0A6I1G2U1      WKVIRRKWPVIVATSLAAAVVMFLITPAE-PPPVERVTSYTATATLIVETPARS------
A0A351ETF8      LAIVRKYWWFTVLVVVCAVAVAFLLTQRQ-ER------IYSTSAQVLLRSSENSFLF---
A0A349B7N2      ----------MVLGLTLGWVTTPSSAGPD-EP------DYYRATHTLVAETGTS------
A0A346Y185      VGVLRSSIGRILLVGVAAGLLGFGLSALQ-SL------RYTAEADLLLADPRNTG-----
A0A259S8H9      FTILRRGWLYLAAGLLLGALAGFGYAQTL-AP------VYTSQATGFIAATGTA------
A0A0Q5L115      LRIVRSYWLGAFLIVLLGVTAGAGWTLTQ-TR------VYESSASGVVQVAAGGDAN---
A0A2W1Z497      VRMFRTYWFGAVLIVLACVAAAGAWTLTQ-PR------VYTSGASGFVRVAGNGDAN---
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A4Q4D4T1      ---------MLLGALGLGAAALVLSGQTT---------RYDGSAEVLIQP----------
A0A261FE22      ---------------------------------------MAKNSDGAMTT----------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      --------------------------------------MYTASASGYVSGAS----LAAE
A0A101KZQ4      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      LRIMRQRWRWLLGTLLVVLAVAAVSTLMQ-PK------TYEASARFYLAGSNG-------
A0A2Y8ZRF8      LRIMRQRWRWLLGTLLIVLIAAAVSTMLQ-PK------TYEASARFYLAGSNG-------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ----------------------------------------------------MSAGNDTN
A0A1Y4CKD6      LRIARRMWWLFLACVAIGVGCLYVASYVSYTP------LYRSEATFTI--------TSGD
A0A0Q7KBQ4      ---MRSRWVFSVSTFVVGAVATILLVLSM-SP------VYGSSAKLFITS------PVGQ
A0A1F1IHY9      MSMLQRHWMILVAAPLIGVLLAGLWVLTQ-NP------RYASTANALVVVG-----NSES
A0A542HCT5      LRVARAYWRGIVAFVLLGVAVAAGVSLVT-PK------VYQADASGFVSAG-----GATN
A0A2S8WHZ8      MQVVRAYWRGIIGIFLICILLAFLWTLTQ-PR------IYAATSSGLVIAG-----DSEN
A0A537WNY9      LNLLWRRRILFVATILAVIGTAFGSVQVV-TP------EYEATSTLALTP----------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ARQVAQNWWVVLALALATFLGMTGVGKLTYVP------EYTSAATLVIRV---------K
A0A0Q5M6Z7      VQLLRRYWVGELAIVMLTVGLVAALTAVQ-PR------VYESTASGLTQAA-----TGES
A0A3N3ZPU0      ARAAGWYWKVALALIVLSVAAGAAIALLM-PK------VYSSTNTVMVVTG-----NSNT
A0A359IQX7      VRMTRHNAWLLLASVVLGLVAAAGYSLTQ-PT------LYGSVSTGIVVAG-----NSNS
A0A4R8TXC3      VRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI------GSGG
A0A433EDP2      VRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI------GSGG
A0A231VTW0      VRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI------GSGG
A0A433ECD0      VRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI------GSGG
U7V3Z1          VRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTI------GSGG
A0A1F1J417      VRTTRANLVLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
A0A2A8D6P2      VRTTRANLVLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
A0A1F0THV9      VRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
A0A5F0M6Y0      VRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
D8USQ4          VRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
E3H5W1          VRTTRANLLLLIAGIVIGAIAGLSYSLLQ-PK------VYAASASGYVTV------GQSG
A0A1F1QKB0      VRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
A0A509JY23      VRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
A0A448USF4      VRTTRANLVLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTV------GQSG
A0A0Q9LZR0      LRVARTYWRGLVAFMLLGVAVAGGLSLVT-PK------VYQADASGFVSAG-----ASSN
A0A1N7E3F1      ARLMRRYWPLLLLSVLAGVGTAHVVTVNT-AP------RYLASITMLVSADA----GDGG
A0A544ZKQ1      ARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------RYLASITMLVSADT----REGG
A0A372P1T1      ARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------KYLASITMLVSADA----RDGG
A0A5D0Q2X0      ARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------KYLASITMLVSADA----RDGG
A0A5R8Z2E7      ARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------KYLASITMLVSADA----RDGG
A0A1L2ZMV4      AHVVLNNWKGAIAIFLLAVLASVGLFLIS-PK------TYAATNTVMVVAG-----GGNN
A0A6I3F378      LSAVWRRKYLALSTTVLCACLAAGWSVTQ-TS------VYRASTEVVIDVS-----RNTS
A0A1S1CAD0      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
G5ET14          FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1E9DXX2      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1E8S156      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1E8S5S2      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1S1DFA8      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A2I1Z490      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1F0DAA9      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1F0PHK9      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1F0VZG6      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1E9G8X4      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1E9IAW2      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1E9ZBC9      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1E9ZDP4      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1F0R6B5      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1F0Z7N5      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1F1D897      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
D2NP38          FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1F1FV74      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1E9M791      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A291DEI8      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTV------GESG
A0A1S1D5T1      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1E8TRD6      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1F0XT88      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1F1EVP5      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
C6R548          FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A0K2RXS2      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A1F0KX60      FRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTV------GESG
A0A542I3V2      VRVARLYWRSIAVVTVIVTALVMLWAALQ-PR------TYAAESSALVLT--V---GSDS
A0A2T0UZ65      VRLSRANLLRIVLLVLIGAGLAFAYAQTL-PK------VYAADASGYVVT--G---GGQN
A0A1R4JTI6      ------------------------------------------------MVTAG---VNEN
A0A4R7TM52      WRIARTGWWMMLIGLVVGVLLAVGWVVLQ-KP------VYTADAGGFVSASAG---SGSD
A0A542XE74      IRLLRRSWLSVAVGLMIGLILAAAYTLTR-PT------TYVAESRGVVVA--G---STIS
A0A0G3V3F3      FRIIARAWKQILIAGVLVAVAMFFWSNRA-ER------VYEATALLAVTP------SDTG
A0A0Q7QDF6      WTAVARRWPLVVLLGALGLGAAALVLSGQ-TT------RYDGSAEVLIQPTSP-------
A0A3S0V9U6      IRLTRANIILLVVGILVGALVGYGTTLIQ-PK------TYAATSSGYVTLGKSEDPTTGS
A0A5R8L819      LRVFRAHWVAIVVATIVGGALAYGWAVLQ-PK------TYTAEASGYVAAT-V---GGSD
A0A261FQA1      LQMIKKHWIVGLAVLVVSLAVTVCVVQTT-VP------EYSASV--------T---AVTN
A0A1Q2CJ92      WGLLRRGWLVIVASLAVGLALAFALSLTQ-PV------LYSATSAGYVVA--G---NSAT
A0A2T0S3C8      LRVLRKRWWMLLAGIGVACGLAGILTSQM-TP------QYATSVTFFVT---T---PNNG
A0A4Y8WZJ3      MSMLQRHWMILVAAPLIGVLLAGLWVLTQ-NP------RYASTANALVVV--G---NSES
A0A285VUW0      FLAIARRWRGAVAILLLVVAATAFATSRQ-PQ------VFESRTTVYFAATDE---AGES
A0A2R7Z032      VRLTRAYWWFLVLLTALGAGVMIAKTSRE-PE------LYSAGASGIVKV--G---FSSS
A0A1I0W453      VRLSRAYVWVLIGCTILGAALMLAKTTRD-PV------LYSATSSGLVRV--G---NAAT
A0A1H4LCS9      VRLSRAYVWLLIGCTILGALLMVAKTTQD-PV------LYAANASGFVKV--G---NATT
A0A4Q2RZP8      VRLSRAYVWLLIGCTILGSLLMIAKTSRE-PV------LYAANASGFVKV--G---NATT
A0A0Q6VV12      VRLTRAYVWVLIGCTVLGALLMMAKTTRD-PV------LYSATSSGLVVV--G---NATT
A0A495NTA9      VRLTRAYVWVLIGCTVLGALLMMAKTTRD-PV------LYSATSSGLVVV--G---NATS
A0A0Q9QB08      VRLSRAYVWVLIGCTVLGAALMVAKTTQD-PV------LYSATANGLVKV--G---EAGS
A0A4Q2SA86      VRLSRAYVWVLIGCTVLGAVLMAAWTTRE-PV------LYSATSSGLVTV--G---NATT
A0A4Z1C3Z0      VRLTRAYVWVLVGCTVLGAAVMAAWTTRE-PV------LYSATSAGLVQV--G---NAAS
A0A4Q2JUT1      LRGLRRHWVAILLLTLVGVGAGYGWTVLQ-TP------VYVASTSGIVQS--T---GVGD
A0A542J310      LRGLRRHWVAIILMTGIGVGAGFGWTLLQ-TP------VYVASASGIVQS--T---GIGD
A0A444BL03      VRLTRTHLLFLVVLTLAGGAAAYGLTLRM-PS------VYLADASGYVRID-G---AGAS
A0A4Y8X357      LRVLRNNKLLLLGGIVLGVVAGLVYSLLQ-PT------LYTATSTGFVTV---------Q
R4LD52          --------------MLAALVLGALVTVQT-AP------RYATSVTFFVT---T---PNTG
A0A4T2CD79      --------MTVVAITLLGAAAAFGWTFTQ-TR------VYTANSSGIVTL--M---SDGS
A0A2N3YJR1      VRLSRTHLLSLVLLTLLGGAAAFGLTTRL-PQ------VYQADASGYVRVT-A---AGSS
A0A6G8FYB9      VRLTRAHLLSLVFLTLVGGAVAYGLTLRM-PE------VYLADASGYVRVA-G---SGTS
A0A4Q4D742      FGTLQARWRFALVTFVLGAIATVVLVTSM-AP------QYGSTVKIFM----S---TPGG
A0A4Q2RU39      VRLSRAYVWVLIGCTILGALLMIAKTTRD-PV------LYSATASGLVRV--G---NAES
A0A4Q2SK58      VRLSRAYVWVLIGCTILGALLMIAKTTRE-PV------LYSATSSGLVRV--G---AAST
A0A1C6T1J1      LRLVRRHWWIVLVTLMVALGTTALVTIRS-EP------RYVASVTFFVT---T---PSEG
A0A2W2CFC8      LRLVRRHWWIVLVTLMVSLGVTALVTVRA-QP------RYLATVTYFVT---T---PSQG
A0A2W2A4B0      TRALVLRWYFAVGGALLGFVVAIALSSTV-TP------QFRATSKIWISISGD---AESS
A0A4Y9MDA5      LGTLRRRWSLLLAGVLVGLTVAGIGSLTA-ER------LYTAESRLFFAL--E---SGNS
A0A1H7N9P7      LGLIRRRSSWLVAGVVLAVAVAGVGSLTA-TR------LYTAEARLFFTL--E---YGDS
A0A1M7V0F8      LGVLRRRSSWLLVSVLVGLTVAGAGSAAA-TR------LYTAEASLFFAL--E---YGDS
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------ST----------------------------
A0A538AM15      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------MA----------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      -----------------------TFFSAREQAERDR------------------------
A0A348NU28      --------------------------------------MAR-------------------
A0A4Q5APW3      -----------MSQIKSYP----VLTTTQSVLQPVI--EDL-GLHT-----TVAQLKE--
A0A4Q5B0V3      -----------MSQIKSYP----VLTTTQSVLQPVI--EDL-GLHT-----TVAQLKE--
A0A222TG79      VQAAYQGSLASQQRIASYA----QLASSDAVISNAV--SES-RKSI-----SSEDVRK--
A0A6I3DFP2      -----------------------MQAQRVVLQKQLSDLPAL-------------------
A0A1Q2CRV2      -----AGSNYAANQVQSFA----KVAKSGFVLTPVI--EDL-QLSV-----TPEQLAR--
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          -SASYQNSLASAQRVASYA----ELVDSDVIVSRAL--EST-GVGL-----KQDEAKD--
A0A1L2ZMQ6      --EAIAGNSLAQDRAGSYA----VMASSQRTAERAV--EKL-EKQGVADVPDAGSLIS--
A0A3L8NYD3      --DVYSATSLAQQKLSVYV----GLVSSTAVAQDVI--DSL-KLDE-----TPSDIAS--
A0A1M6K628      --AGAR--NPAAEKAATYL----PLAESRSVAETVA--QEL-G--V-----QSGEVSL--
A0A561E8R3      --SALNGVSLAQTKAQEYA----ALASSAPVAERAA--QAL-GPNA-----PGGSISA--
A0A3E2DN22      --EAMSGNAIAQQRAATYT----KLVETRTMAQKTS--EIL-KKHG-----MPEAANG--
A0A3Q9ULZ9      --GAMSGNTIAQQRASAYS----TLIGTEAVDNRVQ--KTL-GSKG-----LSKAADG--
A0A3S9JFL2      --GAMSGNTIAQQRASAYS----TLVGTAAVDNRVR--ATL-NKQG-----LSKATDG--
A0A1Q2CI19      GAPDAGAGYASLGRVALFI----TTGEVPRNAA-----AAL-GYEG-----DPALLAK--
A0A512T3M3      SENPQLPPSLPLGRIALYV----TTGVVPVRVA-----KKV-GFVG-----QPTELAG--
W6JTW4          GEERV---TVGLPRIAFFI----TTGDIPQAAA-----DKL-KYAD-----GPFALAR--
A0A0A0JTY0      SSAA-TAVAPNLDRVALYL----KTGEVPKRAA-----KKV-GYEG-----DPAVLAS--
A0A0A0JXF2      GSTD-PERTGNMGRIPLYM----TTGEIPRRAA-----AVV-GYEG-----DPARLAA--
E6S8H2          TSTE-TDSESPMGRIALYL----TTGEIPQRAA-----AEL-GYTG-----DPAVLAS--
A0A0A0JGH0      SAAT-ADEQVSVDRVVLYA----KTGAIPTAAA-----KAL-EFEG-----DPAILAS--
N0E4U7          GSGG-PPELVSIDRLALFI----KTGEIPSRAA-----KVL-SFDG-----DPALLAS--
A0A0A0IYK2      GSTDPENPNPNMGRIPLYM----TTGEIPRRAA-----AAV-GYDG-----DPALLAR--
A0A0Q9L0H3      GSNDPETGSTNLGRIALYM----TSGEVPKRAA-----ARV-DFTG-----DPALLAS--
A3TMK0          GSKDPEATGSNLGRIALYL----TTGEVPKRAA-----AVV-KFEG-----DPALLAR--
A0A543PXP1      GTS--ADSTAQMGRIALYL----TTGEIPRRAA-----AKL-GYTG-----DPAMLAS--
A3TMH6          ERT--EDVNSQLGRIALFL----TTGDIPRGAA-----KRL-GYPG-----DPALLAA--
A0A1H6WL79      --LSLAGDSLAKSKAKGYQ----SVGESILVAESVI--RTL-GLKE-----SAPDITR--
A0A101LAM5      --MSLAGDSLAKSKAKGYQ----SVGESILVAESVI--KSL-GLKE-----SAPDVTR--
A0A4Y3NEG0      --MSLAGDNLAKSKAKGYQ----SVGESILIAESVI--ESL-GLKE-----SAPDITR--
A0A1H6YPK1      --DEVGDAATVESRMAVYT----RLATSDQVAAVVA----E-SIGG-----DADALRS--
A0A2R7MGI0      --SALAGDQLALSKVKSFV----DMGYWRSVAEAAR--QTL-GVND-----SPESLVQ--
A0A2T7WQY4      --SALAGDQLALSKVKSFV----DMGYWRSVAEAAR--ESL-GVED-----SPESLVQ--
A0A1G6GTN3      --AALAGDQLALSKVKSFI----DMGYWRSVAETAR--QDL-GLSD-----PAESLVQ--
A0A1N7DLV3      --SALAGGTLALSRVKSFI----DMGYWKSVAETAR--DEL-GLTD-----SPESLVQ--
A0A1V2NSB5      --SALAGGTLALARVKSFI----DMGYWKSVAETAR--DEL-GLTD-----SPESLVQ--
A0A0Q5Q5L3      --AALAGDQLALSKVKSFI----DMGYWRSVADTAR--QQL-GLSD-----SPEALVE--
A0A0Q6DVM4      --AALAGDQLALSKVKSFI----DMGYWRSVADTAR--QQL-GLSD-----SPEALVE--
A0A1R3WWR6      --AALAGDQLALSKVKSFI----DMGYWRSVAETAR--TEL-GITD-----SPEALVQ--
A0A5Q2FA83      --TGGGGYVLTTNDLGTYE----QLVSSPVVMDPLR--QQL-KLAP-----STPL-----
A0A542FTE6      --LALAAENLAKSKAKTYV----ELAKSQAVAESV---AEA-IGSS-----SPGSLLA--
A0A2S5UYV0      --GYIGGSEAAIAKAQSYI----PLITSQPVYAKIAENPAL-GLAE-----G-QALTG--
A0A2S5X9U6      --GYINGSEAAIAKANSYI----PLITSQPVYAKIAENPDS-GLAE-----G-ETLNG--
A0A2S5ULV5      --SSIDGSEQAITKANSYL----PLITSQPVYAKIAENPNS-GLAA-----G-ETLTG--
A0A653YMF0      --GYINGSEAAIAKANSYL----PLITSQPVYNKIAENPNS-GLAA-----G-ETLNG--
A0A4V1VGV9      --SAVLSQQLSTGRAGYYA----QLASSSGVANRIAEESKG-SLRA-----GEFSVVG--
A0A3Q9IY80      AGSALVAENLAKAKVGSYL----DLGSWRAVAEHAI--AEL-GLTS-----SPESLVN--
A0A0F0LP73      --AVIAGTNIAIDRAGAYM----PLVDTAQVREEIAKDAKV-PLSK---------LNG--
A0A1F1X071      IQQASGNMEFQYSKAQSYL----PLFNTRAVGQRIV--DEL-GLEA-----SPDEVAG--
A0A3R8RWC7      IQQASGNMAFQYQKAQSYL----PLFNTRAVGQRIV--DEL-GLEA-----SPDAVAG--
A0A4U0RJZ4      --AAMVNQQLANQRSGAYA----QLASGSGVADRVVALSNG-ALSP-----GDFVLAG--
A0A4R1FGL9      --AAMVNQQLANQRSGAYA----QLASGSGVADRVVALSKG-ALSP-----GDFVLAG--
E3B8H1          --AAMVNQQLANQRSGAYA----QLASGSGVADRVVALSKG-ALSP-----GDFVLAG--
A0A0Q5AWK6      --DAISGAQTAVTRANAYL----PLISSSAVYERIQ--SDP-EANP-----GGEALNG--
A0A3N1NLD3      --DAISGAQTAVTRANAYL----PLISSSAVYERIE--SDP-EANP-----GGEPLNG--
A0A3N2FVI8      --DAISGAQTAVTRANAYL----PLISSSAVYERIE--SDP-EANP-----GGEPLNG--
A0A2S5XDQ6      --DAISGSQTAVTRANAYL----PLISSSAVSERIE--ADP-EANP-----GGEALSG--
A0A2S5XNN6      --DAISGSQTAVTRANAYL----PLISSSAVSERIE--ADP-EANP-----GGEALSG--
A0A3L7ADK2      --NAYSSEALSKSQAASYA----TVATSLAVAERVE--KAG-VVKQ-----SAGVLLG--
A0A6I2XCV4      ---------------TANLSQVAFLLQSAEVQGQIA--TAM-NLPV-------ETLRG--
A0A5R8VLL6      --SLLAGDTLAKAKAKTYK----SLAESRLVADKVS--AST-GVNM-----TGESLLG--
A0A538JQF8      -----ANNTLAPEDTQKPLNVYALFIKVGEVPKLAA--ERL-GYKK-----EAFELVRSA
A0A0Q5JKD6      --AALAGDQLALSKVKSFI----DMGYWRSVAETAR--GEL-GLSD-----SPESLVQ--
A0A0Q9TBP0      --SASSGTKIDADEVATQV----QVVTSLPVSRLVQ--ERF-SL-A-----SPPDLSE--
A0A346XTB0      --QGIVSARIS---AEEYVPRQAARIQSRAVLQEAA--DLI-DNRI-----SVGELGS--
A0A0G3V3M7      --SGSANTSVNGRDYDRLA----LLMITGEVPKRVA--EAI-DEVR-----WPQIQNANA
A0A6I3DD56      --NGSANTSVNGRDYDRLA----LLMTTGEVPKRVA--EAI-DEVR-----WPQIQSATA
A0A2W6DK08      -----------------AVASTTLLVTAEPVAERVS--KML-NTHH-----APQDLLL--
A0A2S0LQ32      ---AWSANSVAQQKAGVFA----KLAGSAAVAQSVS--QSL-GL---------QDLGG--
A0A2N6V1R5      ---AFSQNSISGQKASVYA----VLAGSQNVANRVA--KTL-KT---------SNMEG--
G9PHS6          ---AFSQNSISGQKASVYA----VLAGSQNVANRVA--KTL-KT---------SNMEG--
U1PLM7          ---AFSQNSISGQKASVYA----VLAGSQNVANRVA--KTL-KT---------SNMEG--
A0A6I1G2U1      ---------VDEPAGAVSLDRVVLYMTTGEVPALAA--QQV-GYTR-----EPALLAN--
A0A351ETF8      --PFPATGPLALNREGEIE--------TLYVTSPAF--TEA-ALLK-----SPPE-----
A0A349B7N2      --------------APPNLAQLSLLLRVGDVPERVA--AEF-G--V-----EPDVLVS--
A0A346Y185      ---LFGETGVNFLDPSRYVRNQAEFAQSNAVAERAS--VLL-GGRL-----DSDQVRE--
A0A259S8H9      ---VIAGSDEAVARAGAYM----PLINTSQVRDEIA--KEA-GVSA-------AELHG--
A0A0Q5L115      --LAFAADQLAKSQAQSYV----ELGGSLAVAESAA--AAL-GGAA-----SPASLLG--
A0A2W1Z497      --LDYAADQLSKSQAETYV----ELGGSLAVAKRVV--RAT-GTSA-----SPQELLG--
A0A1H4I042      -MDTYQGNLLSQERVRSYT----ILLTGEALAQRTI--DAL-HLDM-----SARALRQ--
A0A4R7A6D9      -MDTYQGNLLSQERVRSYT----ILLTGEALAQRTI--DAL-HLDM-----SARALRQ--
A0A4Q4D4T1      ---TSPATSLSGRAVESYA----HVLGGTALEQRAV--KALGLEDA-----GDAEVRG--
A0A261FE22      -----GASNGGSSPLASYA----QLVQSDAVLEPVV--NNL-GLHT-----SVAGLRG--
A0A5C8C085      --------------------------------------------NE-----SPASLIG--
A0A1E4BP96      TGSPLVGDQLARSKVTSYL----DIGSWRAVAEHAI--EDL-GLSA-----SPESLVG--
A0A101KZQ4      ------------------------MAKSRSVALDVQ--ENL-GIDT-----SINQLLS--
A0A439DNZ6      --------------MISYT----ELLMGETLAQRTI--DKL-DLEM-----SAGELQN--
A0A0J6YE86      ---------------------------------------------M-----SADELQA--
A0A5Q5BFU2      MADTYQGNRFSQERVISYA----ELLMGETLAQRTI--DKL-GLDM-----TAQALQE--
A0A151BT98      -----QGTPVQRDDLATYA----QVVSAPAVQKVIR--QQA----K-----LGPSVPV--
A0A2Y8ZRF8      -----QGTPVQRDDLATYA----QVVSAPAVQEVIR--KQA----K-----VGPTAAV--
A0A2R9UAT1      ----MLANNLALSKVVSYV----DIGSWRSVAEYAI--EKL-RLDS-----SPEALVR--
A0A4Q5J5D7      PALGSVADTLAKSRAKSYV----DIARSRATAEGVI--DEL-GLDD-----SPASLIG--
A0A1Y4CKD6      GSSLYSSVSSASQLSKTFP----YVLDSSYFRGVLE--DAL----------GTDSLDG--
A0A0Q7KBQ4      QVTDPTAAYFASQRLASYA----DLAREPSLLQDVI--NRLNLTGV-----TREELAG--
A0A1F1IHY9      LGVALTADNLAKSKAQQYA----LLGESRAVSDKAV--EEL-PFDL-----SSGEALR--
A0A542HCT5      PGEASVLDSLAKSRATSYV----DLAQGRATAQDVI--KTL-GLDA-----QPAGLIG--
A0A2S8WHZ8      IGNALAGDNLAKSKAVGYK----SIAGTRTIADLVR--KEL-KLDE-----SSDVLLG--
A0A537WNY9      --KTLNDPNSAYVFFGTLD----AIVPVYADAAAAR--STKERASA-----LLGRSVA--
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      GADAYSSLAQASQMTAVYS----EVFQSSALRNEIS--ASV-----------GEPVEG--
A0A0Q5M6Z7      LSMAFAGESLAKSRAESYV----RVANSDAVADRAR--KIL-GTDR-----SIGDLLG--
A0A3N3ZPU0      LGDYMTADSVSLSKADSYM----QLGGSPEVAQIAA--ESL-----------DGTPVH--
A0A359IQX7      IGDATAGMVLAEQKAAAYT----ILTGTRQVSQDVA--DGL--RSK-----YGKDVPF--
A0A4R8TXC3      TIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQ--EKNPNMGM-----TVSGIRG--
A0A433EDP2      TIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQ--EKNPNMGM-----TVSGIRG--
A0A231VTW0      TIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQ--EKNPNMGM-----TVSGIRG--
A0A433ECD0      TIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQ--EKNPNMGM-----TVSGIRG--
U7V3Z1          TIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQ--EKNPNMGM-----TVSGIRG--
A0A1F1J417      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--L-----SIGTIRG--
A0A2A8D6P2      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--L-----SIGTIRG--
A0A1F0THV9      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--L-----SIGTIRG--
A0A5F0M6Y0      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--L-----SIGTIRG--
D8USQ4          TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--L-----SIGTIRG--
E3H5W1          TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--L-----SIGTIRG--
A0A1F1QKB0      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSN--L-----SIGTIRG--
A0A509JY23      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--L-----SIGTIRG--
A0A448USF4      TIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQ--EQNSD--L-----SIGTIRG--
A0A0Q9LZR0      PGEASVGDSLAKSRATSYV----DLAKSRATAQDVI--NTL-GLGA-----QPAGLIG--
A0A1N7E3F1      LSTALQAGALSQQRVQSYA----ALLTSRQVVGRIA--GGE----------DVADVQA--
A0A544ZKQ1      LSTALQAGALSQQRVQSYA----TLLTSRQVIGRIA--RGE----------AVDDLQA--
A0A372P1T1      LSTALQAGALSQQRVQSYA----TLLTSRQVVGRIA--RGE----------DVTDLQA--
A0A5D0Q2X0      LSTALQAGALSQQRVQSYA----TLLTSRQVVGRIA--RGE----------DVTDLQA--
A0A5R8Z2E7      LSTALQAGALSQQRVQSYA----TLLTSRQVVGRIA--RGE----------DVTDLQA--
A0A1L2ZMV4      LGSYLSAETLANTKAETYL----ALGNAPEVSQLVS--KHF--AEE-----GQAVSWK--
A0A6I3F378      LFGPVAGAGDARRRLLNEI----AIVTGVEVRLGVQ--Q---QLHL-----SSPPPRA--
A0A1S1CAD0      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNTPELSL-----TTGQIRS--
G5ET14          TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNTPELSL-----TTGQIRS--
A0A1E9DXX2      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRG--
A0A1E8S156      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRG--
A0A1E8S5S2      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRG--
A0A1S1DFA8      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRG--
A0A2I1Z490      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNTPELSL-----TTGQIRS--
A0A1F0DAA9      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSL-----STGQIRS--
A0A1F0PHK9      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSL-----STGQIRS--
A0A1F0VZG6      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSL-----STGQIRS--
A0A1E9G8X4      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRA--
A0A1E9IAW2      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRA--
A0A1E9ZBC9      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRA--
A0A1E9ZDP4      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRA--
A0A1F0R6B5      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRA--
A0A1F0Z7N5      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRA--
A0A1F1D897      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRA--
D2NP38          TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRA--
A0A1F1FV74      TVDVLSGSSAAKERARSYA----AIVSSEAVAQKIK--QNNPDLSL-----TTGQIRA--
A0A1E9M791      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRA--
A0A291DEI8      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNNPELSM-----TTGQIRA--
A0A1S1D5T1      TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNTPELSL-----TTGQIRS--
A0A1E8TRD6      TVDVLSGSSAAKERARSYA----AIVSSEAVAQKIK--QNNPELSL-----TTGQIRA--
A0A1F0XT88      TVDVLSGSSAAKERARSYA----AIVSSEAVAQKIK--QNTPELSL-----TTGQIRA--
A0A1F1EVP5      TVDVLSGSSAAKERARSYA----AIVSSEAVAQKIK--QNNPELSL-----TTGQIRA--
C6R548          TVDVLSGSTAAKERARSYA----AIVSSEAVAQKIK--QNTPELSL-----TTGQIRS--
A0A0K2RXS2      TVDVLSGSSAAKERARSYA----AIVSSEAVAQKIK--QNNPELSL-----STGQIRA--
A0A1F0KX60      TVDVLSGSSAAKERARSYA----AIVSSEAVAQKIK--QNNPELSL-----STGQIRA--
A0A542I3V2      VNTLLTGDALAKSKIKNYE----SIAESRLIADQVI--ATV-GLNT-----TADALLP--
A0A2T0UZ65      TGDVFAGSTLAGSKAESYL----PLINSRAVGKRAG--EII-GSDA-----PPEVLAA--
A0A1R4JTI6      LGIALTADNLAKSKATQYQ----ELATSRAVAEGAV--KQA-GLDI-----SPEAASG--
A0A4R7TM52      TGGALIADNLAKSKVKSYL----DVGTWRSVADDAI--SQL-GLNT-----QPEALVR--
A0A542XE74      VGDTMSGDTVTVSRASMYA----SLVNTSAVAQRAD--R---TLAS-----QGITRDG--
A0A0G3V3F3      LGINADQATFL---AKSYA----LYAETPRVTAAAA--KSS-GLDI-----TANDAAS--
A0A0Q7QDF6      ------ATSLSGRAVESYA----HVLGGTALEQRAV--KAL-GLED-----AGDA-----
A0A3S0V9U6      AGEILSGDAAAQSKAKAYL----PLITSAPVAQKIA--SSS-KTSL-----DAAAIPS--
A0A5R8L819      AGSALIGENLAKAKVKSYI----DLGSWRAVAQHAI--DEL-GLKV-----TPEYLVN--
A0A261FQA1      AQSAAADGSTSDSRMGVVS----RVATSSAVLEPVI--DEL-DLDT-----SVDAMAS--
A0A1Q2CJ92      VGDAFAGSTLAAEKAGTYL----PLVQSRSVANRIA--EEL-ALP------STGPVVG--
A0A2T0S3C8      VTDAYQGGLFSQQRVKSYA----TLLTGDRLAKVVA--AKTPGLEL-----TPAEVRE--
A0A4Y8WZJ3      LGVALTADNLAKSKAQQYA----LLGESRAVSDKAV--EEL-PFDL-----SSGEALR--
A0A285VUW0      SGNLY---QMPAGERSTLA----RIARSPLMLDPVR--ETL-GLDA-----SVPLSVE--
A0A2R7Z032      AGEEMSNQSLASDKAALYV----ALANTTPVAERVV--EKL-GLDV-----DPGAIAG--
A0A1I0W453      AGEEQGNAQLAEDKANLYA----FLVSKTPVAAQVV--EDL-DLDV-----PPEAIAG--
A0A1H4LCS9      AGEEQNNAQLAEDKANLYA----FLVSKLPVAQLVV--DDL-GLDV-----PPEAIAG--
A0A4Q2RZP8      AGEEQGNAQLAEDKANLYA----FLVSKLPVAQLVV--DDL-GLDV-----PPEAIAG--
A0A0Q6VV12      AGEEQGNAALAEEKAGLYA----FLVSSMPVAEKVV--DDL-GLDV-----PPSEIAG--
A0A495NTA9      AGEEQGNSALAEEKAGLYA----FLVNSEPVAEKVV--EDL-GLST-----PPSEIAG--
A0A0Q9QB08      AAEEQGNASLAEDKANLYA----FLVPTTPVAEQVV--KEL-GLDM-----PPSAIAS--
A0A4Q2SA86      AGEEQGNAQLAEDKAVLYA----FLVSTTPVAEKVV--EDL-GLDV-----PPSAIAG--
A0A4Z1C3Z0      AAEEQGNAQLAEDKAVLYA----YLVSTTPVAERVV--EDL-GLDV-----PPSAIAG--
A0A4Q2JUT1      VSNVSLGDSVARSRVPSYL----VMAGWTDVAQGVI--DDL-DLST-----TPEALIQ--
A0A542J310      VSNVSLGDSVARSRVPSYL----VMAGWTDVAEGVI--ADL-GLET-----TPEALIE--
A0A444BL03      TGESIAANSLGGSKADSYL----PLVTSRAVAQRAI--TAT-GIDA-----SPEDVAR--
A0A4Y8X357      GEASISGTETAQTRAQSYV----PLINSRTVRERIS--QG-----------GVDTAGA--
R4LD52          VTDAYQGGLFSQQRVKSYA----SLLVSDRLAQLVA--AEP-GVGL-----DARHIRE--
A0A4T2CD79      IGDTVASDALAKSKATTYV----AVGESRAVAQLVI--TAL-GLTA-----SPETVAG--
A0A2N3YJR1      TGEGIAANALSGSKADSYL----PLVTSRAVAQRAI--EAT-GVKA-----SPASVAS--
A0A6G8FYB9      TGDSLAANSLGGSKADSYL----PLVTSRAVAERAI--AAT-GIDA-----SPAEVAG--
A0A4Q4D742      GQTEYVAAYTLQQRVASYA----DLAVDPAVLQTVV--DRL-NLDE-----SPTQLAG--
A0A4Q2RU39      AGEEQGNNQVAEDKANLYA----FLVSKTPVAQEVV--DEL-GLDV-----PPSAIAG--
A0A4Q2SK58      AGEEQSNSQLAEDKANLYA----FLVTKTPVAAEVV--DDL-GLDV-----PPEAIAG--
A0A1C6T1J1      VAAAYQGGLFLQQRIKSYA----DLLVSDRLAQSVV--AEG-QVGL-----TAEQIQG--
A0A2W2CFC8      VSDAYQGGLFLQQRVKSYE----QLLTSDRLARSVV--ADN-QLGL-----TAEQVRG--
A0A2W2A4B0      ALDLAQGTNAAQQRIHSYL----DLVPQPIVLQPVI--DEL-HLDV-----KASELAR--
A0A4Y9MDA5      AGDLAQGSNYLQGQVTSFA----LLAETPTVLGPAG--EAP-DVAA------TGSLAG--
A0A1H7N9P7      AGDLAQGSNYLQSQVASFA----LLAETPTVLGPAG--EAP-DVAA-----GSRSLAA--
A0A1M7V0F8      AGDLAQGSNYLQSQVSSFA----LLAGTPTVLGPAG--ERA-GVSA-----DARSLAG--
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ----------------------------------------------------MAQLKE--
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A4Y5YMQ6      -----------------------MLSFASLATSGAVLEPVVEDLAEAGIDISLPQLRR--
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      --------------------------------------IEK-------------------
A0A538AM15      --------------------------------------MSK-------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      -------------------------------------ALRGQIESSSLPAVV--------
A0A348NU28      -------------------------------------SIEVTIPLNTVILEIKSSSG---
A0A4Q5APW3      -------------------------------------QVSVTNPTNTAFVNISVTDG---
A0A4Q5B0V3      -------------------------------------QVSVTNPTNTAFVNISVTDG---
A0A222TG79      -------------------------------------KLSTSWDPDTVLLNVTVEDS---
A0A6I3DFP2      ------------------------------------------------------------
A0A1Q2CRV2      -------------------------------------RVAVTIPAQTATMDLAVTAD---
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          -------------------------------------SLSVSTSPDTVLLVVTAENA---
A0A1L2ZMQ6      -------------------------------------SITAAVLEGSTELRVTASAS---
A0A3L8NYD3      -------------------------------------RFSAVGDADNPQLTIYATAS---
A0A1M6K628      -------------------------------------DAKNDGVI----FEITAQAP---
A0A561E8R3      -------------------------------------SVSAVSSV----INFTAISS---
A0A3E2DN22      -------------------------------------QVSASVPGDTAFIDIKATGG---
A0A3Q9ULZ9      -------------------------------------TLAAKVVSGTSFIKITATGS---
A0A3S9JFL2      -------------------------------------TLSAKVVTGTSFIRITATGS---
A0A1Q2CI19      -------------------------------------QITVETQGESASVTITTTAS---
A0A512T3M3      -------------------------------------RIDVGQDSEAMALTITSSNT---
W6JTW4          -------------------------------------RIVVAPDPAASTISISATDP---
A0A0A0JTY0      -------------------------------------GLTVVTDPAAQAITVAATAS---
A0A0A0JXF2      -------------------------------------GLTVTPDNAAEALTVSATAS---
E6S8H2          -------------------------------------GLTVTPDFSAGALTVAVTDA---
A0A0A0JGH0      -------------------------------------QVTITSDPSGAALTIAASDR---
N0E4U7          -------------------------------------QITVTPDPAAAALTIAASAP---
A0A0A0IYK2      -------------------------------------GLTVTPDVVAAAITVSATAS---
A0A0Q9L0H3      -------------------------------------GLTVTPDTVAQALTVSATAS---
A3TMK0          -------------------------------------GLTVTPDTVSQALMVSATAS---
A0A543PXP1      -------------------------------------GLTVTPDFNAAALTVAATAP---
A3TMH6          -------------------------------------GLTVKPEFIATALTVSATAS---
A0A1H6WL79      -------------------------------------SISVSVPLDSVEIRITARSS---
A0A101LAM5      -------------------------------------SISVSVPLDSVEIRVSARSS---
A0A4Y3NEG0      -------------------------------------SVSVSVPLDSVEIRISARSS---
A0A1H6YPK1      -------------------------------------RISVSGSTETAIMLFTGTGS---
A0A2R7MGI0      -------------------------------------RVRVSNPVDTVNVRVDATGP---
A0A2T7WQY4      -------------------------------------RVRVSNPVETVNVRVDATGS---
A0A1G6GTN3      -------------------------------------RIRVSNPVDTVNVRVEATGP---
A0A1N7DLV3      -------------------------------------RIRVSNPVDTVNVRVDATGP---
A0A1V2NSB5      -------------------------------------RVHVSNPVDTVNVRVDATGP---
A0A0Q5Q5L3      -------------------------------------RIRVSNPVDTVNVRVDATGA---
A0A0Q6DVM4      -------------------------------------RIRVSNPVDTVNVRVDATGA---
A0A1R3WWR6      -------------------------------------RVHVSNPIDTVNVRVDATGP---
A0A5Q2FA83      -------------------------------------NVTAKAATGSPMLDITATSS---
A0A542FTE6      -------------------------------------ATTPYLADDSSLIQISASAS---
A0A2S5UYV0      -------------------------------------RLSASVAPGSNLIQVQASAD---
A0A2S5X9U6      -------------------------------------RLSATVAPNSNLINVQATAS---
A0A2S5ULV5      -------------------------------------RLSATVAPNSNLIQVSASAS---
A0A653YMF0      -------------------------------------RLSATVAPSSNLIQVSASAS---
A0A4V1VGV9      -----------------------------------------ASSEGSATLTLTASAA---
A0A3Q9IY80      -------------------------------------RVQVSNPTDTVNIRVVASAS---
A0A0F0LP73      -------------------------------------SLSAQVVPGSTMVRVTANAP---
A0A1F1X071      -------------------------------------SLQTTLDPNAPIITVEAVAP---
A0A3R8RWC7      -------------------------------------SLQTTLDPNAPIITVEAVAP---
A0A4U0RJZ4      -----------------------------------------AGSEGTSNLSLTASSS---
A0A4R1FGL9      -----------------------------------------AGSEGTSNLSLTASSS---
E3B8H1          -----------------------------------------AGSEGTSNLSLTASSS---
A0A0Q5AWK6      -------------------------------------RLTASVAPGSTLIQVTAEAS---
A0A3N1NLD3      -------------------------------------RLTAAVAPGSTLIEVTASAS---
A0A3N2FVI8      -------------------------------------RLTAAVAPGSTLIEVTASAA---
A0A2S5XDQ6      -------------------------------------RLTARVAPGSTLIEVTAAAG---
A0A2S5XNN6      -------------------------------------RLTARVAPGSTLIEVTAEAG---
A0A3L7ADK2      -------------------------------------RITALQPQDTVLIEITAKGP---
A0A6I2XCV4      -------------------------------------LIAAQDQSNVSAIDVTAIST---
A0A5R8VLL6      -------------------------------------AVTVTVPRDTAEMRIKAESP---
A0A538JQF8      -------------------------------------NVQARPNVEVGTLTITANDR---
A0A0Q5JKD6      -------------------------------------RVRVSNPIETVNVRVDATGP---
A0A0Q9TBP0      -------------------------------------LVSVQAVGTSRILRVTAQDS---
A0A346XTB0      -------------------------------------NFDIESSAETLEIVLVAEDE---
A0A0G3V3M7      NKCTETGADATSPDCKKSGRRVSAGSGQVELGTGGFIKASAIPDPATGSLAITAQVG---
A0A6I3DD56      NKCAETGADSSSPDCKKSGRPVSAGSGQVQLGTGGFIKASATPDPATGSLAITAQVG---
A0A2W6DK08      -------------------------------------KVTAVADKPSNAINITASDV---
A0A2S0LQ32      -------------------------------------SLTGAAEPSSPIVTITAVSS---
A0A2N6V1R5      -------------------------------------TLSGSADAVPGLFTLTATAS---
G9PHS6          -------------------------------------TLSGSADAVPGLFTLTATAS---
U1PLM7          -------------------------------------TLSGSADAVPGLFTLTATAS---
A0A6I1G2U1      -------------------------------------QLTVTPNPSAQSLTVEMSGA---
A0A351ETF8      --------------------------------------VKVAAAGTGSTLTFNARGA---
A0A349B7N2      -------------------------------------QVQVRQNPQVATLDITSVGT---
A0A346Y185      -------------------------------------QSRIRPASDLDQLSISATDG---
A0A259S8H9      -------------------------------------SLSARVVPGSTLVEVTADAA---
A0A0Q5L115      -------------------------------------RVTTSLPEDTAIITVTSRGS---
A0A2W1Z497      -------------------------------------RVQTRLPEGTAIIDVTASGA---
A0A1H4I042      -------------------------------------EVSARSKMGTVLIDVDVLDP---
A0A4R7A6D9      -------------------------------------EVSARSKMGTVLIDVDVLDP---
A0A4Q4D4T1      -------------------------------------EVVG----NSSVVRVVVRTT---
A0A261FE22      -------------------------------------NVSASASDGSAFVSMTVTYS---
A0A5C8C085      -------------------------------------RISAEQPTDTVLIKITAKAD---
A0A1E4BP96      -------------------------------------NVTVSNPLDTVVIHVAATAA---
A0A101KZQ4      -------------------------------------SISIANPVDTATLKVSAESN---
A0A439DNZ6      -------------------------------------KVKASSKLDTVLINVSVLDE---
A0A0J6YE86      -------------------------------------RITATAKPDTVLIDVAVLDE---
A0A5Q5BFU2      -------------------------------------NVKAGAKPDTVLIDVAVLDQ---
A0A151BT98      -------------------------------------TVSATLSDTANIMTATASSG---
A0A2Y8ZRF8      -------------------------------------NVNATLSDTANIMTGTASSG---
A0A2R9UAT1      -------------------------------------RVDVTNATGTVTIKVQASAP---
A0A4Q5J5D7      -------------------------------------KISVEQPLDTVLIKVTARDA---
A0A1Y4CKD6      -------------------------------------TIEAQTIDNSNMVTMWVDSA---
A0A0Q7KBQ4      -------------------------------------QVTAQIIATTQTLQVDVTAD---
A0A1F1IHY9      -------------------------------------NVEVASTSGSAQIVVRAEDS---
A0A542HCT5      -------------------------------------RITVKQPLDTVGIKISARAS---
A0A2S8WHZ8      -------------------------------------KVEVTVPTNTAEIRVTASSQ---
A0A537WNY9      -------------------------------------AISVETFKGTGIIKITARST---
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      -------------------------------------SVSCSQVSGTNLLTLSVTSP---
A0A0Q5M6Z7      -------------------------------------HIQASLPADTAVIEITARAS---
A0A3N3ZPU0      -------------------------------------DVAFSVVPGTSQIKVEGRSD---
A0A359IQX7      -------------------------------------SLSPGVTGGSVLFTVTAIAP---
A0A4R8TXC3      -------------------------------------SVTASTDENSSLIKVSAHAS---
A0A433EDP2      -------------------------------------SVTASTDENSSLIKVSAHAS---
A0A231VTW0      -------------------------------------SVTASTDENSSLIKVSAHAS---
A0A433ECD0      -------------------------------------SVTASTDENSSLIKVSAHAS---
U7V3Z1          -------------------------------------SVTASTDENSSLIKVSAHAS---
A0A1F1J417      -------------------------------------SLSATTEENSSLIKVRATAS---
A0A2A8D6P2      -------------------------------------SLSATTEENSSLIKVRATAS---
A0A1F0THV9      -------------------------------------SLSATTEENSSLIKVRATAS---
A0A5F0M6Y0      -------------------------------------SLSATTEENSSLIKVRATAS---
D8USQ4          -------------------------------------SLSATTEENSSLIKVRATAS---
E3H5W1          -------------------------------------SLSATTEENSSLIKVRATAS---
A0A1F1QKB0      -------------------------------------SLSATTEENSSLIKVRATAS---
A0A509JY23      -------------------------------------SLSATTEENSSLIKVRATAS---
A0A448USF4      -------------------------------------SLSATTEENSSLIKVRATAS---
A0A0Q9LZR0      -------------------------------------SITVTQPVDTVLLKISARAA---
A0A1N7E3F1      -------------------------------------RITANAIPETTLLRATVADS---
A0A544ZKQ1      -------------------------------------RITAGAVPDTTLLRATVADS---
A0A372P1T1      -------------------------------------RITADAIPDTTLLRATVADS---
A0A5D0Q2X0      -------------------------------------RITADAIPDTTLLRATVADS---
A0A5R8Z2E7      -------------------------------------RITADAIPDTTLLRATVADS---
A0A1L2ZMV4      -------------------------------------GVTFTKDPSNSQIRVTATAE---
A0A6I3F378      -------------------------------------KFNTSTTSDVVTFFVESPDAQLA
A0A1S1CAD0      -------------------------------------SITAAAGENAALITVSAKAS---
G5ET14          -------------------------------------SITAAAGENAALITVSAKAS---
A0A1E9DXX2      -------------------------------------SLTATAGENAALITVNAKAS---
A0A1E8S156      -------------------------------------SLTATAGENAALITVSAKAS---
A0A1E8S5S2      -------------------------------------SLTATAGENAALITVSAKAS---
A0A1S1DFA8      -------------------------------------SLTATAGENAALITVSAKAS---
A0A2I1Z490      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1F0DAA9      -------------------------------------SLTATAGDNAALITVNAKAS---
A0A1F0PHK9      -------------------------------------SLTATAGDNAALITVNAKAS---
A0A1F0VZG6      -------------------------------------SLTATAGDNAALITVNAKAS---
A0A1E9G8X4      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1E9IAW2      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1E9ZBC9      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1E9ZDP4      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1F0R6B5      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1F0Z7N5      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1F1D897      -------------------------------------SLTATAGDNAALITVSAQAS---
D2NP38          -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1F1FV74      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1E9M791      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A291DEI8      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1S1D5T1      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1E8TRD6      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1F0XT88      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1F1EVP5      -------------------------------------SLTATAGDNAALITVSAQAS---
C6R548          -------------------------------------SLTATAGDNAALITVSAQAS---
A0A0K2RXS2      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A1F0KX60      -------------------------------------SLTATAGDNAALITVSAQAS---
A0A542I3V2      -------------------------------------TVSVNVPVETAEIRITATSP---
A0A2T0UZ65      -------------------------------------RVAGSVAPGSVILKINATGP---
A0A1R4JTI6      -------------------------------------AVTATVPPDTAEVRLSVVQD---
A0A4R7TM52      -------------------------------------QVKVTNPTDTVNLVVQASAS---
A0A542XE74      -------------------------------------TVTATASEGSPFINVTAQAP---
A0A0G3V3F3      -------------------------------------LISASAVGDLGFLEVYAKGP---
A0A0Q7QDF6      -------------------------------------EVRGEVVGNSSVVRVVVRTT---
A0A3S0V9U6      -------------------------------------HLEPSVEDGSTLIRVRATAS---
A0A5R8L819      -------------------------------------RVAVTNPLDTVNINVRAQAS---
A0A261FQA1      -------------------------------------SVSASVDASG-LMTVTATSS---
A0A1Q2CJ92      -------------------------------------NLEGSV--DGVIFRIRATAD---
A0A2T0S3C8      -------------------------------------RITAEALPETVLLQATVTDG---
A0A4Y8WZJ3      -------------------------------------NVEVASTSGSAQIVVRAEDS---
A0A285VUW0      -------------------------------------AVPGG--DDTALFDFVVRSD---
A0A2R7Z032      -------------------------------------RFSASVDTDINLLTVQAIGT---
A0A1I0W453      -------------------------------------RFSASVDADVNALTVTAIGT---
A0A1H4LCS9      -------------------------------------NFSASVDTTVNALTVTATAS---
A0A4Q2RZP8      -------------------------------------NFSASVDTSVNALTVTAVST---
A0A0Q6VV12      -------------------------------------RFSATVNADVNALTITAIGS---
A0A495NTA9      -------------------------------------RFTATVNADVNALTVTAIGS---
A0A0Q9QB08      -------------------------------------RFSATVNSDVNAITISAVGT---
A0A4Q2SA86      -------------------------------------RFSASVDASVNALTVTAIGS---
A0A4Z1C3Z0      -------------------------------------RFSASVDASVNALTVTAIGS---
A0A4Q2JUT1      -------------------------------------RVTVENPTGTVILSVTAQAP---
A0A542J310      -------------------------------------RIVVENPAGTVILSVTARAE---
A0A444BL03      -------------------------------------RVTGTVAENSVIMQVTATGP---
A0A4Y8X357      -------------------------------------SLSAALVPGSNLITVSAIAP---
R4LD52          -------------------------------------RVAAQAVPETVLLQATVTDT---
A0A4T2CD79      -------------------------------------EITVTNIKDTPTINVTARAS---
A0A2N3YJR1      -------------------------------------RVTASVAPDSVILKVTATAP---
A0A6G8FYB9      -------------------------------------RVGASVAANSVILKVTATGP---
A0A4Q4D742      -------------------------------------QISATVVTGTINIQIDVTAD---
A0A4Q2RU39      -------------------------------------RFSATVDASVNSITISAIGT---
A0A4Q2SK58      -------------------------------------RFSASVDAAVNSLTVSAVGT---
A0A1C6T1J1      -------------------------------------RVSTSTETGTVLLRASVTDT---
A0A2W2CFC8      -------------------------------------RISTSTETGTVLLRASVVDT---
A0A2W2A4B0      -------------------------------------SVSATSPTGSVVMQIAVTSP---
A0A4Y9MDA5      -------------------------------------QVTATVVPDTVIVAITATDP---
A0A1H7N9P7      -------------------------------------QVSASVVPETVVVQISATDP---
A0A1M7V0F8      -------------------------------------RVTATVVPETVVVRIAATDP---
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      -------------------------------------QVSVTNPTNTAFVNISVTDG---
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A4Y5YMQ6      -------------------------------------AVAVTIPQNTVILDITAASA---
A0A255G8R8      --------------------------------------MTTTVPQKTVIVEVTVTDP---
A0A6G7Y423      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      -------------------------------------VIDSNIATDTGNMRVVCRLP---
A0A538AM15      -------------------------------------FFKALEQAERDRALQQGRAP---
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      --------------EPSPAAPVREPG----------------------------------
A0A348NU28      --------------DPESAAEIANGV-------------------ADSLTAVVREISPSS
A0A4Q5APW3      --------------NPAQAADIANAI-------------------AKSLSSVVENTLYA-
A0A4Q5B0V3      --------------NPAQAADIANAI-------------------AKSLSSVVENTLYA-
A0A222TG79      --------------DRSVAVVLANSV-------------------AASLQDYVESLETPA
A0A6I3DFP2      --------------DPQAAS-------------------------IQANIDALNQVEAE-
A0A1Q2CRV2      --------------SPEEAARIAHAI-------------------TERLIVAVDELSPPG
A0A2S5WZJ5      ------------------------------------------------MADVITDVETQV
K6WHS4          --------------NPDLAARLASGV-------------------SQALIEYVEVLEVPS
A0A1L2ZMQ6      --------------DPVFAQQLANVW-------------------IDALAEEAHDIESTG
A0A3L8NYD3      --------------SPSQARDLANAV-------------------IGAMSTEAAKLES--
A0A1M6K628      --------------TAEGARLMADAG-------------------IRATSVAANELETMT
A0A561E8R3      --------------TPNGARELADAA-------------------VNATRDEAAQIET--
A0A3E2DN22      --------------TAKNAQALANAG-------------------LEALISEALRMETYG
A0A3Q9ULZ9      --------------SALNAQSLANAA-------------------LVGLQAEALRMETYT
A0A3S9JFL2      --------------SAQNAQALANAA-------------------LVGVQAEALRMETYS
A0A1Q2CI19      --------------DGERAANVVNTF-------------------ANETIAFFET-SPPG
A0A512T3M3      --------------DSKRAGLIVNTF-------------------ADEAVAFFSG-TRPE
W6JTW4          --------------HATTAESIAQTF-------------------AEAAKAYFAK-ASP-
A0A0A0JTY0      --------------DGKQAAAVANAF-------------------ANETINYIKEKPRAG
A0A0A0JXF2      --------------DGEEAAAVANAF-------------------ATETVKFFKETSPPG
E6S8H2          --------------EGKRAASIANTF-------------------ADETVTYFKK-NRPG
A0A0A0JGH0      --------------DGAKAAETANAF-------------------AKQTVAFFAK-PRPG
N0E4U7          --------------DGERAAATANAF-------------------ADETVAFFEK-GAPG
A0A0A0IYK2      --------------DGSRAAAVANAF-------------------ATETVKFFRERSRPG
A0A0Q9L0H3      --------------DGKQAAAVANAF-------------------ATETVKFIEERKRPG
A3TMK0          --------------DGKQAAAVANAF-------------------ANQTVLFIEQARRPG
A0A543PXP1      --------------DGQRAAAVANAF-------------------ADETVAFFKQ-SRPG
A3TMH6          --------------DGARAAAVANAF-------------------ADEAVSFFDT-PRPG
A0A1H6WL79      --------------DAQTAQNVADAW-------------------VAALASQVYELDKGN
A0A101LAM5      --------------DPQTAQNVADAW-------------------VTALAAQVYELDKGN
A0A4Y3NEG0      --------------DPQTAQNVADAW-------------------VAALASQVYELDKGN
A0A1H6YPK1      --------------APESAQELVNAW-------------------MDATFLVVSDVERTS
A0A2R7MGI0      --------------TPESARDLAEAW-------------------IRGMTTQVDDLETGG
A0A2T7WQY4      --------------TPESARDLAEAW-------------------IRGMTTQVDELETGG
A0A1G6GTN3      --------------TPESARDLAEAW-------------------IRGMTVEVDQLETGA
A0A1N7DLV3      --------------TPEAARDLAQAW-------------------LQGMTVQVDQLESTG
A0A1V2NSB5      --------------TPEAARDLAQAW-------------------LHGMTVQVDQLESTG
A0A0Q5Q5L3      --------------TPESARDLAEAW-------------------IRAMTTQVDELESGG
A0A0Q6DVM4      --------------TPESARDLAEAW-------------------IRAMTTQVDELESGG
A0A1R3WWR6      --------------TPESARDLAEAW-------------------IRGMTTEVDQLQSGG
A0A5Q2FA83      --------------SPRVAADAANAV-------------------GPQLASIGKEFAPLL
A0A542FTE6      --------------TPEAARVLADAW-------------------IAAMSQRVEELEVPE
A0A2S5UYV0      --------------SPSSAVALANGA-------------------LQALADVITDLESQA
A0A2S5X9U6      --------------TPSSAVALANGA-------------------LQAMADVITEIETQV
A0A2S5ULV5      --------------TPSSAVALANGA-------------------LQAMADVITEIETQV
A0A653YMF0      --------------TPSSAVALANGA-------------------LQAMADVITEIETQV
A0A4V1VGV9      --------------TPAKAQRAADLA-------------------RTALADEAKYLETVG
A0A3Q9IY80      --------------SPEGARDLAQAW-------------------IRAMATEVENLETSG
A0A0F0LP73      --------------DPQSALRLANGA-------------------LHALANVVARIEDAA
A0A1F1X071      --------------TAEEASAIANAA-------------------VEATAAEARELETGG
A0A3R8RWC7      --------------TAEEASAIANAA-------------------VEATAAEARELETGG
A0A4U0RJZ4      --------------SAAKAQQAANLA-------------------PAALSQEIKHIETLN
A0A4R1FGL9      --------------SAAKAQQAANLA-------------------PAALSQEIKHIETLN
E3B8H1          --------------SAAKAQQAANLA-------------------PAALSQEIKHIETLN
A0A0Q5AWK6      --------------TPENAAALANGA-------------------LAALAAVIADIETQS
A0A3N1NLD3      --------------TPENAAALANGA-------------------LAALADVIADIETQS
A0A3N2FVI8      --------------TPENAAALANGA-------------------LAALADVIADIETQS
A0A2S5XDQ6      --------------TAQNAAALANGA-------------------LAALAAVITDIETQS
A0A2S5XNN6      --------------TAQNAAALANGA-------------------LAALAAVITDIETQS
A0A3L7ADK2      --------------TGDSARTLADAW-------------------ITAMSEQIEAIQGND
A0A6I2XCV4      --------------DPQFAVTLADTSAKILMDSWSTDSKRRAAESSDAVIARIDELAAKR
A0A5R8VLL6      --------------NPTTAQRVADAW-------------------IVELARQVEERER--
A0A538JQF8      --------------DPKRAALIADTFADSLKTVLADQTTQRRQLQIDSQLKAAEQIQGQI
A0A0Q5JKD6      --------------TPESARDLAEAW-------------------IRGMTEEVDQLETGG
A0A0Q9TBP0      --------------SPDRAARTANIVATSYLQFREQDSVGRYEQARDRLAQEQADIESRL
A0A346XTB0      --------------TAEGAAELVNAVAEAYRTQKRAQEVQRAEDAVAELRAQQVRLEEER
A0A0G3V3M7      --------------DAELAAKVANLFAAKLVGYVDELGQKQYDEQIFGLTISRGNSETLI
A0A6I3DD56      --------------DAVLAAKVANLFAATLVGYVDELGQKQFDEQIFGLTLSRSNSETLI
A0A2W6DK08      --------------DPQNAVALANAFAAGTVDEFRARHAAAAAARFRSLEGQLTEVDNQL
A0A2S0LQ32      --------------DPSRARDLANAA-------------------IPALGSYIASLEAIG
A0A2N6V1R5      --------------TPERARDIANAG-------------------IKAVSDEANAITTLN
G9PHS6          --------------TPERARDIANAG-------------------IKAVSDEANAITTLN
U1PLM7          --------------TPERARDIANAG-------------------IKAVSDEANAITTLN
A0A6I1G2U1      --------------DAEYVAAVANAFAEQSVAYFATPRDGTGEAELSILAEA--------
A0A351ETF8      --------------VPEDLAAAANVWAQTYVTARYAETLAQNVESIEFLQALIAEIAEDR
A0A349B7N2      --------------DPDRAVRIADGFAGALLATLTETTQQERAEAQTRLSARLDELEARL
A0A346Y185      --------------TASGAAQIANAIGEAYQAVVREEAERSTQASLSELQTQRAALEDAI
A0A259S8H9      --------------DPKSALKLANGA-------------------LHALAKVVAHIEQVA
A0A0Q5L115      --------------TPADAAALTDAW-------------------LAAMGEQIAAMQE--
A0A2W1Z497      --------------TPRESADLADAW-------------------IAGMGRQIAAIQS--
A0A1H4I042      --------------SPVRARDIANTL-------------------SDQFVKMVRELETPG
A0A4R7A6D9      --------------SPVRARDIANTL-------------------SDQFVKMVRELETPG
A0A4Q4D4T1      --------------DPERAAQLAGQV-------------------AEELVSWIASYQDRA
A0A261FE22      --------------DPNDTVTILNEV-------------------VKQLNKQIT------
A0A5C8C085      --------------SPHAAQALADAW-------------------IVALQDQIEAVENPN
A0A1E4BP96      --------------TPESARDLAEAW-------------------IRGMTAAIDDIEGTG
A0A101KZQ4      --------------TPESAQQLAEAW-------------------VKAIENQVSEVENSS
A0A439DNZ6      --------------SPVRARDIADAL-------------------SEEFVVMVRELETPP
A0A0J6YE86      --------------SAVRARDIANTL-------------------SDEFVGRVRELETPE
A0A5Q5BFU2      --------------SPVRARDIANTL-------------------SDEFVAMVRELETPE
A0A151BT98      --------------SAQEAAAIANAT-------------------GPALAAVAPQFSQL-
A0A2Y8ZRF8      --------------SAQEAAAIANAT-------------------GPALAAVAPQFSQL-
A0A2R9UAT1      --------------TPETARDLAEAW-------------------IQGMATEIDGLESDG
A0A4Q5J5D7      --------------TPLGAQQLADAW-------------------VSALADQVAEIENP-
A0A1Y4CKD6      --------------SPENARAILEKA-------------------LEVYPEVS-------
A0A0Q7KBQ4      --------------SAELAQQIAEAE-------------------AEGIVSLVARLEKPT
A0A1F1IHY9      --------------SPERAQQLASAW-------------------LGALEAQATEVEAGG
A0A542HCT5      --------------TPRGAQQLADAW-------------------VAALARQVQAVENPT
A0A2S8WHZ8      --------------GAEEARNLADAW-------------------VVALAAQVEELESVS
A0A537WNY9      ------------------SRSLAQQS-------------------AQAATDALVERTRSG
A0A5B8M469      ---------------------------------------------------MITEIQKAG
A0A1Y4CTD2      --------------TPRQAYLFIQSA-------------------LQNYE----------
A0A0Q5M6Z7      --------------TPDGAAKLANAW-------------------IAGLTKQVRALEAPE
A0A3N3ZPU0      --------------SPEGSAKVADAY-------------------AGALTQEVQRIESIA
A0A359IQX7      --------------TPSEAKDAADLG-------------------LTATADAAARLESLT
A0A4R8TXC3      --------------TPEQAQVLANSA-------------------LHATAEYIKNIEGNN
A0A433EDP2      --------------TPEQAQVLANSA-------------------LHATAEYIKNIEGNN
A0A231VTW0      --------------TPEQAQVLANSA-------------------LHATAEYIKNIEGNN
A0A433ECD0      --------------TPEQAQVLANSA-------------------LHATAEYIKNIEGNN
U7V3Z1          --------------TPEQAQVLANSA-------------------LHATAEYIKNIEGNN
A0A1F1J417      --------------SPEQARVLANSA-------------------LHATAQYIENIEKNG
A0A2A8D6P2      --------------SPEQARVLANSA-------------------LHATAQYIENIEKNG
A0A1F0THV9      --------------SPEQARVLANSA-------------------LHATAQYIENIEKNG
A0A5F0M6Y0      --------------SPEQARVLANSA-------------------LHATAQYIENIEKNG
D8USQ4          --------------SPEQARVLANSA-------------------LHATAQYIENIEKNG
E3H5W1          --------------SPEQARVLANSA-------------------LHATAQYIENIEKNG
A0A1F1QKB0      --------------SPEQARVLANSA-------------------LHATAQYIENIEKNG
A0A509JY23      --------------SPEQARVLANSA-------------------LHATAQYIENIEKNG
A0A448USF4      --------------SPEQARVLANSA-------------------LHATAQYIENIEKNG
A0A0Q9LZR0      --------------TPRGAQQLADAW-------------------VAALARQVQAVENPT
A0A1N7E3F1      --------------VPTRAAARANAL-------------------GAAFARLIDQIERPT
A0A544ZKQ1      --------------VPARAAARANAL-------------------GAAFAQLIDKIERPT
A0A372P1T1      --------------VPVRAAARANTL-------------------GATFAALIDRIERPT
A0A5D0Q2X0      --------------VPVRAAARANTL-------------------GATFAALIDRIERPT
A0A5R8Z2E7      --------------VPVRAAARANTL-------------------GATFAALIDRIERPT
A0A1L2ZMV4      --------------NPEHARASADAF-------------------ASALAEEAERVERVM
A0A6I3F378      ADVANAYIEQYNIYTAKISADTLAGA-------------------VDSLQQQIDDLQKQI
A0A1S1CAD0      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
G5ET14          --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1E9DXX2      --------------SPKNAQLLANSA-------------------LQATADYIKEIEQNP
A0A1E8S156      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1E8S5S2      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1S1DFA8      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A2I1Z490      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1F0DAA9      --------------SPKNAQVLANSA-------------------LQATADYIKEIEQNP
A0A1F0PHK9      --------------SPKNAQVLANSA-------------------LQATADYIKEIEQNP
A0A1F0VZG6      --------------SPKNAQVLANSA-------------------LQATADYIKEIEQNP
A0A1E9G8X4      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1E9IAW2      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1E9ZBC9      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1E9ZDP4      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1F0R6B5      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1F0Z7N5      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1F1D897      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
D2NP38          --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1F1FV74      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1E9M791      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A291DEI8      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1S1D5T1      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1E8TRD6      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1F0XT88      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1F1EVP5      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
C6R548          --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A0K2RXS2      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A1F0KX60      --------------SPKNAQLLANGA-------------------LQATADYIKEIEQNP
A0A542I3V2      --------------DPVMAQRVADAW-------------------VAELAKRVQLLESFV
A0A2T0UZ65      --------------TPTDARDLADAT-------------------MEAVAAEANRLELGG
A0A1R4JTI6      --------------SPDAARALADSW-------------------VSSLAEEVSNIENQT
A0A4R7TM52      --------------TPEGARDLAQAW-------------------VKAMSNEVKKLESA-
A0A542XE74      --------------TARDAQALANAT-------------------LSALRVEALRLETFG
A0A0G3V3F3      --------------SVSEAEQLSSAA-------------------TVALIDAVRAQQTAS
A0A0Q7QDF6      --------------DPERAAQLAGQV-------------------AEELVSWIASYQDRA
A0A3S0V9U6      --------------SPEDAVALANAS-------------------LKATADTVNEIDGSR
A0A5R8L819      --------------TPEGARDLAQAW-------------------LAGMAVEVQNLEGGS
A0A261FQA1      --------------DSQQAADIANAV-------------------YDSLVQQIEDDSFAS
A0A1Q2CJ92      --------------SPELAASLADAA-------------------IRATSVEANALETLT
A0A2T0S3C8      --------------SAERSRLIAGVL-------------------AREFTTMVEALETPR
A0A4Y8WZJ3      --------------SPERAQQLASAW-------------------LGALEAQATEVEAGG
A0A285VUW0      --------------SPDHASAVAEAL-------------------PQQLATTARSYAPTL
A0A2R7Z032      --------------TPEEARDLASIV-------------------VQAIADEAEEIENTG
A0A1I0W453      --------------TPEEARDLANAV-------------------VDAVVVVAQEIETGE
A0A1H4LCS9      --------------TPQDAQDLANAV-------------------IKAVVVYAAQVDNGG
A0A4Q2RZP8      --------------SPTDARDLANAV-------------------IDAVVIYAAQVENGG
A0A0Q6VV12      --------------TPEQARDLANGV-------------------VDAVVEYAQEVDTGE
A0A495NTA9      --------------TPEEARDLATSV-------------------VDAVVEYAQEVDTGE
A0A0Q9QB08      --------------TPEEARDLANAV-------------------VDAVVVVAQQYETGE
A0A4Q2SA86      --------------TPEEARDLASAV-------------------VDAVVVYAQEVETGE
A0A4Z1C3Z0      --------------TPQEARDLATAV-------------------VDAVVVYAQEVETGE
A0A4Q2JUT1      --------------TAEGARELAEAW-------------------LISLGSVVEEVEVES
A0A542J310      --------------TAEGARALAEAW-------------------LSSLGEVVDEVEKES
A0A444BL03      --------------TPDESRRLADAV-------------------IKATAQEANRIETTG
A0A4Y8X357      --------------DAQQAAALANTA-------------------LVATADVANGLDP--
R4LD52          --------------DRDRSARIATVL-------------------AGQFKQLVESLETPP
A0A4T2CD79      --------------SGIEAKKLADAW-------------------IVGLTTQIATLENKA
A0A2N3YJR1      --------------SPEEARVLADAV-------------------IKATAEEANRIETAG
A0A6G8FYB9      --------------TPEESRVLADAV-------------------IKATAEEANAIETAA
A0A4Q4D742      --------------TAEQAQLIAGAE-------------------ADAIVALVKRLERPA
A0A4Q2RU39      --------------TPVEARDLANAV-------------------VDAVVVVAEDV----
A0A4Q2SK58      --------------TPEEARDLANAV-------------------VDAVVVVARDI----
A0A1C6T1J1      --------------DQTRALKLTELL-------------------SAKFVDLVQKVETPP
A0A2W2CFC8      --------------DQTRALRVTEAV-------------------SAKFVELVKQVETRP
A0A2W2A4B0      --------------DRQRVAEITDSI-------------------VRSFSSVVQDRLDAN
A0A4Y9MDA5      --------------SADRAAAIANAV-------------------ATQLERAVLDLSPVG
A0A1H7N9P7      --------------SPARAAAIANAV-------------------AAELELAVEGLSPAG
A0A1M7V0F8      --------------SPARAAAIADAV-------------------ADQLERTVEQLSPAG
A0A022KX11      ---------------------------------------------------MAGEFSTLL
A0A4Q5A868      --------------DPAQAADIANAI-------------------AKSLSSVVETTLYAS
A0A345NSU7      ----------------------------------------------------------ML
A0A0W8I9Y2      ------------------------------------------------------------
A0A4Y5YMQ6      --------------DPRDAAEIANSV-------------------ADNLTEVVYDIAPKD
A0A255G8R8      --------------DAASAARIANAI-------------------GDQVAETVRELSPKR
A0A6G7Y423      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      --------------DPLRAERCANAF----------------------------------
A0A538AM15      --------------EAPPPAPVVPEV----------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      VDGVDK------------------------------------------------------
A0A3L8NYD3      -AARPS------------------------------------------------------
A0A1M6K628      VTGEPT------------------------------------------------------
A0A561E8R3      -TGEPA------------------------------------------------------
A0A3E2DN22      QIAASDHK----------------------------------------------------
A0A3Q9ULZ9      QAQANPGY----------------------------------------------------
A0A3S9JFL2      QAQANPGY----------------------------------------------------
A0A1Q2CI19      AETTRL------------------------------------------------------
A0A512T3M3      AAGTRL------------------------------------------------------
W6JTW4          SGGTRL------------------------------------------------------
A0A0A0JTY0      VENARL------------------------------------------------------
A0A0A0JXF2      AENTTL------------------------------------------------------
E6S8H2          VGRANV------------------------------------------------------
A0A0A0JGH0      VGRAVV------------------------------------------------------
N0E4U7          TGGAAV------------------------------------------------------
A0A0A0IYK2      AENVAV------------------------------------------------------
A0A0Q9L0H3      AETTTL------------------------------------------------------
A3TMK0          AENATL------------------------------------------------------
A0A543PXP1      TGNATV------------------------------------------------------
A3TMH6          TGTVGI------------------------------------------------------
A0A1H6WL79      ASPGTE------------------------------------------------------
A0A101LAM5      ASPGTE------------------------------------------------------
A0A4Y3NEG0      ASPGTE------------------------------------------------------
A0A1H6YPK1      RGISNP------------------------------------------------------
A0A2R7MGI0      TGQGAV------------------------------------------------------
A0A2T7WQY4      SGQGAV------------------------------------------------------
A0A1G6GTN3      GGRSAV------------------------------------------------------
A0A1N7DLV3      GGHGAV------------------------------------------------------
A0A1V2NSB5      GAHSAV------------------------------------------------------
A0A0Q5Q5L3      SGQGAV------------------------------------------------------
A0A0Q6DVM4      SGQGAV------------------------------------------------------
A0A1R3WWR6      NGESAV------------------------------------------------------
A0A5Q2FA83      NSAGQG------------------------------------------------------
A0A542FTE6      GTIRTQ------------------------------------------------------
A0A2S5UYV0      GGGVSS------------------------------------------------------
A0A2S5X9U6      GGGASG------------------------------------------------------
A0A2S5ULV5      GGGTSG------------------------------------------------------
A0A653YMF0      GGGASG------------------------------------------------------
A0A4V1VGV9      TEAKTS------------------------------------------------------
A0A3Q9IY80      GVSLAT------------------------------------------------------
A0A0F0LP73      GAGATPPP----------------------------------------------------
A0A1F1X071      NENAAV------------------------------------------------------
A0A3R8RWC7      NENAAV------------------------------------------------------
A0A4U0RJZ4      GA-KST------------------------------------------------------
A0A4R1FGL9      GA-KST------------------------------------------------------
E3B8H1          GA-KST------------------------------------------------------
A0A0Q5AWK6      TADRTP------------------------------------------------------
A0A3N1NLD3      TADRTP------------------------------------------------------
A0A3N2FVI8      TADRTP------------------------------------------------------
A0A2S5XDQ6      TADRTP------------------------------------------------------
A0A2S5XNN6      TADRTP------------------------------------------------------
A0A3L7ADK2      GVIGAQ------------------------------------------------------
A0A6I2XCV4      DELESQIARNPSQATLLRAELDSV------------------------------------
A0A5R8VLL6      ------------------------------------------------------------
A0A538JQF8      NDINLQIARAPDAGTVAALQARRQ------------------------------------
A0A0Q5JKD6      GGQS--------------------------------------------------------
A0A0Q9TBP0      SEVNALLEKNPGGQALQG------------------------------------------
A0A346XTB0      SGLQSSLEADSSNVALPFLIQSLD------------------------------------
A0A0G3V3M7      SKIDSQLAAPGLSASEYDSLDIRREAVLRKLA----------------------------
A0A6I3DD56      RQIDSQLAAPGLSASEYDSLDIRREAVLRKLA----------------------------
A0A2W6DK08      KQVT--------------------------------------------------------
A0A2S0LQ32      SGQSPSPADAQPPAAGSDQPSTPSPADEQPAAPEPATPEPRQEEPRGGNQDEGANPGTGE
A0A2N6V1R5      A-----------------------------------------------------------
G9PHS6          A-----------------------------------------------------------
U1PLM7          A-----------------------------------------------------------
A0A6I1G2U1      ------------------------------------------------------------
A0A351ETF8      DAIRVEVDFYDDLLAETTDPDEYSRYLSQ-------------------------------
A0A349B7N2      ADLDAQIE------DGAGDLVQAQRDALV-------------------------------
A0A346Y185      AAAEARLA------ASPTDASARA------------------------------------
A0A259S8H9      QSAAPVDP------SLPPEPKSAT------------------------------------
A0A0Q5L115      ---------------------EST------------------------------------
A0A2W1Z497      ---------------------SGE------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A4Q4D4T1      AERAGE------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A101KZQ4      ATK---------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      S-----------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      VGG---------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      G-----------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      G-----------------------------------------------------------
A0A3N3ZPU0      TEGNNY------------------------------------------------------
A0A359IQX7      TTG---------------------------------------------------------
A0A4R8TXC3      GGSGNA------------------------------------------------------
A0A433EDP2      GGSGNA------------------------------------------------------
A0A231VTW0      GGSGNA------------------------------------------------------
A0A433ECD0      GGSGNA------------------------------------------------------
U7V3Z1          GGSGNA------------------------------------------------------
A0A1F1J417      SGNNST------------------------------------------------------
A0A2A8D6P2      SGNNST------------------------------------------------------
A0A1F0THV9      SGNNST------------------------------------------------------
A0A5F0M6Y0      SGNNST------------------------------------------------------
D8USQ4          SGNNST------------------------------------------------------
E3H5W1          SGNNST------------------------------------------------------
A0A1F1QKB0      SGNNNT------------------------------------------------------
A0A509JY23      SGNNST------------------------------------------------------
A0A448USF4      SGNNST------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ATGGTD------------------------------------------------------
A0A6I3F378      ETLDHS------------------------------------------------------
A0A1S1CAD0      GNAQAL------------------------------------------------------
G5ET14          GNAQAL------------------------------------------------------
A0A1E9DXX2      GNAQAL------------------------------------------------------
A0A1E8S156      GNAQAL------------------------------------------------------
A0A1E8S5S2      GNAQAL------------------------------------------------------
A0A1S1DFA8      GNAQAL------------------------------------------------------
A0A2I1Z490      SNAQAL------------------------------------------------------
A0A1F0DAA9      GNAQAL------------------------------------------------------
A0A1F0PHK9      GNAQAL------------------------------------------------------
A0A1F0VZG6      GNAQAL------------------------------------------------------
A0A1E9G8X4      GNAQAL------------------------------------------------------
A0A1E9IAW2      GNAQAL------------------------------------------------------
A0A1E9ZBC9      GNAQAL------------------------------------------------------
A0A1E9ZDP4      GNAQAL------------------------------------------------------
A0A1F0R6B5      GNAQAL------------------------------------------------------
A0A1F0Z7N5      GNAQAL------------------------------------------------------
A0A1F1D897      GNAQAL------------------------------------------------------
D2NP38          GNAQAL------------------------------------------------------
A0A1F1FV74      GNAQAL------------------------------------------------------
A0A1E9M791      GNAQAL------------------------------------------------------
A0A291DEI8      GNAQAL------------------------------------------------------
A0A1S1D5T1      SNAQAL------------------------------------------------------
A0A1E8TRD6      GNAQAL------------------------------------------------------
A0A1F0XT88      GNAQAL------------------------------------------------------
A0A1F1EVP5      GNAQAL------------------------------------------------------
C6R548          GNAQAL------------------------------------------------------
A0A0K2RXS2      GNAQAL------------------------------------------------------
A0A1F0KX60      GNAQAL------------------------------------------------------
A0A542I3V2      TAGQP-------------------------------------------------------
A0A2T0UZ65      GEVK--------------------------------------------------------
A0A1R4JTI6      LPGVEQ------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      RTQGRE------------------------------------------------------
A0A0G3V3F3      LAQDIA------------------------------------------------------
A0A0Q7QDF6      ---A--------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A261FQA1      --NE--------------------------------------------------------
A0A1Q2CJ92      ITGE--------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A2R7Z032      RPAG--------------------------------------------------------
A0A1I0W453      --EN--------------------------------------------------------
A0A1H4LCS9      --TT--------------------------------------------------------
A0A4Q2RZP8      --TT--------------------------------------------------------
A0A0Q6VV12      --SN--------------------------------------------------------
A0A495NTA9      --AN--------------------------------------------------------
A0A0Q9QB08      --EN--------------------------------------------------------
A0A4Q2SA86      --ES--------------------------------------------------------
A0A4Z1C3Z0      --EN--------------------------------------------------------
A0A4Q2JUT1      ---S--------------------------------------------------------
A0A542J310      ---S--------------------------------------------------------
A0A444BL03      ---S--------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ---G--------------------------------------------------------
A0A4T2CD79      ---V--------------------------------------------------------
A0A2N3YJR1      ---S--------------------------------------------------------
A0A6G8FYB9      ---D--------------------------------------------------------
A0A4Q4D742      ---T--------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A1C6T1J1      ---S--------------------------------------------------------
A0A2W2CFC8      ---D--------------------------------------------------------
A0A2W2A4B0      ---A--------------------------------------------------------
A0A4Y9MDA5      ---E--------------------------------------------------------
A0A1H7N9P7      ---E--------------------------------------------------------
A0A1M7V0F8      ---E--------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A1Q2CI19      ------------------------------------------------------------
A0A512T3M3      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A543PXP1      ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A1H6WL79      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A0A4Y3NEG0      ------------------------------------------------------------
A0A1H6YPK1      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A5Q2FA83      ------------------------------------------------------------
A0A542FTE6      ------------------------------------------------------------
A0A2S5UYV0      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A653YMF0      ------------------------------------------------------------
A0A4V1VGV9      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
A0A4U0RJZ4      ------------------------------------------------------------
A0A4R1FGL9      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A6I2XCV4      -------------------------------------INQYRLAREQFQSIAVSDQTVAA
A0A5R8VLL6      --------------------------------------------------------AAAA
A0A538JQF8      --------------------------------------PLQVRVDRAMNQVDIIQNRPDP
A0A0Q5JKD6      ------------------------------------------------------------
A0A0Q9TBP0      ---------------------------------------------------ERRTLIASS
A0A346XTB0      ---------------------------------------------------------ARI
A0A0G3V3M7      ---------------------------------------------------NADSDLSNL
A0A6I3DD56      ---------------------------------------------------NADSGISNL
A0A2W6DK08      ---------------------------------------------------GFTGAVSTP
A0A2S0LQ32      RRSTPGRGNGTGEEKEDAAADAQARVVPAVAGTGASLVPAVAGAPQAAVGQAGVGQAGQA
A0A2N6V1R5      --------------------------------------PTVQPTTKTTTNPDGTQVTTTT
G9PHS6          --------------------------------------PTVQPTTKTTTNPDGTQVTTTT
U1PLM7          --------------------------------------PTVQPTTKTTTNPDGTQVTTTT
A0A6I1G2U1      ------------------------------------------------------------
A0A351ETF8      --------------------------------------MVSIETLLQPQLAPLEAQISEY
A0A349B7N2      --------------------------------------REYGIVYEDFQVLSREPEATVG
A0A346Y185      ---------------------------------------------------ERDAAVSQL
A0A259S8H9      ---------------------------------------------------NAAPGGIAI
A0A0Q5L115      ---------------------------------------------------DTGGSATSF
A0A2W1Z497      ---------------------------------------------------ALASATTKL
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A4Q4D4T1      ---------------------------------D--------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3N3ZPU0      ---------------------------------EPPSPSPSEDGGEEASPESS-------
A0A359IQX7      ------------------------------------------------------------
A0A4R8TXC3      ---------------------------------ANSNGGNNATPNAENGNTAGASASANT
A0A433EDP2      ---------------------------------ANSNGGNNATPNAENGNTAGANASANT
A0A231VTW0      ---------------------------------ANSNGGNNATPNTENGNTAGASASANT
A0A433ECD0      ---------------------------------ANSNGGNNATPNTENGNTAGASASANT
U7V3Z1          ---------------------------------ANSNGGNNATPNTENGNTAGASASANT
A0A1F1J417      ---------------------------------ATP------TPAGEENQESAQNKVSST
A0A2A8D6P2      ---------------------------------ATP------TPAGEENQESAQNKVSST
A0A1F0THV9      ---------------------------------ATP------TPAGEENQESAQNKVSST
A0A5F0M6Y0      ---------------------------------ATP------TPAGEENQESAQNKVSST
D8USQ4          ---------------------------------ATP------TPAGEENQESAQNKVSST
E3H5W1          ---------------------------------ATP------TPAGEENQESAQNKVSST
A0A1F1QKB0      ---------------------------------ATP------APAGEENQESAQNKVSST
A0A509JY23      ---------------------------------ATP------TPAGEENQESAQNKVSST
A0A448USF4      ---------------------------------ATP------TPAGEENQESAQNKVSST
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ---------------------------------S--------------------------
A0A6I3F378      ---------------------------------IAASGNDDDSTREAQRRELLAQQADFR
A0A1S1CAD0      ---------------------------------VNGDSTAAS------------------
G5ET14          ---------------------------------VNGDSTAAS------------------
A0A1E9DXX2      ---------------------------------VNGDNAVVS------------------
A0A1E8S156      ---------------------------------VNGENTGAT------------------
A0A1E8S5S2      ---------------------------------VNGENTGAT------------------
A0A1S1DFA8      ---------------------------------VNGENTGAT------------------
A0A2I1Z490      ---------------------------------VNGENTGAT------------------
A0A1F0DAA9      ---------------------------------VNGENTGAS------------------
A0A1F0PHK9      ---------------------------------VNGENTGAS------------------
A0A1F0VZG6      ---------------------------------VNGENTGAS------------------
A0A1E9G8X4      ---------------------------------VNGENTGAS------------------
A0A1E9IAW2      ---------------------------------VNGENTGAS------------------
A0A1E9ZBC9      ---------------------------------VNGENTGAS------------------
A0A1E9ZDP4      ---------------------------------VNGENTGAS------------------
A0A1F0R6B5      ---------------------------------VNGENTGAS------------------
A0A1F0Z7N5      ---------------------------------VNGENTGAS------------------
A0A1F1D897      ---------------------------------VNGENTGAS------------------
D2NP38          ---------------------------------VNGENTGAS------------------
A0A1F1FV74      ---------------------------------VNGENTAAS------------------
A0A1E9M791      ---------------------------------VNGENTAAS------------------
A0A291DEI8      ---------------------------------VNGENTAAS------------------
A0A1S1D5T1      ---------------------------------VNGENTGAT------------------
A0A1E8TRD6      ---------------------------------VNGENTGAS------------------
A0A1F0XT88      ---------------------------------VNGENTGAS------------------
A0A1F1EVP5      ---------------------------------VNGENTGAS------------------
C6R548          ---------------------------------VNGENTGAS------------------
A0A0K2RXS2      ---------------------------------VNGENTAAS------------------
A0A1F0KX60      ---------------------------------VNGENAAAS------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ---------------------------------SEE------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ---------------------------------TSEEQ----------------------
A0A0G3V3F3      ---------------------------------PIQAQRVILQKQLSNLPAFDPQAASIQ
A0A0Q7QDF6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A6G8FYB9      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      -------------------------------PTPATGA----------------------
A0A348NU28      ------------ANGSSRISANLVD------EAVVPNV------QAL-------------
A0A4Q5APW3      ------------SGSHSSVKLSVVQ------PAAVPSS------PSS-------------
A0A4Q5B0V3      ------------SGSHSSVKLSVVQ------PAAVPSS------PSS-------------
A0A222TG79      ------------GGGSPMAKLTTVT------PAVEPSV------PVS-------------
A0A6I3DFP2      ------------RRAQPANRVNVAA------GAHAHST------PIS-------------
A0A1Q2CRV2      ------------ADGQKPVVATVIR------QPLVPTA------PTS-------------
A0A2S5WZJ5      ------------GGGVSNVTVIPLE------DAVPPTT------PVT-------------
K6WHS4          ------------AGGDPLAKLTVVS------PATVDDA------PVS-------------
A0A1L2ZMQ6      -------------DFQPAVELMPMT------EGTLPTS------PYA-------------
A0A3L8NYD3      -----------GAPVSTLVKLVATQ------QAGAPSA------PSS-------------
A0A1M6K628      -----------D-QLV--VKIAPVE------PALTPSR------PTS-------------
A0A561E8R3      -----------GTQPS--VRIYPFD------NATTPSL------PFS-------------
A0A3E2DN22      --------SDAQLAKMTSVHVLGYE------SAGLPSG------DRG-------------
A0A3Q9ULZ9      --------TQAQLEKLTAIHVLSYE------PAGLPAT------PKQ-------------
A0A3S9JFL2      --------SQAQLEKLTAIHVLSYE------PAGLPAT------PKT-------------
A0A1Q2CI19      --------------------SVLQE------ATPIPNE-STANFVIP-------------
A0A512T3M3      --------------------SILQR------GIPVAEA--HKGTLIP-------------
W6JTW4          --------------------TIVQD------AVAVPDA--NPGSILP-------------
A0A0A0JTY0      --------------------EVLQT------ATPIPTAGSDGGFVIP-------------
A0A0A0JXF2      --------------------TILQP------ATPIPSTANDGGFVVP-------------
E6S8H2          --------------------SILQR------ATPIPNV-TGGGFVIP-------------
A0A0A0JGH0      --------------------TILQE------ATPIPDE-IGGGFVVP-------------
N0E4U7          --------------------SVLQV------ATPIPDQ-IGGGFVVP-------------
A0A0A0IYK2      --------------------SILQA------ASPVPVANSDGGFVVP-------------
A0A0Q9L0H3      --------------------SLLQP------ATPIPSAATDGGFVIP-------------
A3TMK0          --------------------SVLQP------ATPIPSATTDGGFVVP-------------
A0A543PXP1      --------------------TILQR------ATPIPNV-TGGGFVVP-------------
A3TMH6          --------------------TVLQS------ASPIPNA-DGGGFVVP-------------
A0A1H6WL79      ----------------PVTKIVPLA------KATLPSA------PVS-------------
A0A101LAM5      ----------------PVTKIVPLA------KASLPSA------PVS-------------
A0A4Y3NEG0      ----------------PVTKIVPLT------KASLPSA------PIS-------------
A0A1H6YPK1      -------------ER-TVINVMVLQ------QARLPSV------PAS-------------
A0A2R7MGI0      -------------------RLIAGD------SARLPTS------PSS-------------
A0A2T7WQY4      -------------------RLIAGD------SARLPTS------PSS-------------
A0A1G6GTN3      -------------------RLVAGD------SARLPTA------PSS-------------
A0A1N7DLV3      -------------------KLVAGD------SARLPTA------PSS-------------
A0A1V2NSB5      -------------------KLVAGD------SARLPTS------PSS-------------
A0A0Q5Q5L3      -------------------RLVAGD------SARLPTS------PSS-------------
A0A0Q6DVM4      -------------------RLVAGD------SARLPTS------PSS-------------
A0A1R3WWR6      -------------------RLIAGD------SARLPTS------PSS-------------
A0A5Q2FA83      ------------------VKATTIT------PATVPSQ------PVS-------------
A0A542FTE6      -----------------ATSFVPLA------AATTPTA------PSS-------------
A0A2S5UYV0      ------------------VTVLPLQ------DAVEPTS------PES-------------
A0A2S5X9U6      ------------------VTVVELQ------NAVEPTS------PVS-------------
A0A2S5ULV5      ------------------VTVVPLQ------NAVEPTS------PVS-------------
A0A653YMF0      ------------------VTVVPLQ------NAVEPTS------PVS-------------
A0A4V1VGV9      -----------------VYRVFPLT------AAARPSA------PSS-------------
A0A3Q9IY80      ------------------VQLVPGD------TARLPSS------PSS-------------
A0A0F0LP73      --------GSTVVPT-EGIVIVPLD------QAVAPRT------PSA-------------
A0A1F1X071      -----------------GVQLTNYQ------NAVVPGA------PVS-------------
A0A3R8RWC7      -----------------GVQLTNYQ------NAVVPGA------PVS-------------
A0A4U0RJZ4      -----------------VYDAYPLS------RAGLPAS------QTS-------------
A0A4R1FGL9      -----------------VYDAYPLS------RAGLPAS------QTS-------------
E3B8H1          -----------------VYDAYPLS------RAGLPAS------QTS-------------
A0A0Q5AWK6      -----------------QITVVPLE------NAEPAST------PTS-------------
A0A3N1NLD3      -----------------QITVVPLE------NAEPAAA------PTS-------------
A0A3N2FVI8      -----------------QITVVPLE------NAEPAAA------PTS-------------
A0A2S5XDQ6      -----------------QITVVPLE------NAEPPAA------PTS-------------
A0A2S5XNN6      -----------------QITVVPLE------NAEPPAA------PTS-------------
A0A3L7ADK2      -----------------NTKFVSVS------KAATPNS------PVS-------------
A0A6I2XCV4      FTVFQPAIAVQINGRAFAIRYDANL------NSRGSIS------ATQ------SVPKLTF
A0A5R8VLL6      AGQPAAPAGQPAPVVTPPISLVPLD------PATVPTH------PVS-------------
A0A538JQF8      LPALLTLESGSIRGGRTDLSRFLAQ------RAAATFH------PKP-------------
A0A0Q5JKD6      -----------------AVRLVAGD------SARLPTA------PSS-------------
A0A0Q9TBP0      AQVAAQIDALTDSLTTAAAGGELLH------SAEPADN------PVS-------------
A0A346XTB0      LDISGRIDATLLAVRLRGDGVEDFQ------DAIPPDF------PSR-------------
A0A0G3V3M7      QEIGPQTSGLTTLEAATKGRATIIV------SRAQGST------SES-------------
A0A6I3DD56      EDAGPQTSGLTTLEAATKARATILV------TSAKGST------SES-------------
A0A2W6DK08      VNPVLQARAAALSARYAAIYGLLQE------TANQANN------PTG----LDTLSPAAG
A0A2S0LQ32      APAAPATAAPTDETYNSQTRLVALE------PAQLPGA------PFS-------------
A0A2N6V1R5      QSVDGTTNVTTTDNSYRETRVTQTL------QAVAPSA------PSS-------------
G9PHS6          QSVDGTTNVTTTDNSYRETRVTQTL------QAVAPSA------PSS-------------
U1PLM7          QSVDGTTNVTTTDNSYRETRVTQTL------QAVAPSA------PSS-------------
A0A6I1G2U1      --------------------------------TPIPII------ASG-------------
A0A351ETF8      QRQITEFESVARFLDSPDVSAQVSQ------LAEVPTI------PVS-------------
A0A349B7N2      LRTLQPAVAVPISGDAFVAALQETL------GATDPSE------PTAIEDGDPDEEDPLL
A0A346Y185      IMIDSRADQIAVDSTLFGSGVELFE------RADVPES------PSA-------------
A0A259S8H9      VPMDE---------------------------AVAPTR------PSA-------------
A0A0Q5L115      VALSS---------------------------ASVPTS------PAS-------------
A0A2W1Z497      VPLAS---------------------------ATVPTS------PSS-------------
A0A1H4I042      ------------DGSLPDTRVVVEQ------PAAIASS------PAV-------------
A0A4R7A6D9      ------------DGSLPDTRVVVEQ------PAAIASS------PAV-------------
A0A4Q4D4T1      ------------APDLPTLSPIVIQ------EGTASSQ------PVE-------------
A0A261FE22      ------------SDGSSGIQLSFIQ------KPYVPSS------PSS-------------
A0A5C8C085      ------------GKNEAPIRLLPVE------SAALPSA------PVS-------------
A0A1E4BP96      ------------VAGSAPVTLIPGD------SARLPTA------PSS-------------
A0A101KZQ4      ------------SSSASIVTFRSFD------AAELPTS------PSS-------------
A0A439DNZ6      ------------DGTRPDARVIVEQ------RASIPKS------PVI-------------
A0A0J6YE86      ------------NSTRADSRVVVEQ------RASIPSS------PVV-------------
A0A5Q5BFU2      ------------DGSSPDARVVVEQ------RASIANK------PVI-------------
A0A151BT98      ------------LSGAGSVTSTAVQ------PAEVPAS------PAS-------------
A0A2Y8ZRF8      ------------LSGAGSVTSTAVQ------PATVPSS------PAS-------------
A0A2R9UAT1      ------------GKVQAAVRLVPAD------TARLPTA------PSS-------------
A0A4Q5J5D7      ------------RGEAGALKVVPIE------AAALPSA------PVS-------------
A0A1Y4CKD6      ------------RFVLGNIAFNLID------EISTPAT------PVN-------------
A0A0Q7KBQ4      ------------GNGSPAFVARIVG------PPSISQT------PVA-------------
A0A1F1IHY9      ------------IAGQSIISLETLS------DASLPSA------PSS-------------
A0A542HCT5      ------------GKSEQALRIVPIE------SAALPAS------PVS-------------
A0A2S8WHZ8      ------------SDRATAVKLQPLG------QAVLPSS------PVS-------------
A0A537WNY9      ------------EVGVPTLELKELD------RPALPQA------PVF-------------
A0A5B8M469      ------------ASDTPHLKVIPLD------NATAPST------PVS-------------
A0A1Y4CTD2      ------------RVSGYVFSNATLQ------LVQEPSV------PES-------------
A0A0Q5M6Z7      ------------AIAEPAISFVALA------SARPPYF------PSS-------------
A0A3N3ZPU0      ------------EDGTGLVQVVPVS------SASVPES------PVS-------------
A0A359IQX7      ------------TPGQSVVKLQPYI------SAAESPN------PVS-------------
A0A4R8TXC3      AVS---------GNAANNIRVIPLD------NASINPP------LVS-------------
A0A433EDP2      AVS---------GNAANNIRVIPLD------NASINPP------LVS-------------
A0A231VTW0      AVS---------GNAANNIRVIPLD------NASINPP------LVS-------------
A0A433ECD0      AVS---------GNAANNIRVIPLD------NASINPP------LVS-------------
U7V3Z1          AVS---------GNAANNIRVIPLD------NASINPP------LVS-------------
A0A1F1J417      NPS---------DTTNTLIRVIPLD------NASVNPP------LVS-------------
A0A2A8D6P2      NPS---------DTTNTLIRVIPLD------NASVNPP------LVS-------------
A0A1F0THV9      NPS---------DTTNTLIRVIPLD------NASVNPP------LVS-------------
A0A5F0M6Y0      NPS---------DTTNTLIRVIPLD------NASVNPP------LVS-------------
D8USQ4          NPS---------DTTNTLIRVIPLD------NASVNPP------LVS-------------
E3H5W1          NPS---------DTTNTLIRVIPLD------NASVNPP------LVS-------------
A0A1F1QKB0      NPS---------DTTNTLIRVIPLD------NASVNPP------LVS-------------
A0A509JY23      NPS---------DTTNTLIRVIPLD------NASVNPP------LVS-------------
A0A448USF4      NPS---------DTTNTLIRVIPLD------NASVNPP------LVS-------------
A0A0Q9LZR0      ------------GKAAQALRVVPIE------SAALPAS------PVS-------------
A0A1N7E3F1      ------------PKSPPTIRVTVVD------DAEVPED------PVA-------------
A0A544ZKQ1      ------------PKSPPTIRVTVVD------EAEVPKE------PVA-------------
A0A372P1T1      ------------PKSPPTIRVTVID------EAEVPRE------PVA-------------
A0A5D0Q2X0      ------------PKSPPTIRVTVID------EAEVPRE------PVA-------------
A0A5R8Z2E7      ------------PKSPPTIRVTVID------EAEVPRE------PVA-------------
A0A1L2ZMV4      ------------TSSVPVVQIIPIS------SALLPSA------PSA-------------
A0A6I3F378      HTLEQQQIDARLDTPGAKVVH----------PAETPGT------PVR-------------
A0A1S1CAD0      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
G5ET14          ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1E9DXX2      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1E8S156      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1E8S5S2      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1S1DFA8      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A2I1Z490      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1F0DAA9      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1F0PHK9      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1F0VZG6      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1E9G8X4      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1E9IAW2      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1E9ZBC9      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1E9ZDP4      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1F0R6B5      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1F0Z7N5      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1F1D897      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
D2NP38          ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1F1FV74      ------------PTTNNTVRVIPLN------NASVNPP------LVA-------------
A0A1E9M791      ------------PTTNNTVRVIPLN------NASVNPP------LVA-------------
A0A291DEI8      ------------PTTNNTVRVIPLN------NASVNPP------LVA-------------
A0A1S1D5T1      ------------PTGGNTVRVIPLN------NASVNPP------LVA-------------
A0A1E8TRD6      ------------PTTSNTVRVIPLN------NASVNPP------LVA-------------
A0A1F0XT88      ------------PTTSNTVRVIPLN------NASVNPP------LVA-------------
A0A1F1EVP5      ------------PTTSNTVRVIPLN------NASVNPP------LVA-------------
C6R548          ------------PTTNNTVRVIPLN------NASVNPP------LVA-------------
A0A0K2RXS2      ------------PTTNNTVRVIPLN------NASVNPP------LVA-------------
A0A1F0KX60      ------------PTTNNTVRVIPLN------NASVNPP------LVA-------------
A0A542I3V2      ------------TPPALPVGLVPLD------KAALPTT------PIS-------------
A0A2T0UZ65      ------------PGTQALVRIIPIE------TALLPGA------PIG-------------
A0A1R4JTI6      ------------SSAQSIVKVLPLV------QATQPQT------PHT-------------
A0A4R7TM52      ------------SGGEALVQLVPGD------SAQLPTS------PSS-------------
A0A542XE74      ------------MRGMTSINVLAYE------PAALPSS------PVR-------------
A0A0G3V3F3      ANIDALNKVEAERRAQPANRVNVAA------SAHASST------PIS-------------
A0A0Q7QDF6      ------------ERAGEDAPDLPTLSPIVIQEGTASSQ------PVE-------------
A0A3S0V9U6      -----------------SVRVIPLD------DAQKPGS------PVG-------------
A0A5R8L819      ------------SGGGEVVRLVEGD------SARLPSS------PSY-------------
A0A261FQA1      ------------TGLFNGLQFSVIE------RAVAPSS------PVS-------------
A0A1Q2CJ92      ------------SSGQTVVRIVPVE------LAQTPTT------PVS-------------
A0A2T0S3C8      ------------DRTASPIKVEVVA------GPTGGDT------PVS-------------
A0A4Y8WZJ3      ------------IAGQSIISLETLS------DASLPSA------PSS-------------
A0A285VUW0      ------------AQSGASVAAQFVD------QPTQSSE------PVS-------------
A0A2R7Z032      ------------NKAETLVQVVPLE------QAQLPGA------PFT-------------
A0A1I0W453      ------------PKEPALTRIIPLE------EAQLPGA------PFT-------------
A0A1H4LCS9      ------------PKGDSLATIVPLE------EAQLPGA------PFT-------------
A0A4Q2RZP8      ------------PKGDPLARIVPLE------EAALPGA------PFT-------------
A0A0Q6VV12      ------------PRRDPLTRVVPVQ------PAELPQA------PFT-------------
A0A495NTA9      ------------PKTDPLTRIVPVT------PAQLPGA------PFT-------------
A0A0Q9QB08      ------------PRGPSLTRIIPVT------PAELPGA------PFT-------------
A0A4Q2SA86      ------------PREAPLTRIVPVE------QAQLPTA------PFS-------------
A0A4Z1C3Z0      ------------PRGDPLTRIVAVE------PAQLPSA------PFS-------------
A0A4Q2JUT1      ------------PTGAAPVQVVTRE------SASLPTS------PAF-------------
A0A542J310      ------------PTGDAPVKVVVRE------SASLPSS------PAF-------------
A0A444BL03      ------------N--AKNIVTIVPI------ESALPGR------RIA-------------
A0A4Y8X357      ---------------ASNVKVTAME------DALPPQA------PSS-------------
R4LD52          ------------KQ-VSSVKVEVVA------GPELADA------PVS-------------
A0A4T2CD79      ------------TQQAGNTVVAAVTFLEPVESAVAPTQ------PIF-------------
A0A2N3YJR1      ------------GR-GAASVTIVPI------ESALPGT------KIA-------------
A0A6G8FYB9      ------------PS-AKPIVSIVPI------ESALPGG------KIA-------------
A0A4Q4D742      ------------SGQAAAVTARIAA------DPSFRSS------PVA-------------
A0A4Q2RU39      ------------DG-ANLARIIPLE------EAQLPGA------PFT-------------
A0A4Q2SK58      ------------DG-GTLTRIIPLE------EAQLPGA------PFT-------------
A0A1C6T1J1      ------------GE-PGPIKIEIVS------GPRVSAS------PVS-------------
A0A2W2CFC8      ------------GS-AGPIKIEVIS------GPGVTPS------PVS-------------
A0A2W2A4B0      ------------SG-V-GVTVTQTS------PAARPTT------PVA-------------
A0A4Y9MDA5      ------------DG-SPSVRADTVA------PASVPSA------PVS-------------
A0A1H7N9P7      ------------DG-SPAVRATTVA------PAGVPGA------PVS-------------
A0A1M7V0F8      ------------DG-SRAVRATTVA------SADVPTA------PVS-------------
A0A022KX11      ------------KSSGQKVVSTPIQ------PASAPAQ------PVS-------------
A0A4Q5A868      ------------G-SHSSVKLSVVQ------PAAVPSS------PSS-------------
A0A345NSU7      ------------QMSGSAVSAETVV------PAAVPGR------PVE-------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A4Y5YMQ6      ------------DRGESTVGARVID------PGAPAQF------QSS-------------
A0A255G8R8      ------------D-GQDTVKATTIS------PALPPPS------PSS-------------
A0A6G7Y423      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ----------------------------------MPQE------PIS-------------
A0A538AJI7      -----AKQAVVFSKKDRLLSAQLVA------PAVKPTT------PAA-------------
A0A538AM15      -----HTANEAAPRQEPLVAVDAAE------PLTLQQS------PA--------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      -----------------------------------------------------VDGADEH
A0A348NU28      ----------PNKPRDAL----LGAVVGLLLGVLAALLWTLLDTRVPNE----TVLSQVV
A0A4Q5APW3      ----------PKWKLNIL----VGIVGGLILGVFAALLKDALSKRIQND----DEISEYI
A0A4Q5B0V3      ----------PKWKLNIL----VGIVGGLILGVFAALLKDVLSKRIQND----DEISEYI
A0A222TG79      ----------PGIEKNTL----IGVAVGLLFGLLAVMFASRLTNRIQTP----ADVVEVT
A0A6I3DFP2      ----------PHPTRSAV----VAFLLTCILVGELIVASRAIGDRIGRTGDDDADVARIT
A0A1Q2CRV2      ----------PKPLQNLA----IGGLVGLLLGAGQALLRDVLNTVVRSR----RDIEQVS
A0A2S5WZJ5      ----------PNLQTNLL----LGAGIGIVLAYVFVFLRKALDVKVRTS----KDLATAT
K6WHS4          ----------PRYGRTVL----IALTLGICMGIGIVVLVERADTRIRSE----DSVLEVT
A0A1L2ZMQ6      ----------PNVNQAVL----IGAVVGLVLGLIWAAIKHLLDRRVRSV----EAIQK-V
A0A3L8NYD3      ----------PDYRINLL----AGGIAGIVAGYLLALVRRQLDSRIRTV----DDMESLV
A0A1M6K628      ----------PNWARNLA----LGLALGLLCGFGAVVLRRSLDRRVRQA----DEVEELT
A0A561E8R3      ----------PDFKKATA----EGLLAGLVAGYLWAAFRRQLDSRVRHQ----DDVERHL
A0A3E2DN22      ----------KSVALYVV----AGLAAGFLIGAVVAVVRKQFDVKVRDQ----ATIEELT
A0A3Q9ULZ9      ----------DNLLLYLA----LGLVAGLVVGSVIAVIRRMFDVKIRSQ----NDVEELT
A0A3S9JFL2      ----------ANLPLYLA----LGLLAGLVLGGVISVIKRMFDVKIRSQ----KDVEDLT
A0A1Q2CI19      ----------PDRWFRTL----LAAVLGLLFGIALALVLERLDSRLRTR----EEIAEAL
A0A512T3M3      ----------PGRPQRTG----LAAGLGLLLGLAIALVLNRLDSRMRSR----EEIQEAL
W6JTW4          ----------PGRPTRTA----LAALIGLLFGMALAVFVDRIDSRLRSR----TEIQAAL
A0A0A0JTY0      ----------PGRGPRTA----IATLLGVLVGLGLALLLDRLDSRLRTR----SEIHNAL
A0A0A0JXF2      ----------PGRGPRTA----IATLLGLLVGMGLALLLDRLDSRLRSR----SEIGDAL
E6S8H2          ----------PDRTTRTA----LAAGLGLLLGLGLALVLDRVDSRLRTR----SEIAAAL
A0A0A0JGH0      ----------PSRPLRAA----LAALVGLLLGFALALVLQRVDSRLRTR----DEVHAGL
N0E4U7          ----------PSRPLRTA----MAAFIGLLLGFALALVIQRVDSRLRTR----DEVHAAL
A0A0A0IYK2      ----------PGRGPRTA----IATVLGLLAGLALALLLDRLDSRLRTR----QEIHGAL
A0A0Q9L0H3      ----------PGRGPRTA----IATLLGLLVGLGLALLLDRLDSRLRTR----GEIASAL
A3TMK0          ----------PGRGPRTA----MATLLGLLVGLGAALVMDRLDSRLRTR----ADIHSAL
A0A543PXP1      ----------PGRAFRTA----LAAMLGLLAGLALALVLDRLDSRLRTR----EEIAAAL
A3TMH6          ----------PSRPVRAA----LSAVLGLLLGLALALVLDRLDSRLRTR----EEIAAAL
A0A1H6WL79      ----------PLLTATIG----IGLAGGLLVGLGYALARNHFDRRIRAA----SEIERLF
A0A101LAM5      ----------PLLTATLG----IGLAAGLLIGLGYALARNHLDRRIRGA----SEIERLF
A0A4Y3NEG0      ----------PLLTATLG----IGLAAGLLIGLGYAIARNHFDRRIRGA----SEIERLF
A0A1H6YPK1      ----------PAIKQNTA----VGLMLGLALGVAYAFVRATLDRRLRSR----NDVEIQF
A0A2R7MGI0      ----------PNIKIDVA----VGGIAGGVLGVVFALVRRTFDRRVRTV----QDITDTV
A0A2T7WQY4      ----------PNVKVDVA----VGAIAGGVLGVVFALVRRTFDRRVRTV----EDITAAV
A0A1G6GTN3      ----------PNVRLDVT----LGALAGGVAGIIFALVRRAFDRRVRST----HDITDAV
A0A1N7DLV3      ----------PNEKLAIA----VGALAGAVAGVLFALVRRAFDRRVRSA----HDISDSV
A0A1V2NSB5      ----------PNEKLAIA----VGALGGAVVGVLFALVRRTFDRRVRST----QDISDSV
A0A0Q5Q5L3      ----------PNVRLDVM----IGALLGLVAGVVFALVRRTFDRRLRSA----SDITDAV
A0A0Q6DVM4      ----------PNVRLDVM----IGALLGLVAGVVFALVRRTFDRRLRSA----SDITDAV
A0A1R3WWR6      ----------PNVRLDIA----IGALVGAMAGTVFALVRRAFDRRIRSA----ADITDTI
A0A5Q2FA83      ----------PNLLQNIA----LGVLAGLALGIGLALLRHFLDTRVRSE----LDLRAVS
A0A542FTE6      ----------PNIFSALV----VGGVVGLVAAGIFMLVRNTLDRRVRSV----ETVEKTA
A0A2S5UYV0      ----------PNLRNNLL----IGAGLGLVLAYVFVFLRKALDVKVRNS----KDLASAA
A0A2S5X9U6      ----------PNLRNNLI----IGGAIGLLLAYAFALLRRSLDVKVRDS----KDLAAAS
A0A2S5ULV5      ----------PNLRNNLI----IGGAIGLVLAYAFALLRRSLDVKVRDS----KDLATAS
A0A653YMF0      ----------PNLRNNLI----IGGAIGLVLAYAFALLRRSLDVKVRDS----KDLATAS
A0A4V1VGV9      ----------PNWMRNLM----AGAAIGLLAGIVLVVLRKQLDSRIRHT----SEVEKLT
A0A3Q9IY80      ----------PNVRIALA----LGALAGLVLGIAYAVLRYTLDRRIRSA----DAVEKET
A0A0F0LP73      ----------PDKRAMII----AGALIGLGVGLLLVLLRRALDVRVRAH----TDVAAIV
A0A1F1X071      ----------PDREKFLL----AGAAFGLLVALGLAWLRDRNDSRLRTA----DDVTDVV
A0A3R8RWC7      ----------PDREKFLL----AGAAFGLLVALGLAWLRDRNDSRLRTA----DDVTDVV
A0A4U0RJZ4      ----------PKWPVNLL----IGAFLGLVAGTILVVLRKQLDSRIRHT----SDLEKVT
A0A4R1FGL9      ----------PKWPVNLL----IGAFLGLVAGTVLVVLRKQLDSRIRHT----SDLEKVT
E3B8H1          ----------PKWPVNLL----IGAFLGLVAGTVLVVLRKQLDSRIRHT----SDLEKVT
A0A0Q5AWK6      ----------PNWLRNLL----LGAAGGLVLGFVVAFLRRALDIRVRTV----DQLTELF
A0A3N1NLD3      ----------PNWLRNLL----LGAAGGLVLGFVLAILRRALDIRVRTV----DDLTQLF
A0A3N2FVI8      ----------PNWLRNLL----LGAAGGLVLGFVLAILRRALDIRVRTV----DDLTQLF
A0A2S5XDQ6      ----------PDWVRNIL----LGALGGLVLGFGLAFLRRALDIRVRTV----DDLTELF
A0A2S5XNN6      ----------PDWVRNIL----LGALGGLVLGFGLAFLRRALDIRVRTV----DDLTELF
A0A3L7ADK2      ----------PNVIIALV----LATITGTLLAIAYAVIRQHLDRRIRSA----DVLEQRY
A0A6I2XCV4      SETDLTVVSGSSRAVRIL----IGGLVGLILGIATAFVLEVWDDRIRRR----DGLEAVT
A0A5R8VLL6      ----------PGMGLTAL----YGAAVGLLLAYASALLRDRLDRRLRTA----AEVENLF
A0A538JQF8      ------------RRIRAV----IGLLIGLLVGAGVSFAIDFFDPRLRTR----AKVEDLL
A0A0Q5JKD6      ----------PNVRLDVT----LGALAGGVAGLIFAFVRRAFDRRVRSA----HDITDAV
A0A0Q9TBP0      ----------PQIVLNLI----LGALVGLVLGVGAALLRDRLDDVVHDE----EAVRQAL
A0A346XTB0      ----------PRPRLTAL----SFAFLGGVASAMWAYWYAFKSQRVTSR----TDPEIVL
A0A0G3V3M7      --------------QRLL----FGAAIGFIVGLGILLLLEILSARIRDV----PGTEGAA
A0A6I3DD56      --------------QRLL----FGAAIGFIIGLGILLLLEILSARIRDV----PGTEGAA
A0A2W6DK08      ATFNAGAFSLSSTTARTV----VGLVLGVVLGCALALALEHFDTRPRDR----AAAGRAY
A0A2S0LQ32      ----------PDTTKLAG----MGGAGGLALGLAVAFLRRALDNKIRHN----SDIEDIL
A0A2N6V1R5      ----------PDFYKLSG----MGALAGLVIGYLVVFMRRLMDNRVRHN----SDVEELL
G9PHS6          ----------PDFYKLSG----MGALAGLVIGYLVVFMRRLMDNRVRHN----SDVEELL
U1PLM7          ----------PDFYKLSG----MGALAGLVIGYLVVFMRRLMDNRVRHN----SDVEELL
A0A6I1G2U1      -----GFSIPPSRTFRTT----MAALLGLLIGFGLALVLHQVDSRLRTR----DEVYQAL
A0A351ETF8      ----------PNVTRNLV----VAAAFGMALGIALTYLREVINDKIEGA----RSVEQAT
A0A349B7N2      EAFDAGPSEPPSPARRGM----LGGGLGLVLSVGAVVLFDRFDDRLRTK----EDAEEAF
A0A346Y185      ----------PTPVRNAV----LACFLGALAAAALAWWRADETATADGR----NDPSRML
A0A259S8H9      ----------PNKPLIAG----IGGGAGLVLGLIALLLRRAMDVRVRAH----TDVAALV
A0A0Q5L115      ----------PNVEVALL----LGGLSGLMLAGVYLLVRNTLDRRIRSA----AEVESRF
A0A2W1Z497      ----------PDVRAAVT----LGVLVGLLLASVYVLVRQALDRRIRSA----AAIEAAF
A0A1H4I042      ----------PNLMRNLA----LGLFAGILFGVACALGREMIDNTVKKH----EDLESIT
A0A4R7A6D9      ----------PNLMRNLA----LGLFAGVLLGVACALGREVIDNTVKKH----EDLESIT
A0A4Q4D4T1      ----------PDARRTYV----LFGLAGLLLGLLLAALRNLATATVTSS----DALTEQV
A0A261FE22      ----------PNVKGNMM----MGAFAALIIAAAGAVIREMSDNSIHTK----AEIQSIV
A0A5C8C085      ----------PNITRNLA----IGFGAGLLLGFAYALVRSQLDRRLRTA----SAVEKKF
A0A1E4BP96      ----------PNTTLNLA----LGGLVGLALGIAYAVMRSVLDSRIREP----QDVERNT
A0A101KZQ4      ----------PNFKIAIA----VGLLVGLFMAFAYAMLRHAFDRRISSI----ESVESST
A0A439DNZ6      ----------PKTARNIA----LGLALGLALGIGLAILRDLLDNTVKDR----QNLEEIT
A0A0J6YE86      ----------PKRARNIA----VGLVLGLVLGVGFALIRDLLDNTVKDR----TTLEQIA
A0A5Q5BFU2      ----------PKTARNIV----FGLGLGLLLGVGLAVLRDTLDNTVKDR----QALEDVT
A0A151BT98      ----------PDLKKALE----LALAVGLLLGVAMALLRHFMDNRVRTV----EDLETLV
A0A2Y8ZRF8      ----------PDIKRTLE----LAFAVGLLLGVAMALLRHFMDNRVRTV----EDLEALV
A0A2R9UAT1      ----------PNVRLALA----IGGVAGLVVGLMIALLRFTLDRRIRSA----ELVERET
A0A4Q5J5D7      ----------PRVELNLL----IGGVVGVLLGLAYALLRNQLDRRLRSS----QAVERQF
A0A1Y4CKD6      ----------EPSQSRIWG---FGVMGGICTAALVVGLIALFNNTIKTA----EDLESVS
A0A0Q7KBQ4      ----------PNVPLNIA----VGLLLSLFVAIAGAVLRDLLDRTVKTR----QEAEELS
A0A1F1IHY9      ----------PNLPLALS----IGGALGLLAGLGVAVVRHVLDNKIRSA----AALESRF
A0A542HCT5      ----------PNTQRNLA----LGFVLGLILGMGYALLRSQLDRRVREP----EVIERDF
A0A2S8WHZ8      ----------PNTKLSLA----LGGVIGLALGLGYALTRNHLDRRIRSV-----EAIERL
A0A537WNY9      ----------PRKRLTLI----VASLIAVLLGVAAALVRENLGTRIETA----EDLARIA
A0A5B8M469      ----------PKPKLVLP----IGALAGLVLGYIVILLRRALDVRVRAG----TDMIELL
A0A1Y4CTD2      ----------PSNTSPLIAYRYLGAAIAALGAVALIALIYLLRNTVKTA----EQASDLL
A0A0Q5M6Z7      ----------PNVQTALV----LAILAGIALAVVYGLLRQHFDRRIRSV----EQIERLL
A0A3N3ZPU0      ----------PDLRLNLL----VGVGVGLLLAALYVLARSLFDRKVRSS----EAVANAT
A0A359IQX7      ----------PNWKANLP----IGAIAGLVIGYGIAFIRRSIDGRVRTQ----AEVEELT
A0A4R8TXC3      ----------PNYTRNTL----IGAVAGLVLVYVVIFLRRSVDQRIRTR----DDAVKAT
A0A433EDP2      ----------PNYTRNTL----IGAVAGLVLVYVVIFLRRSVDQRIRTR----DDAVKAT
A0A231VTW0      ----------PNYTRNTL----IGAVAGLVLVYVVIFLRRSVDQRIRTR----DDAVKAT
A0A433ECD0      ----------PNYTRNTL----IGAVAGLVLVYVVIFLRRSVDQRIRTR----DDAVKAT
U7V3Z1          ----------PNYTRNTL----IGAVAGLVLVYVVIFLRRSVDQRIRTR----DDAVKAT
A0A1F1J417      ----------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQRIRTR----DDAIKAT
A0A2A8D6P2      ----------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQRIRTR----DDAIKAT
A0A1F0THV9      ----------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQRIRTR----DDAIKAT
A0A5F0M6Y0      ----------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQRIRTR----DDAIKAT
D8USQ4          ----------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQRIRTR----DDAIKAT
E3H5W1          ----------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQRIRTR----DDAIKAT
A0A1F1QKB0      ----------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQRIRTR----DDAIKAT
A0A509JY23      ----------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQRIRTR----DDAIKAT
A0A448USF4      ----------PNYMQNGL----IGAGAGLVLVYLAIFLRRSVDQRIRTR----DDAIKAT
A0A0Q9LZR0      ----------PNTRRNLA----LGFVLGLMLGLGYALLRSQLDRRVREP----EVVERDF
A0A1N7E3F1      ----------PQPLTNMA----LGVLIALFAAVTGLVLRDRLDTTIKTA----ETLRQVA
A0A544ZKQ1      ----------PQPLTNMA----LGALIALLAAVTVLVLRDRLDTTVKTA----EALQQVA
A0A372P1T1      ----------PQPLTNMA----LGALIALFAAVSGLVLRDRLDTTVKTA----ETLQKVA
A0A5D0Q2X0      ----------PQPLTNMA----LGALIALFAAVSGLVLRDRLDTTVKTA----ETLQKVA
A0A5R8Z2E7      ----------PQPLTNMA----LGALIALFAAVSGLVLRDRLDTTVKTA----ETLQKVA
A0A1L2ZMV4      ----------PVLRTNLM----YGAIAGLILAALFVFIKHLFDVRIRST----EQVETTT
A0A6I3F378      ----------PTPIATTG----LGLAIGALLGVALALIRQRLATTVDRP---EDLVTLGI
A0A1S1CAD0      ----------PNYEQNTL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
G5ET14          ----------PNYEQNTL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
A0A1E9DXX2      ----------PNYKQNVL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
A0A1E8S156      ----------PNYQQNVL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
A0A1E8S5S2      ----------PNYQQNVL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
A0A1S1DFA8      ----------PNYQQNVL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
A0A2I1Z490      ----------PNYQQNVL----VGAATGLALVYLAIFLRRALDQRIRTR----DDATKAT
A0A1F0DAA9      ----------PNYQQNVL----VGAAAGLALVYLAIFLRRALDQRIRTR----DDATKAT
A0A1F0PHK9      ----------PNYQQNVL----VGAAAGLALVYLAIFLRRALDQRIRTR----DDATKAT
A0A1F0VZG6      ----------PNYQQNVL----VGAAAGLALVYLAIFLRRALDQRIRTR----DDATKAT
A0A1E9G8X4      ----------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
A0A1E9IAW2      ----------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
A0A1E9ZBC9      ----------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
A0A1E9ZDP4      ----------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
A0A1F0R6B5      ----------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
A0A1F0Z7N5      ----------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
A0A1F1D897      ----------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
D2NP38          ----------PNYQQNTL----IGAGTGLVLVYAAIFLRRALDQRIRTR----DDATKAT
A0A1F1FV74      ----------PNYQQNVL----IGAVAGLGLVYLAIFLRRALDQRIRTR----DDATKAT
A0A1E9M791      ----------PNYQQNVL----IGAVAGLGLVYLAIFLRRALDQRIRTR----DDATKAT
A0A291DEI8      ----------PNYQQNVL----IGAVAGLGLVYLAIFLRRALDQRIRTR----DDATKAT
A0A1S1D5T1      ----------PNYQQNVL----VGAATGLALVYLAIFLRRALDQRIRTR----DDATKAT
A0A1E8TRD6      ----------PNYQQNVL----VGAAAGLALVYLAIFLRRALDQRIRTR----DDATKAT
A0A1F0XT88      ----------PNYQQNVL----VGAAAGLALVYLAIFLRRALDQRIRTR----DDATKAT
A0A1F1EVP5      ----------PNYQQNVL----VGAAAGLALVYLAIFLRRALDQRIRTR----DDATKAT
C6R548          ----------PNYQQNVL----VGAVAGLALVYLAIFLRRALDQRIRTR----DDATKAT
A0A0K2RXS2      ----------PNYQQNVL----IGAVAGLGLVYLAIFLRRALDQRIRTR----DDATKAT
A0A1F0KX60      ----------PNYQQNVL----IGAVAGLGLVYLAIFLRRALDQRIRTR----DDATKAT
A0A542I3V2      ----------PNIKLALL----FGAIGGLLLAYAAALLRHHLDRRLRSS----SEIERLF
A0A2T0UZ65      ----------PNVTKYVL----AGAVAGAALAYAWIFIRRLSDTRIRTS----KDVEDLT
A0A1R4JTI6      ----------PNVRMALA----LGALVGLVVGLGVAALRSLNDRRIRGV----KVLEETF
A0A4R7TM52      ----------PNWRIAVV----IGAVIGLAAGIGAAAIRYVVDRRIRSA----DIVERET
A0A542XE74      ----------PGVIRNLI----LGGLAGAILGGLIAFGRRALDARIRSQ----EQVELLT
A0A0G3V3F3      ----------PHPTRSAV----VAFLLTCILVGELIVASRAIGDRIGRTGDDDADVARIT
A0A0Q7QDF6      ----------PDARRTYV----LFGLAGLLLGLLLAALRNLATATVTSS----DALTEQV
A0A3S0V9U6      ----------PNVKKYVL----FGAAAGLIIVYLVVFIRRFMDVRVRTT----KDMEEST
A0A5R8L819      ----------PNDRLFAA----LGVVAGLALGIIYAVARHTLDRRVRSA----ETVEKET
A0A261FQA1      ----------PNKPRLIF----MGTLAGLVLALVVIVVIDVSDKRVRDT----ADIQRIL
A0A1Q2CJ92      ----------PNYVRNLA----LGAALGLLLGLGIVVGRQSFDRRIRRA----HEAEEVA
A0A2T0S3C8      ----------PKPLRNLA----LAALLGLLAGGVAAVLRETLDTTVKTA----DALHELA
A0A4Y8WZJ3      ----------PNLPLALS----IGGALGLLAGLGVAVVRHVLDNKIRSA----AALESRF
A0A285VUW0      ----------PNPTRNLA----IATLAGLMLGLAYALGMQALDTRLRST----ADVEALT
A0A2R7Z032      ----------PNYRNGAI----KGAGGGLVLAYVILIARRLIDRRIRSV----KDVETAT
A0A1I0W453      ----------PNYESAAM----KGALGGLGLAYAFLIGRRLIDRRIRTT----KHVEEAT
A0A1H4LCS9      ----------PNYQKAAM----YGAAGGLGLCYAFLVGRRLIDRRIRSA----KHVEEAT
A0A4Q2RZP8      ----------PNYKKGAM----QGAAAGLGLCYAVLVGRRLIDRRIRSA----KHVEEAT
A0A0Q6VV12      ----------PDYAKAAM----KGAAGGLALAYAFLIARRLIDRRIRSV----KHVEDAT
A0A495NTA9      ----------PDYRKAAM----KGAAGGLGLAYAFLIARRLIDRRVRSV----KHVEDAT
A0A0Q9QB08      ----------PDYRAAAI----KGALGGLALAYAFLIARRLIDRRVRSA----KHVEDAT
A0A4Q2SA86      ----------PDYPSAAL----KGALGGLALAYAVLIGRRLIDRRIRSA----KHVEEAT
A0A4Z1C3Z0      ----------PDYRSAAL----KGALGGLALAYAVLIARRLLDRRIRSA----AHVEEAT
A0A4Q2JUT1      ----------PDVQTALI----VGGVLGLGFGIAFAMIRTAADRRIRNA----EDTESKT
A0A542J310      ----------PDTQTALI----VGGVLGLGFGVAFAMIRTAADRRIRSA----ADIEQKT
A0A444BL03      ----------PDPPRNVL----IGIGLGLLVAYLLVFVRRQLDTRLRSA----QDVEAAT
A0A4Y8X357      ----------PDHLRNAL----IGGSIGLLAALAAAFLRRLLDVNVRTT----TDATQAS
R4LD52          ----------PRPVRNLV----LAALLGLLTGAAGAVLREVLDTTVKTV----EGLQALA
A0A4T2CD79      ----------PNVRLSVI----IGALIGLVLAIVYAMVRNVLDRRIRTA----ATIQQQF
A0A2N3YJR1      ----------PDPRRNTL----VGLVGGLFLAYALIFVRRQLDTRVRSA----EDVEKET
A0A6G8FYB9      ----------PNPKRSGL----IGLVVGLGVAYALVFVRRQLDTRLRTV----GDVEELT
A0A4Q4D742      ----------PNVPLNLA----AGLLLSLFLAIAGALVRDLLDRTVKSR----RDVETIT
A0A4Q2RU39      ----------PDYERAAM----KGAIGGLGLAYAFLIARRLIDRRVRSA----KHVEEAT
A0A4Q2SK58      ----------PNYERAAM----KGAIGGLGIAYAFLIARRLIDRRVRSA----KHVEEAT
A0A1C6T1J1      ----------PQPLRNFT----IGGLLGLVAGVALAVLRGMADVRLRDA----AGLQRVT
A0A2W2CFC8      ----------PQPVRNVL----IGTLIGLLAGVGLAILRGIADLRVRDG----ASLRRVT
A0A2W2A4B0      ----------PRTRANAA----LGGAAGAGLGVLAAFLRWALDTKVRGR----DEVQELW
A0A4Y9MDA5      ----------PRTSLNLA----VGQLAGLLAGCVAALLRDRLDNRVRDT----GVVAELT
A0A1H7N9P7      ----------PRTSLNLA----VGVLAGLLLGCGLALARDRLDTRVRDA----AVVAQLT
A0A1M7V0F8      ----------PRTSLNLA----VGVLAGLLAGCAAALVRDLLDNRVRDA----GVVAELT
A0A022KX11      ----------PNPTRNLA----LGLLAGLVLGLGLAFIRHALDTKVRGE----EDIRAHS
A0A4Q5A868      ----------PKWKLNIL----VGIVGGLILGVFAALLKDVLSKRIQDD----DEISEYI
A0A345NSU7      ----------PDPERNLA----LGALAGLLLGVAFALARQALDQRVRGT----ADVEAIS
A0A0W8I9Y2      ------------------------------MGLLYAFARFKMDRRIKSV----EEIRDGF
A0A4Y5YMQ6      ----------PNKSQDAV----LGVVLGAFGALFALSAWALLDRRVRSV----AALEGVT
A0A255G8R8      ----------PKVAQNLA----LGLLLGLALGFAAALVRERLDTRVRNE----ADVAAVT
A0A6G7Y423      --------------------------MGAAVGVGQALARHALDTRIRTA----RDLQQTT
A0A2N4T4Q5      -----------------------------------------MDRRIRSV----EEVRETF
A0A1M3LEY6      ----------PNTRLYLS----LGLLIGLIVGLAVAILIEVLDTRIRGE----ANVRQIT
A0A538AJI7      ----------PPRRLLEL----ASLFIGSLLGIVASLLLERGRPRLRSW----RDLARAS
A0A538AM15      ----------------------DSAVDDHLVSLVAPAAFE--------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ----------------------IGLVSGIVLGVMVALIKDLLDTRVRRD----SDVTTVI
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------MAEAVSS----SMNIKSL
A0A4R5Z7B0      ------------------------------------------MVFKKNK----KVRTTDP
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      -----------------------------------------------KP----VVGTIPE
A0A1I6IST1      -----------------------------------------------KP----VVGTIPE
A0A412JBM5      -----------------------------------MMGMAMSHELKRES----GHMRPAC
A0A510HHA8      -------------------------------------MVRLNLKRRARE----EQRNGDL
A0A6G8Q9J3      -------------------------------------MARPKVKRPARK----GNAEGGP
A0A1C2B334      ------------------------------------------------M----GVVDSPV
R7Y679          -----------------------------------MFGRSRLGTRIRDE----GDLDDAI
A0A5Q2F9A3      ------------------------------------MLRNSLDTRVRTA----SDVAQLT
A0A4R1BMZ2      ----------------------------------------MIISRRKKR----SEREEDL
A0A023X491      ----------------------------------------MARSKPLKK----HKKTENL
A0A6G8QDQ0      ------------------------------------MQQPKTESKMGKE----TGASAIA
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      --------------------------------------------------------MPHV
A0A6D1QMN1      -----------------------------------------MARKNKTN----QPDMSEK
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      -----------------------------------------------------------M
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ---------------------------------------TIDAPVLSSV----AYDADVP
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      LVSLLTPTS---------------------------------------------------
A0A348NU28      PAPVLGSIS----------RVRGNGERGLYVARE----------PLG-------------
A0A4Q5APW3      DAPIIGRIP----------EEELLNSTKPVIVSE----------PGS-------------
A0A4Q5B0V3      DAPIIGRIP----------EEELLNSTKPVIVSE----------PGS-------------
A0A222TG79      ESPVLAVVP----------RFPSAADSPVSFGAGSS------------------------
A0A6I3DFP2      GLPVLGRIP----------KGEGF------------------------------------
A0A1Q2CRV2      DQAILGAIP----------------------LDESGDVLVLNSDPHG-------------
A0A2S5WZJ5      RSGSLGRIP----------KSPQLMGKNRGANDADA------------------------
K6WHS4          ELPILGDLP----------DDPAVDRNVVNFGVGGS------------------------
A0A1L2ZMQ6      GMSAVGTLP----------SDPRLSRGRQ-VLPVVYSAETRTDRSYH-------------
A0A3L8NYD3      GTSVLTILP----------ESDELDRVGD---------DGLVGSQTG-------------
A0A1M6K628      SATALGVVP----------TAVEL---AS---------GVSLVNDSG-------------
A0A561E8R3      EAPVVGVIP----------KVPEL---AE---------DYRGDTGLG-------------
A0A3E2DN22      GSGILSVIP----------DDKKLAEQRE----------KSIVHISG-------------
A0A3Q9ULZ9      GRGVLAIIP----------EDRQLSKQRK----------TGDLGLSG-------------
A0A3S9JFL2      GHGVMAVIP----------EDRQLTKQRK----------SGDLELAG-------------
A0A1Q2CI19      DMPIVGVVP----------KITAAQRRNK--------EILTVTQPLS-------------
A0A512T3M3      GLPIIAEVP----------KLARGQRASA--------GTLVVTEPLS-------------
W6JTW4          GLPIIAEVP----------KLPRAKRSDA--------YHMVLDQPLS-------------
A0A0A0JTY0      QMPIIAEVP----------RLKRAQRSRA--------SIAVATDPLS-------------
A0A0A0JXF2      SMPIIAEVP----------RLKRSQRNRN--------SIAVVEDPLN-------------
E6S8H2          RLPIIAEVP----------KMSRSLRRRR--------SIGVADEPLS-------------
A0A0A0JGH0      RLPIIAEVP----------RLKRSQKGER--------TITVAVDPLS-------------
N0E4U7          RLPIIAEVP----------RLSQAQKRKA--------SIMVAADPLD-------------
A0A0A0IYK2      RMPIIAEIP----------RLRRSERHQG--------AIAVAEDPLS-------------
A0A0Q9L0H3      RMPIIAEIP----------RLKRSQRNSA--------SIAVASDPLS-------------
A3TMK0          RMPIIAEVP----------RLKRSQRNRA--------TLGVLEDPLS-------------
A0A543PXP1      RLPIIAEVP----------RLNRSQRSSP--------SIGVAEQPLS-------------
A3TMH6          ALPIVAEVP----------RLGRTKRRDK--------TIGVAEQPLS-------------
A0A1H6WL79      GLAVVGTLP----------LDKRLSEKSS---VLESTSVVHRVPGGH-------------
A0A101LAM5      GLAVVGTLP----------LDKRLSEKSS---VLESTTGMHRVPGGH-------------
A0A4Y3NEG0      GLAVVGTLP----------LDKRLSEKSS---VLE-TTGTHRVPGGH-------------
A0A1H6YPK1      GVPVVGTVP----------WDGAIAKKGP-----------LGAVPGF-------------
A0A2R7MGI0      DASVVGVLP----------VDKELANGRA----VFSFTDIRDGRGSF-------------
A0A2T7WQY4      GASVVGVLP----------IDKELANGRA----VFSFTDTHDGRGSF-------------
A0A1G6GTN3      DASVVGVLP----------VDKELASGRA----VFSFDDIKDGRGSF-------------
A0A1N7DLV3      DVSVVGILP----------VDKELAAGRA----VFSFDDIRDGRGSF-------------
A0A1V2NSB5      DVSVVGILP----------VDKELAAGRA----VFSFDDIRDGRGSF-------------
A0A0Q5Q5L3      DASVVGVLP----------VDKELAAGRA----VFSFDDIRDGRGSF-------------
A0A0Q6DVM4      DASVVGVLP----------VDKELAAGRA----VFSFDDIRDGRGSF-------------
A0A1R3WWR6      AASVVGILP----------VDKELASGRA----VFSFDDIRDGRGSF-------------
A0A5Q2FA83      DRPILGALR----------LLPKGTSPTV----------MSSDPHGV-------------
A0A542FTE6      GVAVIGTLI----------RYEPFDAGRRLATAVSPLSGPARRSHFA-------------
A0A2S5UYV0      GVGSLGRIP----------KSPQLMGKNR----------ASNDADAI-------------
A0A2S5X9U6      GAGTLGRIP----------KSPQLMGKNR----------GTNDADAI-------------
A0A2S5ULV5      GAGTLGRIP----------KSPQLMGKNR----------GTNDADAI-------------
A0A653YMF0      GAGTLGRIP----------KSPQLMGKNR----------GTNDADAI-------------
A0A4V1VGV9      GSGVLGVIP----------KAPTLQSRRR---------GGL-GELGT-------------
A0A3Q9IY80      GLSVVGTIP----------DEKSFTADNRLLPVDGISSGSHADLFGV-------------
A0A0F0LP73      GAGVLGRVP----------KFDPDGRSKK---------DAIARAVAH-------------
A0A1F1X071      GLPTLGALP----------DAKELARGKD---------GVLPEPTSF-------------
A0A3R8RWC7      GLPTLGALP----------DAKELARGKD---------GVLPEPASF-------------
A0A4U0RJZ4      GVGTLGVIP----------KAKNLQTKSR---------GGL-GALGS-------------
A0A4R1FGL9      GVGTLGVIP----------KAKNLQTKSR---------GGL-GALGS-------------
E3B8H1          GVGTLGVIP----------KAKNLQTKSR---------GGL-GALGS-------------
A0A0Q5AWK6      GVGVLGRIP----------KAGR-RAGRK---------GET--VDRI-------------
A0A3N1NLD3      GVGVLGRIP----------KMGKGRVGRR---------GDARAVDGI-------------
A0A3N2FVI8      GVGVLGRIP----------KMGKGRGGRR---------GDARAVDGI-------------
A0A2S5XDQ6      GVGVLGRIP----------K--AGRPGRT---------GGRRGTDAL-------------
A0A2S5XNN6      GVGVLGRIP----------K--AGRPGRT---------GGRRGTDAL-------------
A0A3L7ADK2      GTSVLGTIPMNPFLRKGSQLLSQLTETST--------ESRHASFAMA-------------
A0A6I2XCV4      GLPVIVEVP----------VFTRAERQEL--------SVIALDAPRS-------------
A0A5R8VLL6      SVPVVGTLPVDLRLTGENKVLGGLPAAPA--------PGSRPQSP---------------
A0A538JQF8      GLPVVAEIP----------LLSRRARRVP--------GILAFNRPLS-------------
A0A0Q5JKD6      DASVVGVLPVDKELAGGRAVFSFDDIKDG--------RGSFAHK----------------
A0A0Q9TBP0      DAVVLARVP-----------QWSERSHRD--------RLVTLVDPHS-------------
A0A346XTB0      GVPPLGEIP----------LYRMTSEDQL--------TGLLRVDPSA-------------
A0A0G3V3M7      RMPVIAEIP----------VMNLDRSLRF--------QVTTAVDPTS-------------
A0A6I3DD56      RMPVIAEIP----------VMNLDRTLRF--------QVITAVDPTS-------------
A0A2W6DK08      RLPVLAEIP----------QARHSERRNF--------AVITASEPES-------------
A0A2S0LQ32      QSSVLAVVP-------------RSTDLSA--------KGRRNVDGLG-------------
A0A2N6V1R5      GSSVLAVVP-------------KSTELNA--------KGRQNVDGLG-------------
G9PHS6          GSSVLAVVP-------------KSTELNA--------KGRQNVDGLG-------------
U1PLM7          GSSVLAVVP-------------KSTELNA--------KGRQNVDGLG-------------
A0A6I1G2U1      RMPVIAEIP----------KLSRSQREQR--------QILVADEPHG-------------
A0A351ETF8      GLAILGTIPGYQL------------NSDQ--------VVEVIERPKS-------------
A0A349B7N2      GLPVVAEIP----------LLRRRQRRNS--------EVVSAERPRS-------------
A0A346Y185      KAPLLGTVPSFEEIGLTGSVPTVEAPKSP--------AG---------------------
A0A259S8H9      GAGVLGRVPRM--------------RKSG--------QGRNAALARA-------------
A0A0Q5L115      GVGVIGTIPQNDALAEHGGLVAALPNATA--------DDRHVNFAMS-------------
A0A2W1Z497      GVPVLGTIPLNPALTDHRQLVDALPNRTP--------EERRVNFATS-------------
A0A1H4I042      GVAVVGDIP----------MDKARRGTPAISFGT----------ENS-------------
A0A4R7A6D9      GVAVVGDIP----------MDKARRGAPAISFGT----------ENS-------------
A0A4Q4D4T1      KAPVIGAVA----------QDRHVADHPLISTLS----------NQH-------------
A0A261FE22      PAPILAAVP----------KSPTLAGRTPAVIVK----------PRG-------------
A0A5C8C085      GLSVVGSIP----------KAPLLAHDTNEAANLAVLEAAARGAGQS-------------
A0A1E4BP96      GASVVGVLP----------LDHDLDNRREVLSFTGASGNVVRG-----------------
A0A101KZQ4      GHSVIGTIP----------QTDTLDREQRLITSIGGNDRNEEHAGEY-------------
A0A439DNZ6      GVGVVGSIP----------LDKERKRSPAKSLDN----------DNS-------------
A0A0J6YE86      NVGLVGTVP----------LDKERRRHAAIAFEN----------DNS-------------
A0A5Q5BFU2      GAGVVGNIP----------LSKDRRKQAAIGFES----------DNS-------------
A0A151BT98      QRPVLSIVP----------RVGGGHRVVDTSDHP-----------SG-------------
A0A2Y8ZRF8      QRPVLSIVP----------RVGSGQRVVDTSDSP-----------SG-------------
A0A2R9UAT1      GVAVVGTVP----------VEKSFTAANRLIPVG------------------GQRDERLF
A0A4Q5J5D7      GVTVVGAIP----------TASDLASTDGAGPVAVQDRSGSQRRSES-------------
A0A1Y4CKD6      SMVCLGALP----------EVRAKARKRSAASRY---VSALDKRVSH-------------
A0A0Q7KBQ4      GGAVLATLP----------FDRQLKKQALTSEGH------------G-------------
A0A1F1IHY9      GLTILGTVP----------ESTRSARNRRRRDGGDVINLAGRVDGET----SPKQHQDSF
A0A542HCT5      GVTVAGAIP----------ETSALVRKKGGLVPLVVTGPRKDKDPVH-------------
A0A2S8WHZ8      GVSVVGTIP----------EDQRLTEGRSVVETG---SIVHDDRAAH-------------
A0A537WNY9      GVPSYGEVP----------HEPAVTRLATPEALA-------LDNRLH-------------
A0A5B8M469      GTGVLGRVP----------RFKGKGGVRGGELDR--------------------------
A0A1Y4CTD2      DGRVLGTVP--------------FERKRVVRGGD----------ERSVPALVLSSPLVSM
A0A0Q5M6Z7      GAPVIGTIP----------ASPALEDRRRVTDSD-----------------SGDDAVELF
A0A3N3ZPU0      GLAILGTIP----------LDKRLTAKRGVIPTA-----------------PPRKDREAW
A0A359IQX7      GAGVIGVIP----------KVAELEQQRVEEGQV----------SLG-------------
A0A4R8TXC3      GSSILGVLP----------TSDDLTEENIVTGSS----------SDH-------------
A0A433EDP2      GSSILGVLP----------TSDDLTEENIVTGSS----------NDH-------------
A0A231VTW0      GSSILGVLP----------TSDDLTEENIVTGSS----------NDH-------------
A0A433ECD0      GSSILGVLP----------TSDDLTEENIVTGSS----------NDH-------------
U7V3Z1          GSSILGVLP----------TSDDLTEENIVTGSS----------NDH-------------
A0A1F1J417      NSNILGVLP----------VSDDLAEENIVHASN----------DDH-------------
A0A2A8D6P2      NSNILGVLP----------VSDDLAEENIVHASN----------DDH-------------
A0A1F0THV9      NSNILGVLP----------VSDDLAEENIVHASN----------DDH-------------
A0A5F0M6Y0      NSNILGVLP----------VSDDLAEENIVHASN----------DDH-------------
D8USQ4          NSNILGVLP----------VSDDLAEENIVHASN----------DDH-------------
E3H5W1          NSNILGVLP----------VSDDLAEENIVHASN----------DDH-------------
A0A1F1QKB0      NSNILGVLP----------VSDDLAEENIVRASN----------DDH-------------
A0A509JY23      NSNILGVLP----------VSDDLAEENIVRASN----------DDH-------------
A0A448USF4      NSNILGVLP----------VSDDLAEENIVRASN----------DDH-------------
A0A0Q9LZR0      GVTVAGAIP----------ETSALVRKKGGLVPLVVAGTSKEKDPVH-------------
A0A1N7E3F1      KSSVLGLIG----------YERDARRHPLVLRDQ----------GRS-------------
A0A544ZKQ1      RSSILGVIG----------YERDAKRHPLILRDQ----------GRS-------------
A0A372P1T1      RSSILGVIG----------YERDAKRHPLILRDQ----------GRS-------------
A0A5D0Q2X0      RSSILGVIG----------YERDAKRHPLILRDQ----------GRS-------------
A0A5R8Z2E7      RSSILGVIG----------YERDAKRHPLILRDQ----------GRS-------------
A0A1L2ZMV4      GHPVLGTVP----------QDKRLDHHRQVITVG----------EPG--------DKQGW
A0A6I3F378      AAPLLTVVP----------VTSSTGDRPLATTDP-----------TN-------------
A0A1S1CAD0      GASILGVLP----------VSDDLNEDNIVKGDT----------DDH-------------
G5ET14          GASILGVLP----------VSDDLNEDNIVKGDT----------DDH-------------
A0A1E9DXX2      GASILGVLP----------ISDDLNEENIVNGDT----------DDH-------------
A0A1E8S156      GASVLGVLP----------VSDDLNEDNIVKGDT----------DDH-------------
A0A1E8S5S2      GASVLGVLP----------VSDDLNEDNIVKGDT----------DDH-------------
A0A1S1DFA8      GASVLGVLP----------VSDDLNEDNIVKGDT----------DDH-------------
A0A2I1Z490      GASVLGVLP----------VSDDLNEDNIVKGDT----------EDH-------------
A0A1F0DAA9      GASILGVLP----------VSDDLNEENIVKGNT----------DDH-------------
A0A1F0PHK9      GASILGVLP----------VSDDLNEENIVKGNT----------DDH-------------
A0A1F0VZG6      GASILGVLP----------VSDDLNEENIVKGNT----------DDH-------------
A0A1E9G8X4      GASILGVLP----------VSDDLNEENIVNGNT----------DDH-------------
A0A1E9IAW2      GASILGVLP----------VSDDLNEENIVNGNT----------DDH-------------
A0A1E9ZBC9      GASILGVLP----------VSDDLNEENIVNGNT----------DDH-------------
A0A1E9ZDP4      GASILGVLP----------VSDDLNEENIVNGNT----------DDH-------------
A0A1F0R6B5      GASILGVLP----------VSDDLNEENIVNGNT----------DDH-------------
A0A1F0Z7N5      GASILGVLP----------VSDDLNEENIVNGNT----------DDH-------------
A0A1F1D897      GASILGVLP----------VSDDLNEENIVNGNT----------DDH-------------
D2NP38          GASILGVLP----------VSDDLNEENIVNGNT----------DDH-------------
A0A1F1FV74      GASILGVLP----------VSEDLNEENIVKGDT----------DDH-------------
A0A1E9M791      GASILGVLP----------VSEDLNEENIVKGDT----------DDH-------------
A0A291DEI8      GASILGVLP----------VSEDLNEENIVKGDT----------DDH-------------
A0A1S1D5T1      GASILGVLP----------VSDDLSEENIVNGGT----------DDH-------------
A0A1E8TRD6      GASILGVLP----------VSDDLSEENIVNGDT----------DDH-------------
A0A1F0XT88      GASILGVLP----------VSDDLSEENIVNGDT----------DDH-------------
A0A1F1EVP5      GASILGVLP----------VSDDLSEENIVNGDT----------DDH-------------
C6R548          GASILGVLP----------VSDDLSEENIVNGDT----------DDH-------------
A0A0K2RXS2      GASILGVLP----------VSDDLNEENIVNGNT----------DDH-------------
A0A1F0KX60      GASILGVLP----------VSDDLNEENIVNGNT----------DDH-------------
A0A542I3V2      DVPVIGTLP----------YDPDISGALKVLGTERHQLTQAGERNRA-------------
A0A2T0UZ65      GSSSLGVIP----------LSNELRKARGGRSSG-----------LG-------------
A0A1R4JTI6      GLTVLGTIP----------AMAGLGRRAQRNRTQSKDSNAEVESRSALLELTGHTGRDDF
A0A4R7TM52      GHAVVGTIP----------FEKSFTSAGRLIPFG----------GGY----DEGIRSKHF
A0A542XE74      GKAVLGVVP----------ETKSLKVRKGQASKR----------VSG-------------
A0A0G3V3F3      GLPVLGRIP----------KGEGF------------------------------------
A0A0Q7QDF6      KAPVIGAVA----------QDRHVADHPLISTLS----------NQH-------------
A0A3S0V9U6      GLGVLGVLP----------KTNALDQNSFLEDAA-----------DH-------------
A0A5R8L819      GRAVVGILP----------LERTFSSASRLL-------------PAG----GSHVPHELF
A0A261FQA1      YSPVISSVP----------KSDTFRGTAPAVISD----------PSS-------------
A0A1Q2CJ92      ETSSLGIVP----------AAAELAGESALVTGS------------S-------------
A0A2T0S3C8      GAPVLAGVP----------FDADARSGPLRLTGS----------GHS-------------
A0A4Y8WZJ3      GLTILGTVP----------ESTRSARNRRRRDGGDVINLAGRVDGET----SPKQHQDSF
A0A285VUW0      GRPVLSTVP----------VLPTAGRTSSMYIEN---------DPFG-------------
A0A2R7Z032      GSAVIGIIP----------KVDALNRTHRGVRGD-----------LG-------------
A0A1I0W453      GASVLGIIP----------KEDSLGRSHRGVRGD-----------LG-------------
A0A1H4LCS9      GASVLGIIP----------KEDALGRGHRGVRGD-----------LG-------------
A0A4Q2RZP8      GSSVLGIIP----------KEDALGRGHRGVRGD-----------LG-------------
A0A0Q6VV12      GAAVLGIIP----------KEDALGRTHRGVRGD-----------LG-------------
A0A495NTA9      GASVLGIIP----------KEDALDRGHRGVRGD-----------LG-------------
A0A0Q9QB08      GAAVLGVIP----------KEDALGRVNRGVRGD-----------LG-------------
A0A4Q2SA86      GAAVLGIIP----------KEDSLGRTHRGVRGD-----------LG-------------
A0A4Z1C3Z0      GAAVLGVIP----------TEDSLGRTHRGVRGD-----------LG-------------
A0A4Q2JUT1      GVAVVGTIP----------WVAGFDSGERLVDTS--AANRTGRTGTF-------------
A0A542J310      DVAVVGTIP----------WVAAFNDDNRIVDPA--AANSTGKNGTF-------------
A0A444BL03      GASVLGVVP----------VTSELRVQGGRGRLD----------HLG-------------
A0A4Y8X357      GAGLLGAIP----------QDKTMTAERTDRLGD----------PSP-------------
R4LD52          AAPVLAAVP----------FDDDAKEGPRALLGT----------GHS-------------
A0A4T2CD79      KLAVIGVLP----------KDAALTDENRIVSETGGIHAGSVTVQSR-------------
A0A2N3YJR1      GASVLGVVP----------VTPELRAARGRGRLD----------ALG-------------
A0A6G8FYB9      AASVLGVVP----------QTKELGVVRGRGRVG----------QLG-------------
A0A4Q4D742      SSAVLATLP----------FYPQVKKEP--LSAE----------TGG-------------
A0A4Q2RU39      GAAVLGVIP----------KEEVLGRTHRGVRGD-----------LG-------------
A0A4Q2SK58      GASVLGIIP----------KEEALGRSHRGVRGD-----------LG-------------
A0A1C6T1J1      GSPLLGEIP----------LDTAARTAPLIVGEA----------ATS-------------
A0A2W2CFC8      DSPLLGEIP----------LDNDARTAPLIIGVA----------AAS-------------
A0A2W2A4B0      DLPVLGDIG----------FDPEASKQPLVLRDA----------RAS-------------
A0A4Y9MDA5      SLPVVGSIP----------TRPAGSTPGAVVDAD----------PSG-------------
A0A1H7N9P7      GLPVVGSIP----------TRPSGSTAHPAVDAD----------PHG-------------
A0A1M7V0F8      GVPVVGAIP----------ARSPRSAPGAVVETD----------SHS-------------
A0A022KX11      DAPMLAGLP----------LE-----SRGSKRGLISVEEDPHG-----------------
A0A4Q5A868      DAPIIGRIP----------EEELLNSAKPVIVS------EPGS-----------------
A0A345NSU7      DRPVLSTIP----------M------RKADDAHSIYLELDPFG-----------------
A0A0W8I9Y2      GVAVLGVIP----------TDDRLADHREIVETGFSAG-RGHH-----------------
A0A4Y5YMQ6      DLPVLGLVP----------R------RRNPAQGAAFLI-SPNG-----------------
A0A255G8R8      TASQVGSIP----------Y------VAGTPEHPLELG-AHTD-----------------
A0A6G7Y423      TLPLLASIG----------R------RHPDPAQGGE-G-AHWA-----------------
A0A2N4T4Q5      GTPVLGIIP----------EDDRLADHREIIETGTSGGRGHH------------------
A0A1M3LEY6      DAPILGGIA----------FDKLAPKRPLIVQSEPNSPR---------------------
A0A538AJI7      GYPVVGRIP----------PSRALKQGPLAAFSDLRT-----------------------
A0A538AM15      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      DAPVLGSLS----------RNEAYVGTSPVIISRPAS-----------------------
A0A357ZCV8      -------------------MARHRKVGREQESPGSRS-----------------------
A0A4R1CW45      QLETLRVVQ----------PNRDAVASNNVVGFDSRD-----------------------
A0A4R5Z7B0      ARKLIANLD-------------------------PKS-----------------------
A0A419GS64      ------MAM----------KTKSRGSKYLYTKDFPAS-----------------------
A0A2V2CXY5      -----MASE----------GRAGMKELVIRNMPKLPF-----------------------
A0A2S8MDM2      -------------------LDKERRKQPAISFETDNA-----------------------
A0A357ZDL3      ------------------------MSKKNNKSFSNNH-----------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      --------------------MRTRSSRGGAEVRSPEE-----------------------
A0A1I6GVG4      EKSFTADNR----------LLPFDGGTSRSSESAHLF-----------------------
A0A1I6IST1      EKSFTADNR----------LLPFDGGTSRSSESAHLF-----------------------
A0A412JBM5      DRKLLTYDS--------------------------PF-----------------------
A0A510HHA8      SGRLITLHD-------------------------PSN-----------------------
A0A6G8Q9J3      SASLVTVTD-------------------------PTG-----------------------
A0A1C2B334      ----IGLVP----------GDSALDGEGFVDFGAGGS-----------------------
R7Y679          GVHSLGVVA----------SDGAFADRSLIDFRAGGS-----------------------
A0A5Q2F9A3      DSPLVGRIG----------YDAASERGLTLISDAITS-----------------------
A0A4R1BMZ2      SGRLVTILD-------------------------PEG-----------------------
A0A023X491      TDRLVSLSD-------------------------PGG-----------------------
A0A6G8QDQ0      AENLITLAE-------------------------PGG-----------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ERRNGSGEE-------------------------GAA-----------------------
A0A6D1QMN1      QRSLITEFD-------------------------QRS-----------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      GEHLVSLLN-------------------------PAS-----------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      KHPLLTEVG-------------------------SHS-----------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      FAAEQYRGLRHLVEQFH-------------------------------------------
A0A348NU28      HTSEEFRRIRAALSYSG----------------------V--------------------
A0A4Q5APW3      PVAEGFRRVRTNLSFMAP---------------------V--------------------
A0A4Q5B0V3      PVAEGFRRVRTNLSFMAP---------------------V--------------------
A0A222TG79      PASEAYRRLRTNLSFIG----------------------V--------------------
A0A6I3DFP2      ETVEAFRVLRTNLMVLE----------------------A--------------------
A0A1Q2CRV2      LRAEAYRSMRTNLQFLA----------------------L--------------------
A0A2S5WZJ5      IAAESFRRLRTNLRFAS----------------------V--------------------
K6WHS4          PAAEAFRHLRTNLSFMD----------------------V--------------------
A0A1L2ZMQ6      AYSEALRELRTNLAYMD----------------------V--------------------
A0A3L8NYD3      PAAEALRQLRTNLRFVD----------------------V--------------------
A0A1M6K628      TAAEALRQLRTNLRFVS----------------------V--------------------
A0A561E8R3      NAAEALRMLRTNLRFID----------------------V--------------------
A0A3E2DN22      VTGEAFRHLRTNLRFAN----------------------V--------------------
A0A3Q9ULZ9      ITAEAFRQLRTNLRFIN----------------------V--------------------
A0A3S9JFL2      IAGEAFRQLRTNLRFIN----------------------V--------------------
A0A1Q2CI19      PYADGYRSVRAALAHGQAEAAPA----------------R--------------------
A0A512T3M3      PFADGYRAARTAISHTLGRSAKPSDMSPR-----ERRGTR--------------------
W6JTW4          PFADAYRAARAATTHSVETSRAAAPRGPR-----E--NDP--------------------
A0A0A0JTY0      IYSDGYRAARTALVHTTGQVMPGDYTPRRAASEVPEKQ-A--------------------
A0A0A0JXF2      LYSDAYRAARTALSHTAGQVMPSDYTPRR--STVEPRR-S--------------------
E6S8H2          PYADGYRGARTALVHTSSLLVQGD--DRR--PTSPPEPVS--------------------
A0A0A0JGH0      PYSDAYRAARTALMHTVSRQAPGEYMGRR--AARPEPRPV--------------------
N0E4U7          PYSDAYRAARTALMHTVSRKMTGDYTGRR--AATAERGGT--------------------
A0A0A0IYK2      NYSDGYRAARTALVHTTGQIMPGDYTPRR--SAAGARP-A--------------------
A0A0Q9L0H3      NYSDGYRAARTALVHTSGQIMPGDYTPRR--PGGEESR-S--------------------
A3TMK0          LYADGYRAARTALTHTAGQVMPGDYSPRR--SAIEPRR-P--------------------
A0A543PXP1      PYSDSYRAARTALAHTASQHAGASVSSTD--VPRGYAA----------------------
A3TMH6          PYADAYRGARTAIVHTASQRLSVGSAPRH--LLDGPAT-Q--------------------
A0A1H6WL79      AMAEALRELRTNLNFID----------------------V--------------------
A0A101LAM5      AMAEALRELRTNLDFID----------------------V--------------------
A0A4Y3NEG0      AMAEALRELRTNLDFID----------------------V--------------------
A0A1H6YPK1      AFTEAMRQLRTNLQFMN----------------------V--------------------
A0A2R7MGI0      AHKEAIRELRTNLQYVD----------------------V--------------------
A0A2T7WQY4      AHKEAVRELRTNLQYVD----------------------V--------------------
A0A1G6GTN3      AHKEAMRELRTNLQYVD----------------------V--------------------
A0A1N7DLV3      AHKEAMRELRTNLQYVD----------------------V--------------------
A0A1V2NSB5      AHKEAMRELRTNLQYVD----------------------V--------------------
A0A0Q5Q5L3      AHKEAMRELRTNLQYVD----------------------V--------------------
A0A0Q6DVM4      AHKEAMRELRTNLQYVD----------------------V--------------------
A0A1R3WWR6      AHKEAMRELRTNLQYVD----------------------V--------------------
A0A5Q2FA83      AA-EEYRRLRTNLQFAD----------------------V--------------------
A0A542FTE6      IT-EGIRELRTNLAYVS----------------------I--------------------
A0A2S5UYV0      AA-ESFRRLRTNLRFAS----------------------V--------------------
A0A2S5X9U6      AA-ESFRRLRTNLRFAS----------------------V--------------------
A0A2S5ULV5      AA-ESFRRLRTNLRFAS----------------------V--------------------
A0A653YMF0      AA-ESFRRLRTNLRFAS----------------------V--------------------
A0A4V1VGV9      TA-EAFRMLRTNLRYIS----------------------T--------------------
A0A3Q9IY80      S--EAMRELRTNLQFMD----------------------V--------------------
A0A0F0LP73      ---EAHRQIRTGLRFAS----------------------V--------------------
A0A1F1X071      PSREALRKLRTNLRYID----------------------V--------------------
A0A3R8RWC7      PSREALRKLRTNLRYID----------------------V--------------------
A0A4U0RJZ4      TS-EAFRMLRTNLRYVL----------------------A--------------------
A0A4R1FGL9      TS-EAFRMLRTNLRYVS----------------------A--------------------
E3B8H1          TS-EAFRMLRTNLRYVS----------------------A--------------------
A0A0Q5AWK6      TA-EAYRALRTGLRFSS----------------------V--------------------
A0A3N1NLD3      TA-EAFRALRTGLRFSS----------------------V--------------------
A0A3N2FVI8      TA-EAFRALRTGLRFSS----------------------V--------------------
A0A2S5XDQ6      TA-EAFRSLRTGLRFSS----------------------V--------------------
A0A2S5XNN6      TA-EAFRSLRTGLRFSS----------------------V--------------------
A0A3L7ADK2      ---ESLRELRTNLSYVD----------------------V--------------------
A0A6I2XCV4      RTAELYRTVRTSILFAI----------------------E--------------------
A0A5R8VLL6      AFSEALRELRTNLTFLD----------------------V--------------------
A0A538JQF8      PLAEGYRVLRTSLLRMP----------------------TRVFTEAPPTPDASGGHPEVE
A0A0Q5JKD6      ---EAMRELRTNLQYVD----------------------V--------------------
A0A0Q9TBP0      PASEEYQRLGVNVRFMV----------------------AT------------------G
A0A346XTB0      --AEAYEFVLSSIEFAL----------------------A--------------------
A0A0G3V3M7      LMAEAYRSFRTSLVAMW----------------------QR------------------H
A0A6I3DD56      LMAEAYRSFRTSLVAMW----------------------QR------------------H
A0A2W6DK08      SAAEAYRSLRSSIMFTE----------------------NR------------------M
A0A2S0LQ32      QAAEAIRLLRTNLRFVD----------------------V--------------------
A0A2N6V1R5      QAAEALRHLRTNLRFVD----------------------V--------------------
G9PHS6          QAAEALRHLRTNLRFVD----------------------V--------------------
U1PLM7          QAAEALRHLRTNLRFVD----------------------V--------------------
A0A6I1G2U1      VYADGYRTARAAVMHTA----------------------SL------------------E
A0A351ETF8      LAAERYEAVLTAIEFAS----------------------I--------------------
A0A349B7N2      RIAEAYRGLRTSVQYMG----------------------VV------------------T
A0A346Y185      ---EAYQFLVGALAFAL----------------------A--------------------
A0A259S8H9      VAHEAYRQIRTGLRFAS----------------------V--------------------
A0A0Q5L115      ---EALRELRTNLAYVK----------------------V--------------------
A0A2W1Z497      ---EALRELRTNLSYVH----------------------V--------------------
A0A1H4I042      QIAESFRKLRTNLSFLS----------------------V--------------------
A0A4R7A6D9      QIAESFRKMRTNLSFLS----------------------V--------------------
A0A4Q4D4T1      PRAEAMRIIRTNLQFLD----------------------V--------------------
A0A261FE22      HAAEEFRRLITNLSFVK----------------------N--------------------
A0A5C8C085      -AAEAFRKLRTNLQFMN----------------------V--------------------
A0A1E4BP96      ALTEAIRELRTNLQFMD----------------------V--------------------
A0A101KZQ4      AVAESIRELRTNLQFMN----------------------I--------------------
A0A439DNZ6      AFAEAFRKLRTNLQFLA----------------------V--------------------
A0A0J6YE86      VIAEAFRKLRTNLQFLS----------------------V--------------------
A0A5Q5BFU2      GIAEAFRKLRTNLQFLA----------------------V--------------------
A0A151BT98      AMVEAMRRLRTNVKFVN----------------------V--------------------
A0A2Y8ZRF8      AMVEAMRRLRTNVKFVN----------------------V--------------------
A0A2R9UAT1      AVSEALRELRTNIQFMD----------------------V--------------------
A0A4Q5J5D7      --AEAFRKLRTNLQFMD----------------------V--------------------
A0A1Y4CKD6      GFRESARAMGARVRDAL----------------------S--------------------
A0A0Q7KBQ4      ALAEAFRVLRTNLQFAN----------------------L--------------------
A0A1F1IHY9      RLTESFKELRTNLQFLR----------------------P--------------------
A0A542HCT5      -SAESFLKLRTNLQFMD----------------------I--------------------
A0A2S8WHZ8      AFSESLRELRTNLNYID----------------------V--------------------
A0A537WNY9      VFAEALRDVRTNLLFTE----------------------G--------------------
A0A5B8M469      LSAESFRQVRTGLRFSS----------------------V--------------------
A0A1Y4CTD2      GFAEANRRTATRLEAHL----------------------R--------------------
A0A0Q5M6Z7      TISESLRELRTNLSYID----------------------V--------------------
A0A3N3ZPU0      ATSEAFRQLRTNLTFAN----------------------V--------------------
A0A359IQX7      EASEAFRHLRTNLRYVN----------------------V--------------------
A0A4R8TXC3      IAQESIRQLRTNLRFVN----------------------I--------------------
A0A433EDP2      IAQESIRQLRTNLRFVN----------------------I--------------------
A0A231VTW0      IAQESIRQLRTNLRFVN----------------------I--------------------
A0A433ECD0      IAQESIRQLRTNLRFVN----------------------I--------------------
U7V3Z1          IAQESIRQLRTNLRFVN----------------------I--------------------
A0A1F1J417      IAHESIRQLRTNLRFVN----------------------I--------------------
A0A2A8D6P2      IAHESIRQLRTNLRFVN----------------------I--------------------
A0A1F0THV9      IAHESIRQLRTNLRFVN----------------------I--------------------
A0A5F0M6Y0      IAHESIRQLRTNLRFVN----------------------I--------------------
D8USQ4          IAHESIRQLRTNLRFVN----------------------I--------------------
E3H5W1          IAHESIRQLRTNLRFVN----------------------I--------------------
A0A1F1QKB0      IAHESIRQLRTNLRFVN----------------------I--------------------
A0A509JY23      IAHESIRQLRTNLRFVN----------------------I--------------------
A0A448USF4      IAHESIRQLRTNLRFVN----------------------I--------------------
A0A0Q9LZR0      -SAESFLKLRTNLQFMD----------------------I--------------------
A0A1N7E3F1      VRAEAFRSLRTNLQFIG----------------------V--------------------
A0A544ZKQ1      SRAEAFRSLRTNLQFIG----------------------V--------------------
A0A372P1T1      SRSEAFRSLRTNLQFIG----------------------V--------------------
A0A5D0Q2X0      SRSEAFRSLRTNLQFIG----------------------V--------------------
A0A5R8Z2E7      SRSEAFRSLRTNLQFIG----------------------V--------------------
A0A1L2ZMV4      ATSEALRELRTNLTFSR----------------------V--------------------
A0A6I3F378      DAVEAYRWLRTSVQFAG----------------------T--------------------
A0A1S1CAD0      IAQESIRQLRTNLRFVN----------------------V--------------------
G5ET14          IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1E9DXX2      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1E8S156      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1E8S5S2      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1S1DFA8      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A2I1Z490      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1F0DAA9      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1F0PHK9      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1F0VZG6      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1E9G8X4      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1E9IAW2      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1E9ZBC9      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1E9ZDP4      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1F0R6B5      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1F0Z7N5      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1F1D897      IAQESIRQLRTNLRFVN----------------------V--------------------
D2NP38          IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1F1FV74      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1E9M791      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A291DEI8      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1S1D5T1      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1E8TRD6      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1F0XT88      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1F1EVP5      IAQESIRQLRTNLRFVN----------------------V--------------------
C6R548          IAQESIRQLRTNLRFVN----------------------V--------------------
A0A0K2RXS2      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A1F0KX60      IAQESIRQLRTNLRFVN----------------------V--------------------
A0A542I3V2      -FVEALRALRTNLRFVD----------------------V--------------------
A0A2T0UZ65      LAGESFRQIRTNLRFVS----------------------P--------------------
A0A1R4JTI6      HVVEAFKELRTNLQFLR----------------------P--------------------
A0A4R7TM52      RVAEAMRELRTNIQFMD----------------------V--------------------
A0A542XE74      AAGEALRQLRTNLRFVS----------------------V--------------------
A0A0G3V3F3      ETVEAFRVLRTNLMVLE----------------------A--------------------
A0A0Q7QDF6      PRAEAMRIIRTNLQFLD----------------------V--------------------
A0A3S0V9U6      QSAESLRQLRTNLRFVS----------------------V--------------------
A0A5R8L819      AMSEAMRELRTNIQFMD----------------------V--------------------
A0A261FQA1      KAAEDIRRLALNLDFIV----------------------P--------------------
A0A1Q2CJ92      AAAEAIRQIRTNLRFVS----------------------V--------------------
A0A2T0S3C8      PRSEALRQLRTNLQFVD----------------------V--------------------
A0A4Y8WZJ3      RLTESFKELRTNLQFLR----------------------P--------------------
A0A285VUW0      PQAEAIRKLRTNLVFVD----------------------V--------------------
A0A2R7Z032      QAAEAFRQLRTNLRFLD----------------------V--------------------
A0A1I0W453      KAAESFRQLRTNLRFVD----------------------V--------------------
A0A1H4LCS9      RAAESFRQLRTNLRFVD----------------------V--------------------
A0A4Q2RZP8      RAAESFRQLRTNLRFVD----------------------V--------------------
A0A0Q6VV12      RAAESFRQLRTNLRFVD----------------------V--------------------
A0A495NTA9      RAAEAFRQLRTNLRFVD----------------------V--------------------
A0A0Q9QB08      RAAEAFRVLRTNLRFVD----------------------V--------------------
A0A4Q2SA86      RAAEAFRQLRTNLRFVD----------------------V--------------------
A0A4Z1C3Z0      RAAEAFRLLRTNLRFVD----------------------V--------------------
A0A4Q2JUT1      AVSEALRSLRTNLQFMD----------------------V--------------------
A0A542J310      AVSEALRSLRTNLQFMD----------------------V--------------------
A0A444BL03      IASESFRQIRTNLRFVG----------------------V--------------------
A0A4Y8X357      RAAEAVRQLRTNLRFAA----------------------V--------------------
R4LD52          ARAEALRQLRTNLQYVD----------------------V--------------------
A0A4T2CD79      PLAEAFRELRTNMRFMR----------------------V--------------------
A0A2N3YJR1      ASAESFRQIRTNLRFVG----------------------V--------------------
A0A6G8FYB9      IATEAFRQIRTNLRFVG----------------------V--------------------
A0A4Q4D742      NLAEAFRVLRTNLQFVK----------------------L--------------------
A0A4Q2RU39      RAAEAFRQLRTNLRFVD----------------------V--------------------
A0A4Q2SK58      KAAEAFRQLRTNLRFVD----------------------V--------------------
A0A1C6T1J1      ARAEAVRKLRTNLRFVD----------------------V--------------------
A0A2W2CFC8      ARAEAIRKLRTNLRFVD----------------------A--------------------
A0A2W2A4B0      ARAEAFRSLRTNVQFLA----------------------S--------------------
A0A4Y9MDA5      VVAEAFRQLRTNLQFVG----------------------V--------------------
A0A1H7N9P7      VVAEAVRQFRTNLQFLG----------------------M--------------------
A0A1M7V0F8      VAAEAFRHLRTNLQFVG----------------------V--------------------
A0A022KX11      RHAEAVRRLRTNLMFVD-------------------------------------------
A0A4Q5A868      PVAEGFRRVRTNLSFMA----------------------P--------------------
A0A345NSU7      PQAEAVRQLRTNMMFVD-------------------------------------------
A0A0W8I9Y2      EFSEALRELRTNLSFVS-------------------------------------------
A0A4Y5YMQ6      SAAEAFRQVRSALRFSA-------------------------------------------
A0A255G8R8      QRFEAYRRLRTNVQFVA-------------------------------------------
A0A6G7Y423      TA-EAYRRLRTNVGFVA----------------------L--------------------
A0A2N4T4Q5      AFSEALRELRTNLSFVS----------------------V--------------------
A0A1M3LEY6      --AEAFRSLRTNLQFLD----------------------V--------------------
A0A538AJI7      --ASAFRILRANLEPQL----------------------R--------------------
A0A538AM15      --AEQYRALRHTVEQLH----------------------K--------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      REAEEIRRLRTNVMFVL----------------------P--------------------
A0A357ZCV8      EVQNAAKTLYANIRFLS----------------------P--------------------
A0A4R1CW45      KRSRPFSLMRTQLAKRL----------------------V--------------------
A0A4R5Z7B0      PISEQYRTIRTNIQYSS----------------------I--------------------
A0A419GS64      VLAESYRTLRANILLTN----------------------V--------------------
A0A2V2CXY5      DVTEALNQFRINLGFC--------------------------------------------
A0A2S8MDM2      ATAEAFRKLRTNLQFLA----------------------I--------------------
A0A357ZDL3      EIQNAIKTLYANIRFLS----------------------P--------------------
A0A4Y8ZIU8      --------LRTNLRFAA----------------------V--------------------
A0A0F0KYJ9      -----MRELRTNLVYMD----------------------V--------------------
A0A538BBM6      IQREAVRVLRSNLQVAL----------------------A--------------------
A0A1I6GVG4      GIGEAMRELRTNLQYMD----------------------V--------------------
A0A1I6IST1      GIGEAMRELRTNLQYMD----------------------V--------------------
A0A412JBM5      AIREAYVRLRTNLMFCV----------------------N--------------------
A0A510HHA8      PASEAYRTLRTGLLYAV----------------------V--------------------
A0A6G8Q9J3      AASEAYRGLRTNLLYAQ----------------------V--------------------
A0A1C2B334      VIAESYRRIRTNLAFAA----------------------V--------------------
R7Y679          STAEQFRKIRTNLTFAN----------------------V--------------------
A0A5Q2F9A3      PRAEAFRRLRTNLQYLG----------------------R--------------------
A0A4R1BMZ2      PAAEAYRTLRTNLLYAL----------------------V--------------------
A0A023X491      QAAEAYRTLRTSLLYSV----------------------V--------------------
A0A6G8QDQ0      MAAEDYRTLRTSLLYTV----------------------V--------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ---------RTNLSFLD----------------------V--------------------
A0A1Q7WJN6      GVIEALRGVRLNVAYAH-------------------------------------------
A0A6D1QMN1      PVSEQFKTLRTNIQFSS----------------------I--------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      FEAEQYRVLRHLVETLR----------------------K--------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      TRVEAFRLLRTNLQFLD----------------------L--------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      -------------------K-SA----RLSVLAVSSPASGDGKTTTAINLAGALA-QAPE
A0A348NU28      -------------------A-EK----VQ-RLMVTSVSPGEGKSMFASNLGLTLA-GLR-
A0A4Q5APW3      -------------------EDTN----CR-LIVVTSIGASEGKTTTSVNIAAALA-ENG-
A0A4Q5B0V3      -------------------EDTN----CR-LIVVTSIGASEGKTTTSVNIAAALA-ENG-
A0A222TG79      -------------------D-SP----HR-RFAVTSALEGEGKTTTAVNLAVCLS-EVG-
A0A6I3DFP2      -------------------A-GR----PR-TVAVVSNTQDAGKSFVSINLAQSAS-ALD-
A0A1Q2CRV2      -------------------D-KG----GR-SIVVTSSVPGEGKTSTAINLAATLA-AAG-
A0A2S5WZJ5      -------------------D-EE----IR-SMVITSSNAGEGKSTIATSLAQVLA-QSN-
K6WHS4          -------------------D-SP----AR-MIAVTSPSPGDGKTTVALNLAASLA-EAG-
A0A1L2ZMQ6      -------------------D-NP----PR-VIVVTSSVPGEGKSSLSANLAVTIA-HTG-
A0A3L8NYD3      -------------------D-KP----PQ-SIVITSANAGEGKSVVTANLARVLA-AAG-
A0A1M6K628      -------------------D-TP----VR-SIVVTSPSQGEGKSTIAMQLAALLA-ESG-
A0A561E8R3      -------------------D-RH----PR-SIVVTSPNPGEGKSTVAANLARVLA-AAG-
A0A3E2DN22      -------------------D-NP----PR-AVVVTSANPGEGKSTVSTHLAVVMA-QAG-
A0A3Q9ULZ9      -------------------D-HP----PK-AVVITSANPGEGKSTVGSYLARAVA-RSG-
A0A3S9JFL2      -------------------D-HP----PK-AVVVTSANPGEGKSTVCSYLARSVA-RSG-
A0A1Q2CI19      -------------------G-HQ----SL-VVLVSSAHVAEGKSTSTANLAASFA-ETG-
A0A512T3M3      -------------------T-NH----TP-WVLVTSANPGDGKTTSVGNLAASFA-ESG-
W6JTW4          -------------------E-PQ----AV-AVLVTSAQPSEGKTTSVANLAASFA-ESG-
A0A0A0JTY0      -------------------A-TG----AR-LIVVTSAHAAEGKTTSVANLAASFA-ETG-
A0A0A0JXF2      -------------------A-SS----AR-LVLITSAHAAEGKTTSVANLAASFA-ETG-
E6S8H2          -------------------A-AS----AS-LILVTSAHPREGKTTSVANLAASFA-ETG-
A0A0A0JGH0      -------------------V-EG----AR-LILVTSGNAAEGKTTTVANLAASFA-ETG-
N0E4U7          -------------------A-TG----AR-LILVTSANAAEGKTTTVANLAASFA-ETG-
A0A0A0IYK2      -------------------A-KG----AR-LILVTSAHAAEGKTTSVANLAASFA-ETG-
A0A0Q9L0H3      -------------------R-QG----GR-LVLITSAHAAEGKTTSVANLAASFA-ETG-
A3TMK0          -------------------A-NT----AR-LVLITSAHASEGKTTSVANLAASFA-ETG-
A0A543PXP1      ---------------------AQ----GR-LILVTSAYPGEGKTTSVANLAASFA-ETG-
A3TMH6          -------------------L-EG----AR-VVLVTSAHPAEGKTTTVANLAVSFA-ESG-
A0A1H6WL79      -------------------D-NP----PR-ILLITSSLPSEGKSTVTSNLAATIA-AAG-
A0A101LAM5      -------------------D-NP----PR-ILLITSSLPSEGKSTVTSNLAATIA-AAG-
A0A4Y3NEG0      -------------------D-NP----PR-ILLITSSLPSEGKSTVTSNLAATIA-AAG-
A0A1H6YPK1      -------------------D-HP----PR-VLVVTSPVPGDGKSTMAVMLAAAIA-ESG-
A0A2R7MGI0      -------------------D-RP----PR-VIVVTSPLPGDGKSTTAANLAVSIA-ATG-
A0A2T7WQY4      -------------------D-HP----PR-VIVVTSPLPGDGKSTTAANLAVSIA-ATG-
A0A1G6GTN3      -------------------D-RP----AR-IVVVTSPLSGDGKSTTAANLAVSIA-ATG-
A0A1N7DLV3      -------------------D-RP----PR-VMVVTSPLPGDGKSTTAANLAVSIA-ATG-
A0A1V2NSB5      -------------------D-RP----PR-VMVVTSPLPGDGKSTTAANLAVSIA-ATG-
A0A0Q5Q5L3      -------------------D-RP----AR-IMVVTSPLPGDGKSTTAANLAVSIA-ATG-
A0A0Q6DVM4      -------------------D-RP----AR-IMVVTSPLPGDGKSTTAANLAVSIA-ATG-
A0A1R3WWR6      -------------------D-RP----AR-VMVITSPLPGDGKSTTAANLAVSIA-ATG-
A0A5Q2FA83      -------------------T-TG----GKHSFVISSVMPGEGKTTTAVNLAIALA-DSG-
A0A542FTE6      -------------------D-DP----PS-VVVVVSASPGEGKSTVAANLADAVA-ASG-
A0A2S5UYV0      -------------------D-EE----IR-SMVITSSNAGEGKSTIATSLAQVLA-QSN-
A0A2S5X9U6      -------------------D-EE----IR-SIVVTSANAGEGKSTVSTSLAQVLA-QSN-
A0A2S5ULV5      -------------------D-EE----IR-SIVVTSANAGEGKSTVATSLAQVLA-QSN-
A0A653YMF0      -------------------D-EE----IR-SIVVTSANAGEGKSTVATSLAQVLA-QSN-
A0A4V1VGV9      -------------------E-RP----PR-SLVITSAMQSEGKSTVAANLARVLS-AAG-
A0A3Q9IY80      -------------------D-NP----PR-IIVVTSPLPGDGKSTTSANLAITLA-ANG-
A0A0F0LP73      -------------------D-QE----VR-VVMVTSANLGEGKSSTTRTLARVLA-ESG-
A0A1F1X071      -------------------D-NP----PR-SIVVTSSAPGEGKSTVAANLARVMA-RAG-
A0A3R8RWC7      -------------------D-NP----PR-SIVVTSSAPGEGKSTVAANLARVMA-RAG-
A0A4U0RJZ4      -------------------E-QP----PR-SLVITSAVQSEGKSTVASNLARVLA-AAG-
A0A4R1FGL9      -------------------E-QP----PR-SLVITSAVQSEGKSTVASNLARVLA-AAG-
E3B8H1          -------------------E-QP----PR-SLVITSAVQSEGKSTVASNLARVLA-AAG-
A0A0Q5AWK6      -------------------D-DE----TR-SVVITSANQAEGKSTIASGLARVTA-DSG-
A0A3N1NLD3      -------------------D-DE----TR-SVVITSANQAEGKSTIASGLARVTA-DSG-
A0A3N2FVI8      -------------------D-DE----TR-SVVITSANQAEGKSTIASGLARVMA-DSG-
A0A2S5XDQ6      -------------------D-EE----TR-SVVITSANQAEGKSTIAAGLARVTA-ESG-
A0A2S5XNN6      -------------------D-EE----TR-SVVITSANQAEGKSTIAAGLARVTA-ESG-
A0A3L7ADK2      -------------------D-NP----PQ-VFVVTSPNPGEGKSTLSANLAETLAVNSG-
A0A6I2XCV4      --AESLAALANSDSPDSPRN-DR----TP-VILVTSPSPGEGKTTTTANVASVFA-AAG-
A0A5R8VLL6      -------------------D-NP----PR-IIVVTSSVSGEGKSTIAANLASAMA-AAG-
A0A538JQF8      AAAAVPSGVGEWRPVGDSNG-AT----PK-VVLVCSPRPREGKTMTVANLAVCLA-ESG-
A0A0Q5JKD6      -------------------D-RP----AR-VLVVTSPLPGDGKSTIAANLAVSIA-ATG-
A0A0Q9TBP0      A------------------Q-ES----AP-IVLLTSGQESEGKTVTSCNLAVSAA-RLG-
A0A346XTB0      -------------------D-LD----GK-SLLITSTLPGDGKTTTTLQLAIAAS-RDR-
A0A0G3V3M7      PTNNRPVLAGASEPE----A-TP----LR-VLLVTSPGPAEGKSISVVNIAAAFA-ETG-
A0A6I3DD56      PTNNRAGLSGSSEPE----A-TP----LR-VLLVTSPGPAEGKSISVVNIAAAFA-ETG-
A0A2W6DK08      NHFDREDMVLDRSAVDT--T-QP----PQ-VILVASACAAEGKTATVVNLAACFA-EVG-
A0A2S0LQ32      -------------------D-NP----PR-AIVMTSANPGEGKSTISAVLAQMLA-ASG-
A0A2N6V1R5      -------------------D-NP----PR-AIVMTSANPGEGKSTMSAVLAQMLA-SSG-
G9PHS6          -------------------D-NP----PR-AIVMTSANPGEGKSTMSAVLAQMLA-SSG-
U1PLM7          -------------------D-NP----PR-AIVMTSANPGEGKSTMSAVLAQMLA-SSG-
A0A6I1G2U1      VGRSESALAERRRAR----Q-GH----AK-VVMVTSAQAGEGKSTSVANLAASFA-ETG-
A0A351ETF8      -------------------G-EP----VS-SVLFTSAVPGDGKTTTAVNVAALAS--KY-
A0A349B7N2      SRVGESPSDLRRQQTKRRDR-SD----GT-VVLVTSPGPAEGKSTTVVNLAAAYA-ESG-
A0A346Y185      -------------------E-TG----GQ-SVVLTSASPVDGKTVTCLNLAVASA-QDG-
A0A259S8H9      -------------------D-QE----VR-VVMVTSANLGEGKSETTRALARVLA-ESG-
A0A0Q5L115      -------------------D-AQ----PR-VIVMTSPQPGDGKSTLAANLAESLAVSSD-
A0A2W1Z497      -------------------D-ER----PK-VLVVTSPLPGDGKSTIAANLARSLAVTST-
A0A1H4I042      -------------------D-NP----PR-VIVVTSSIPNEGKSTTAVNIALALV-EVE-
A0A4R7A6D9      -------------------D-NP----PR-VIVVTSSIPNEGKSTTAVNIALALV-EVD-
A0A4Q4D4T1      -------------------D-RV----SN-VYVVTSSVAGEGKTTTASNLAISLA-QSG-
A0A261FE22      -------------------D-RGNR--GN-VLVVTSAMLGEGKTTVSVNIAATFV-EKG-
A0A5C8C085      -------------------D-NP----PR-IIVVTSSKPGDGKSTVTANLAAAIA-ASG-
A0A1E4BP96      -------------------D-DP----PR-SIVVTSPLPGDGKSTTAANLAMSLA-AAG-
A0A101KZQ4      -------------------D-NP----PR-TIVITSALPGEGKSTVAANLAITIA-ASD-
A0A439DNZ6      -------------------D-NP----PR-VIVVTSSMPGEGKSTTAINLALVLA-EAE-
A0A0J6YE86      -------------------D-NP----PR-VIVITSSMPHEGKSTTAINIALALA-EAE-
A0A5Q5BFU2      -------------------D-NP----PR-VIVLTSSVPHEGKSTTAINIALALA-EAE-
A0A151BT98      -------------------T-ND----VP-AVVVTSARPGDGKTTVAANLALAMA-RDG-
A0A2Y8ZRF8      -------------------T-ND----VP-AVVVTSARPGDGKTTVAANLALAMS-RDG-
A0A2R9UAT1      -------------------D-HP----PR-VVVVTSPLPGDGKSTMSANLALAMA-ASG-
A0A4Q5J5D7      -------------------D-NP----PR-VIIITSPQQGDGKSTVAANLAGALA-VSG-
A0A1Y4CKD6      -------------------E-RG----AK-VVLVTSSIAGEGKSTVAINLAEQLA-QDG-
A0A0Q7KBQ4      -------------------D-AK----VE-SILVSSAVPNEGKTLVATNLAMSMA-QSG-
A0A1F1IHY9      -------------------D-EA----VS-IVTVTSAHPGEGKSTVAANLAVPVA-ESG-
A0A542HCT5      -------------------D-NP----PR-IIVVTSPLPGDGKSTVAMNLAAALS-MSD-
A0A2S8WHZ8      -------------------D-NP----PR-IIVVSSSVPGEGKSSVTANLAVAIA-STG-
A0A537WNY9      -------------------G-K-----LR-SVLITSPEGSHGKTTISYGLAVTLA-RAG-
A0A5B8M469      -------------------D-GE----VR-CVVVTSPNQSEGKSTVAARLAAVIA-ESG-
A0A1Y4CTD2      -------------------S-GG----FK-TVLVASVEENEGKSTVAANLAAALA-ERG-
A0A0Q5M6Z7      -------------------D-QP----PK-VIVVTSSIPGEGKSTLTANLADAIA-SAN-
A0A3N3ZPU0      -------------------D-DP----PR-TVVVTSSVAGEGKSSVAANLAVTLG-ALG-
A0A359IQX7      -------------------D-SP----PK-CIVVTSANASEGKSTVAANLARVLA-ESG-
A0A4R8TXC3      -------------------D-EP----PR-SFLVTSAVPSEGKSTVSLSLARSMA-ESG-
A0A433EDP2      -------------------D-EP----PR-SFLVTSAVPSEGKSTVSLSLARSMA-ESG-
A0A231VTW0      -------------------D-EP----PR-SFLVTSAVPSEGKSTVSLSLARSMA-ESG-
A0A433ECD0      -------------------D-EP----PR-SFLVTSAVPSEGKSTVSLSLARSMA-ESG-
U7V3Z1          -------------------D-EP----PR-SFLVTSAVPSEGKSTVSLSLARSMA-ESG-
A0A1F1J417      -------------------D-NP----PS-SFIVTSAVPGEGKSTVSLAVARSMA-SSG-
A0A2A8D6P2      -------------------D-NP----PS-SFIVTSAVPGEGKSTVSLAVARSMA-SSG-
A0A1F0THV9      -------------------D-NP----PS-SFIVTSAVPGEGKSTVSLAVARSMA-SSG-
A0A5F0M6Y0      -------------------D-NP----PS-SFIVTSAVPGEGKSTVSLAVARSMA-SSG-
D8USQ4          -------------------D-NP----PS-SFIVTSAVPGEGKSTVSLAVARSMA-SSG-
E3H5W1          -------------------D-NP----PS-SFIVTSAVPGEGKSTVSLAVARSMA-SSG-
A0A1F1QKB0      -------------------D-NP----PS-SFIVTSAVPGEGKSTVSLAVARSMA-SSG-
A0A509JY23      -------------------D-NP----PS-SFIVTSAVPGEGKSTVSLAVARSMA-SSG-
A0A448USF4      -------------------D-NP----PS-SFIVTSAVPGEGKSTVSLAVARSMA-SSG-
A0A0Q9LZR0      -------------------D-NP----PR-IIVITSPLPGDGKSTVAMNLAAALS-MSD-
A0A1N7E3F1      -------------------D-RQ----PK-SLVVTSCLPGEGKSSTSVNLAITMA-QAG-
A0A544ZKQ1      -------------------D-RQ----PK-SLVVTSCLPGEGKSSTSANLAITMA-QAG-
A0A372P1T1      -------------------D-RQ----PK-SLVVTSCLPGEGKSSTSANLAITMA-QAG-
A0A5D0Q2X0      -------------------D-RQ----PK-SLVVTSCLPGEGKSSTSANLAITMA-QAG-
A0A5R8Z2E7      -------------------D-RQ----PK-SLVVTSCLPGEGKSSTSANLAITMA-QAG-
A0A1L2ZMV4      -------------------D-NP----PR-IIVVTSALAGEGKSSIAANLAVTIA-QSG-
A0A6I3F378      -------------------D-RN----LK-VLQVTSAMPGEGKTTTTANLAIVLA-NAG-
A0A1S1CAD0      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
G5ET14          -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1E9DXX2      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1E8S156      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1E8S5S2      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1S1DFA8      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A2I1Z490      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1F0DAA9      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1F0PHK9      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1F0VZG6      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1E9G8X4      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1E9IAW2      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1E9ZBC9      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1E9ZDP4      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1F0R6B5      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1F0Z7N5      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1F1D897      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
D2NP38          -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1F1FV74      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1E9M791      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A291DEI8      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1S1D5T1      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1E8TRD6      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1F0XT88      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1F1EVP5      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
C6R548          -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A0K2RXS2      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLSLARAMA-DAG-
A0A1F0KX60      -------------------D-TP----PR-SFIVTSAVPGEGKSTVSLALARAMA-DAG-
A0A542I3V2      -------------------D-HR----PR-IILVTSPMTSDGKSTVTGNLAVTMA-ATG-
A0A2T0UZ65      -------------------D-AP----PQ-SIVVTSASPSEGKSTVSSTLASIIA-EDG-
A0A1R4JTI6      -------------------D-NP----PR-IIVVTSAAPAEGKSTVAANAAITLA-QSD-
A0A4R7TM52      -------------------D-RP----PR-IIVVTSPLPGDGKSTTSANLAIILA-ASG-
A0A542XE74      -------------------D-AP----PR-SVVVTSPAPGDGKSTIAAQLARLMA-VAG-
A0A0G3V3F3      -------------------A-GR----PR-TVAVVSNTQDAGKSFISINLAQSAS-ALD-
A0A0Q7QDF6      -------------------D-RV----SN-VYVVTSSVAGEGKTTTASNLAISLA-QSG-
A0A3S0V9U6      -------------------D-QP----PR-SIIVTSPNPGEGKSTVTSSLAHAFA-KAG-
A0A5R8L819      -------------------D-HP----PR-ILVVTSPLPGDGKSTTSANLAVTLA-ASG-
A0A261FQA1      -------------------D-KTDM--SN-VIVVASSDASEGKTTIAVNLAAAIA-ERG-
A0A1Q2CJ92      -------------------D-NP----AK-SIVITSSNEGEGKSTLAANIAAMFA-DAG-
A0A2T0S3C8      -------------------D-RP----VK-TLVITSAMPGEGKSSTACTLAGLFA-EAG-
A0A4Y8WZJ3      -------------------D-EA----VS-IVTVTSAHPGEGKSTVAANLAVTVA-ESG-
A0A285VUW0      -------------------A-SD---AGH-SFVVTSSLSAEGKTTTVVNLGMAMA-ESG-
A0A2R7Z032      -------------------D-NP----PR-RIVITSALASEGKSTVSSNLARLVA-QAG-
A0A1I0W453      -------------------D-NE----PR-KIVVTSALAGEGKSTVSSNIARLVA-QAG-
A0A1H4LCS9      -------------------D-NE----PR-RIVVTSALAGEGKSTVSSNIGRLVA-QAG-
A0A4Q2RZP8      -------------------D-NE----PR-RIVVTSALAGEGKSTVSSNIARLVA-QAG-
A0A0Q6VV12      -------------------D-NE----PR-KIVVTSALAGEGKSTVSANIARLVA-QAG-
A0A495NTA9      -------------------D-NE----PR-KIVVTSALAGEGKSTVSSNIARLVA-QAG-
A0A0Q9QB08      -------------------D-NE----PR-RIVVTSALAGEGKSTVSSNVARLVA-QAG-
A0A4Q2SA86      -------------------D-NE----PR-RIVVTSALAGEGKSTVSANIARLVA-HAG-
A0A4Z1C3Z0      -------------------D-NE----PR-RIVVTSALAGEGKSTVSANIARLVA-QAG-
A0A4Q2JUT1      -------------------D-HP----PK-TIVVTSPLPGDGKSTIACNLALTLA-AAG-
A0A542J310      -------------------D-HP----PK-TIVVTSPLPGDGKSTVACNLALTLA-AAG-
A0A444BL03      -------------------D-DP----PR-SIVVTSANAHEGKSTVSSTLARVLG-EAG-
A0A4Y8X357      -------------------D-DP----PR-VVMVTSSNPGEGKSTVIGSLAQAVA-ASG-
R4LD52          -------------------D-RP----VK-TLVVTSAVPGEGKSSTACGIAMLFA-QAG-
A0A4T2CD79      -------------------D-SP----PR-IIVISSPSPNDGKSTVTANLAVALS-AAG-
A0A2N3YJR1      -------------------D-DP----PR-SIVVTSANAGEGKSTVSATLARVLG-QSG-
A0A6G8FYB9      -------------------D-DP----AR-SIVVTSANAGEGKSTVAATLARVLG-ASG-
A0A4Q4D742      -------------------D-AE----RQ-AILVSSALPNEGKTLTATNLAISMA-QSG-
A0A4Q2RU39      -------------------D-NE----PR-KIVVTSALPGEGKSTVSANIARLVA-QAG-
A0A4Q2SK58      -------------------D-NE----PR-KIVVTSALPGEGKSTVSANIARLVA-QAG-
A0A1C6T1J1      -------------------H-EP----AR-VIAVTSALQGEGKTTMSCNLAIALA-EAG-
A0A2W2CFC8      -------------------D-EP----AR-VIAITSALQGEGKTTLSCNLAITLA-EAG-
A0A2W2A4B0      -------------------R-PE---GAR-TLAITSSRPSEGKTTTAANLAVALA-ESG-
A0A4Y9MDA5      -------------------G-DGDREGGR-VTAITSSRPGEGKSTVAVDLAAALA-ETG-
A0A1H7N9P7      -------------------Q-DEERAGAR-IVAVTSSRSGEGKSTVAVELAAALA-ETG-
A0A1M7V0F8      -------------------Q-DEDQGGAR-VLAVTSSRPGEGKSTVAVNLAAALA-ETG-
A0A022KX11      -------------------V-TT----GRHSFVITSAVPGEGKTTTAVNLALAMA-DSG-
A0A4Q5A868      -------------------MEDT----NCRLIVVTSTGASEGKTTTSVNIAAALA-ENG-
A0A345NSU7      -------------------V-TT----GKHSFVISSTLPGEGKTTTAVNLALAMS-DAG-
A0A0W8I9Y2      -------------------V-DS----PPKMIVVTSALPGEGKSSITANLAVAIA-STG-
A0A4Y5YMQ6      -------------------V-EH----QIGVLAVTSSIAGEGKTTMSVNTALAFA-EMG-
A0A255G8R8      -------------------A-PQ----GRTALVVTSSVPGEGKSVTVANLALAMA-DAG-
A0A6G7Y423      -------------------G-GE----RRRSMVITSSVQGEGKTQTAVNLARVLA-SAG-
A0A2N4T4Q5      -------------------D-AP----PR-VVVVTSSMPGEGKSSITANLAVAIA-STG-
A0A1M3LEY6      -------------------E-GG----PR-SFVVTSSVPSEGKSTTSANLAIVMA-QSG-
A0A538AJI7      -------------------E-GS----ID-LIVVSSPAPADGKTTVTTLLGEALS-RLG-
A0A538AM15      -------------------A-RD----LR-IVAVSSPGVGDGKTTTAINLAGALA-QASE
A0A1V8PLV6      ------------------------------MIVISSVEPSEGKTTVSVNVAAALA-ENG-
A0A4R0U4F1      -------------------D-EP----LSNVIVVTSAGPSEGKTTLSVNLATAFA-ENG-
A0A357ZCV8      ---------------------DK----PIKSIAITSSVPNEGKSTIALSLAQAIA-TSG-
A0A4R1CW45      ---------------------EE----KIRLVGVTSASPAAGKSFLAVNLAASLS-RVLK
A0A4R5Z7B0      ---------------------DK----ELKVLMVTSSGPGEGKSTTAANLAVVFA-QLG-
A0A419GS64      ---------------------DS----EIGSVVVTSPDRGEGKSTICANLAIVMA-QAE-
A0A2V2CXY5      ---------------------GD----EVKTIMVTSSLPNEGKSFLVMQLWRMMA-EVG-
A0A2S8MDM2      ---------------------DS----PPRVLVVTSSVPSEGKSTTAINLALALA-EAD-
A0A357ZDL3      ---------------------DN----PVKTIAITSSVPNEGKSTIALNLAQAIA-GSG-
A0A4Y8ZIU8      ---------------------DD----PPRTIAFTSANPGEGKSTVIGSLAVAVA-ASG-
A0A0F0KYJ9      ---------------------DN----PPRIIVVTSPLPGDGKSTISSNLAVTLA-SSG-
A0A538BBM6      ---------------------GL----ENPIVIVTSPNAGEGKTSTCVPLAQSLA-QAG-
A0A1I6GVG4      ---------------------DN----PPRIIVVTSPLPGDGKSTISSNLAVTLA-SSG-
A0A1I6IST1      ---------------------DN----PPRIIVVTSPLPGDGKSTISSNLAVTLA-SSG-
A0A412JBM5      -------------------GDGD----PCTTFLVTSGSPSEGKSLTAANTAISFA-MLG-
A0A510HHA8      ---------------------DA----PPRVISLTSPGPTEGKSTVCANLGVVLA-QAN-
A0A6G8Q9J3      ---------------------DA----PPKVILLTSPGSREGKSTICANLGVALA-QAD-
A0A1C2B334      ---------------------DP----ASRRILVTSASVAEGKTTTAINVAASLA-EYG-
R7Y679          ---------------------DN----SVRKILISSPSQSEGKTTTSLNLAASLA-ELG-
A0A5Q2F9A3      ---------------------GQ----GGNSFVITSSVPDEGKTSTAINTALVLA-DAG-
A0A4R1BMZ2      ---------------------DD----PLKVVTFTSPGPGEGKSTTCANLGVVLA-QAN-
A0A023X491      ---------------------DE----PPHVVAVTSPGQQEGKSTTCANLAVTLA-QAE-
A0A6G8QDQ0      ---------------------DN----PPKVVVVTSPGPKEGKSTTCANLGVVLA-QAD-
A0A0K8Q3D9      --------------------------------MVTSSMQAEGKSTVTANLAVTMA-AAG-
A0A2R7RCA1      ---------------------DQ----PPRIIVVTSSVQAEGKSTVTANLAVTLA-AAG-
A0A1Q7WJN6      ---------------------GT----GPLLVSITSPGRSDGKSFVASNLALAFA-SVG-
A0A6D1QMN1      ---------------------DR----KLKTIMVTSSNPGEGKSTTVANLAVVMA-QQH-
A0A1E2SNF6      -------------------------------------MPSEGKSTLSANLAVTIA-RGG-
Q6ADE8          -------------------------------------MPSEGKSTLSANLAVTIA-RGG-
A0A1Q7CZ24      ---------------------GA----NLQVVAVTSPGVGDGKTTTAINLAGSLA-QAAD
A0A2W6VLC6      ----------------------------PTTFVITSSVPGEGKTSSGINIARALA-DVG-
A0A519G798      ---------------------DS----RPRALVITSAVPSEGKTSTATNLAIALA-QTG-
A0A519GXS6      ---------------------------------------GEGKTTTAVNLALAYV-ESG-
A0A520EHH5      -------------------D-NP----PR-ILLVTSCIAGEGKSTTAVNLALSLA-ESG-
                                                         **:                

A0A538BYZ4      ARVLLVDLDLRRGSVREHL---G--------------L--GGRQ-SPGLVDAIL--KPA-
A0A348NU28      NNVLIIDADLRRPRVADYF---G--------------L--EGSV-G---LTTVL--LGD-
A0A4Q5APW3      AKVLLIDADLRHPSVANKL---D--------------I--DGSA-G---LTHVL--SGQ-
A0A4Q5B0V3      AKVLLIDADLRHPSVANKL---D--------------I--DGSA-G---LTHVL--SGQ-
A0A222TG79      YKVVVVDADLRRPMVAVRL---G--------------V--NPDI-G---FTDFL--SGR-
A0A6I3DFP2      DKVVLIDADLRRPTIHERL---S--------------V--PRTP-G---LTSVL--LGS-
A0A1Q2CRV2      EKVLLIDADLRRPRVAAQL---Q--------------L--EGAV-G---LTTVL--IGD-
A0A2S5WZJ5      TPTILIDADLRRPTVATVL---G--------------I--DGKI-G---LSEVL--SGQ-
K6WHS4          HSVLLVDADLRNPSVAGRV---N--------------L--TGSV-G---LTTIL--STG-
A0A1L2ZMQ6      QKVIVVDGDLRRPVVSEMF---S--------------L--PGDA-G---LTDVL--AGQ-
A0A3L8NYD3      QKTILLDGDLRRPMVSTIF---E--------------L--DPVV-G---LTQVL--AGD-
A0A1M6K628      EPTVLIDADLRRPRVAQLF---G--------------I--DGAV-G---LTQVV--AGS-
A0A561E8R3      QPVVLIDADLRKPMVATIF---N--------------L--EGSI-G---LTQAL--AGD-
A0A3E2DN22      EKVVLIDADMRRPVQHKAF---G--------------A--EAGV-G---LSQVL--AGD-
A0A3Q9ULZ9      QATVLVDADMRRPMQHTAF---G--------------I--DSRV-G---LSQVL--AGD-
A0A3S9JFL2      QATVLVDADMRRPMQHTAF---S--------------I--DSHV-G---LSQVL--AGD-
A0A1Q2CI19      KQVLVIDADLRSPDVHEKL---D--------------V--PQGA-G---VSDLL--VDG-
A0A512T3M3      KSVLVLDADLRSPDTHNVF---D--------------V--PQGA-G---ISDYL--TDP-
W6JTW4          RRVLVLDADLRSPDAHNLF---D--------------V--PQGA-G---ISDYL--VDS-
A0A0A0JTY0      QRVLVLDADLRSPDVHNVF---D--------------V--PQGA-G---ISDYL--SDV-
A0A0A0JXF2      QKVLVVDADLRSPDVHNVF---D--------------V--PQGA-G---ISDYL--SD--
E6S8H2          QRILVLDGDLRSPDTHNIF---D--------------V--PQGA-G---ISDYL--TGP-
A0A0A0JGH0      QRVLVLDADLRSPNTHTLF---D--------------V--PQGA-G---ISDYI--SDN-
N0E4U7          QRVLVLDADLRSPDTHSLF---D--------------V--PQGA-G---ISDFI--TDP-
A0A0A0IYK2      QRVLVLDADLRSPDAHNVF---D--------------V--PQGA-G---ISDFL--SDP-
A0A0Q9L0H3      QTVLVLDADLRSPDIHTAF---D--------------V--PQGA-G---ISDYL--SDP-
A3TMK0          QQVLVLDADLRSPDAHNAF---D--------------V--PQGA-G---ISDYL--TDP-
A0A543PXP1      LRVLVLDADLRSPDTHDLF---D--------------V--PQGA-G---LSDYL--SRP-
A3TMH6          QRVLVLDADLRSPDTHTLF---D--------------V--PQGA-G---ISDYL--SRH-
A0A1H6WL79      RDVIVVDADLRRPTVHQVF---D--------------V--LPDV-G---VTDIL--SGR-
A0A101LAM5      RDVIVVDADLRRPTVHQVF---G--------------V--LPDV-G---VTDVL--SGR-
A0A4Y3NEG0      RDVIVVDADLRRPTVHQVF---G--------------V--LPDV-G---VTDIL--SAR-
A0A1H6YPK1      RDVVLVDADLRRPTLAKAL---G--------------V--SPEA-G---LTSVL--ASQ-
A0A2R7MGI0      QSVILIDADLRRPVMGGVF---G--------------F--SDDV-G---LSDVL--AAR-
A0A2T7WQY4      QSVILIDADLRRPVMGGVF---G--------------F--SDDV-G---LSDVL--ASR-
A0A1G6GTN3      QSVVLIDADLRRPVLGGMF---G--------------F--SDDV-G---LSDVL--AGR-
A0A1N7DLV3      QSVILIDADLRRPVLGATF---G--------------F--SDDV-G---LSDVL--AGR-
A0A1V2NSB5      QSVILIDADLRRPVLGATF---G--------------F--SDDV-G---LSDVL--AGR-
A0A0Q5Q5L3      QSVILVDADLRRPVLGGMF---G--------------F--SDDV-G---LSDVL--AGR-
A0A0Q6DVM4      QSVILVDADLRRPVLGGMF---G--------------F--SDDV-G---LSDVL--AGR-
A0A1R3WWR6      QAVVLIDADLRRPVLGGVF---G--------------F--SDDV-G---LSDVL--AGR-
A0A5Q2FA83      ANVVLVDGDLRNPSVAKAM---G--------------L--EGNV-G---LTTVL--LGR-
A0A542FTE6      RPVIVVDCDLRKPMIATIY---E--------------K--EGAV-G---LTDVL--AGR-
A0A2S5UYV0      TPTILIDADLRRPTVASVL---G--------------I--DGSV-G---LSEVL--SGQ-
A0A2S5X9U6      TPTILIDADLRRPTVATVL---G--------------I--DGKI-G---LSEVL--SGQ-
A0A2S5ULV5      TPTILIDADLRRPTVATVL---G--------------I--DGKI-G---LSEVL--SGQ-
A0A653YMF0      TPTILIDADLRRPTVATVL---G--------------I--DGKI-G---LSEVL--SGQ-
A0A4V1VGV9      QSVVLVDTDLRRPTVHETF---D--------------L--ENLV-G---LTEVL--TGQ-
A0A3Q9IY80      SKVVLIDGDLRRPMVATIF---R--------------L--VDGV-G---VTDVL--AGR-
A0A0F0LP73      QRTLVIDGDLRRPTVAEGF---D--------------L--DGTV-G---LSEVL--SGQ-
A0A1F1X071      QPTLLVDADLRRPMIAQQF---S--------------V--DGEV-G---LSQLL--AAS-
A0A3R8RWC7      QPTLLVDADLRRPMIAQQF---S--------------V--DGEV-G---LSQLL--AAS-
A0A4U0RJZ4      QHVVLVDTDLRRPVIHETF---D--------------V--DNAV-G---LTEVL--TGQ-
A0A4R1FGL9      QHVVLVDTDLRRPVIHETF---D--------------V--DNAV-G---LTEVL--TGQ-
E3B8H1          QHVVLVDTDLRRPVIHETF---D--------------V--DNAV-G---LTEVL--TGQ-
A0A0Q5AWK6      QRTLLIDADLRRPTVAKML---G--------------I--DGAV-G---LSEVL--SHQ-
A0A3N1NLD3      QRTLLIDADLRRPTVAKLL---G--------------I--DGAV-G---LSEVL--SHQ-
A0A3N2FVI8      QRTLLIDADLRRPTVAKLL---G--------------I--DGAV-G---LSEVL--SHQ-
A0A2S5XDQ6      QRTLLVDADLRRPSVARML---D--------------I--DGAI-G---LSEVL--SHQ-
A0A2S5XNN6      QRTLLVDADLRRPSVARML---D--------------I--DGAI-G---LSEVL--SHQ-
A0A3L7ADK2      KNVVVIDCDLRRPTLSKIF---N--------------A--VEGA-G---LTDVL--SGR-
A0A6I2XCV4      TRTLIVDCDYRKPSIGKYL-----------------------------------------
A0A5R8VLL6      DPVIVVDGDLRHPSVAKIF---D--------------V--VPGI-G---ITDVL--TGK-
A0A538JQF8      HTVLVLDSDLRAPQAHRLF---G--------------V--QVEP-G---LSDVL--SGS-
A0A0Q5JKD6      QSVVLIDADMRRPVVGGMF---G--------------F--SDDV-G---LSDVL--AGR-
A0A0Q9TBP0      LNVVLIDADFRRASVAPRF---G--------------L--GDPP-G---LSDLL--VSE-
A0A346XTB0      RRVVLVDADIRARGLTRVL---G--------------A--DDRV-G---LSDLA--AMD-
A0A0G3V3M7      ISVLLIDGDFRRPQMYKYF---S--------------G--ATTP-N---LTDIPHQGTA-
A0A6I3DD56      MSVLLIDGDFRRPQMHKYF---S--------------G--ATSP-N---LTDIPYQGTA-
A0A2W6DK08      KRVLVLDCDFRGPDAHQYL---G--------------V--SPGT-G---LSNLLRSTTT-
A0A2S0LQ32      QRTILVDTDLRKPVVHRIF---D--------------I--DGSV-G---LTQVL--AGD-
A0A2N6V1R5      QRTVLIDTDLRKPVVHKIF---G--------------L--DGSV-G---LTQIL--AGD-
G9PHS6          QRTVLIDTDLRKPVVHKIF---G--------------L--DGSV-G---LTQIL--AGD-
U1PLM7          QRTVLIDTDLRKPVVHKIF---G--------------L--DGSV-G---LTQIL--AGD-
A0A6I1G2U1      KSVLVLDADLRSPNLHPMF---D--------------V--PQGA-G---ISDFLYDPAS-
A0A351ETF8      MNVLLVDGDMRRPRVHRML---G--------------V--SNSV-G---LSDVL--AGE-
A0A349B7N2      SRVLIVDGDFRRPAVHEFLPEAD--------------V--GRGN-G---LAPVD--AP--
A0A346Y185      RDVVLVDADTRVRGLTRRL---G--------------A--KDTG-G---LPALA--DPR-
A0A259S8H9      QRTLVIDGDLRRPTIAKGF---E--------------I--DEAI-G---LSEVL--SGQ-
A0A0Q5L115      QRVVVIDCDLRRPTLSKVL---G--------------V--SEGA-G---LTDVL--SGR-
A0A2W1Z497      GRVVLIDCDLRRPVLSAVF---G--------------V--ARGA-G---LTDVL--SGR-
A0A1H4I042      NNVLLVDGDMRRSIAHKHL---N--------------V--DGAV-G---LSTVL--SGA-
A0A4R7A6D9      NNVLLVDGDMRRSIAHKHL---N--------------V--DGAV-G---LSTVL--SGA-
A0A4Q4D4T1      QNVVLVDGDLRRPRLHEVF---G--------------A--EQNV-G---LTSVL--VGK-
A0A261FE22      ESVLLIDADVRHPSVAKAL---G--------------I--SNGV-G---LMQML--TNQ-
A0A5C8C085      APVILVDGDLRRPTVASSF---G--------------L--VEGV-G---LTDVL--VGR-
A0A1E4BP96      QRVVLIDGDLRQPVVASLF---D--------------L--PEGA-G---LTDIL--AGR-
A0A101KZQ4      QKVVLIDGDLRRPTIAKTF---G--------------L--LEGV-G---LTDVL--IGN-
A0A439DNZ6      HNVVLVDGDLRRPRLDKYL---G--------------L--VGSV-G---LSTVL--AGR-
A0A0J6YE86      HNVVLVDGDMRRPTLSKYL---D--------------L--MSKV-G---FSTVL--SGA-
A0A5Q5BFU2      HNVVLVDGDMRRPMLHKYL---G--------------L--VGPV-G---FSTVL--SGG-
A0A151BT98      YRTVLVDGDLRKPGVGSAI---G--------------I--DGSV-G---LTNVL--VHE-
A0A2Y8ZRF8      HRTLLVDGDLRKPGVASAV---G--------------I--DGSV-G---LTNVL--VHE-
A0A2R9UAT1      QQVVLIDGDLRRPMIAAIF---G--------------L--VEGA-G---VTDIL--AGR-
A0A4Q5J5D7      EPVILIDGDLRRPTVAEKF---G--------------L--VEGA-G---LTDVL--IGR-
A0A1Y4CKD6      SRVLLVDMDLRSQGDGALL---G--------------C--GASH-G---PAEVL--EDSG
A0A0Q7KBQ4      RSVLLIDADMRNPNVADLL---G--------------L--ENSV-G---LMTVL--IGR-
A0A1F1IHY9      QRVVLVDGDLRRPVVAENF---G--------------L--ISTV-G---LTDVV--LGR-
A0A542HCT5      RRVILIDGDLRRPVIADSF---G--------------L--IEGL-G---LTDVL--IGT-
A0A2S8WHZ8      RNVVLIDADLRRPVQTELF---D--------------M--MDGA-G---LTDVL--SHS-
A0A537WNY9      TSTLLVDGDLRRGRISEMM---N--------------I--TRSP-G---LTEVL--IGD-
A0A5B8M469      QPTLIIDADLRRPSVARQF---D--------------M--DGTI-G---LSEVL--SGQ-
A0A1Y4CTD2      RRVLLIDGDFRKPAQRRIF---DEQNLERPSFSDYVLE--DGVA-G---VGPVL--NGR-
A0A0Q5M6Z7      SNVVVIDCDLRRPMQSTLF---S--------------L--RSGV-G---LTDVL--SGR-
A0A3N3ZPU0      QPTVLVDADLRRPVQTELF---G--------------L--TEGA-G---LTDVL--AGA-
A0A359IQX7      QITLLVDADLRRPSQHRTF---D--------------L--DGSV-G---LTQVL--AGD-
A0A4R8TXC3      QAVILIDADLRRPTLAKKL---N--------------V--DAKV-G---LTQVL--AGQ-
A0A433EDP2      QAVILIDADLRRPTLAKKL---N--------------V--DAKV-G---LTQVL--AGQ-
A0A231VTW0      QAVILIDADLRRPTLAKKL---N--------------V--DAKV-G---LTQVL--AGQ-
A0A433ECD0      QAVILIDADLRRPTLAKKL---N--------------V--DAKV-G---LTQVL--AGQ-
U7V3Z1          QAVILIDADLRRPTLAKKL---N--------------V--DAKV-G---LTQVL--AGQ-
A0A1F1J417      QPVILIDADLRRPTVAKKL---H--------------I--NAKI-G---LTQVL--AGQ-
A0A2A8D6P2      QPVILIDADLRRPTVAKKL---H--------------I--NAKI-G---LTQVL--AGQ-
A0A1F0THV9      QPVILIDADLRRPTVAKKL---H--------------I--NAKI-G---LTQVL--AGQ-
A0A5F0M6Y0      QPVILIDADLRRPTVAKKL---H--------------I--NAKI-G---LTQVL--AGQ-
D8USQ4          QPVILIDADLRRPTVAKKL---H--------------I--NAKI-G---LTQVL--AGQ-
E3H5W1          QPVILIDADLRRPTVAKKL---H--------------I--NAKI-G---LTQVL--AGQ-
A0A1F1QKB0      QPVILIDADLRRPTVAKKL---H--------------I--NAKI-G---LTQVL--AGQ-
A0A509JY23      QPVILIDADLRRPTVAKKL---H--------------I--NAKI-G---LTQVL--AGQ-
A0A448USF4      QPVILIDADLRRPTVAKKL---H--------------I--NAKI-G---LTQVL--AGQ-
A0A0Q9LZR0      RRVVLIDGDLRRPVVAESF---G--------------L--IEGL-G---LTDVL--IGS-
A0A1N7E3F1      WRVVLVDADLRRPSVPRYL---G--------------I--EGGT-G---LTDVL--IER-
A0A544ZKQ1      WRVVLVDADLRRPSVPRYL---G--------------I--EGGT-G---LTDVL--IER-
A0A372P1T1      WRVVLVDADLRRPSVPRYL---G--------------I--EGGT-G---LTDVL--IER-
A0A5D0Q2X0      WRVVLVDADLRRPSVPRYL---G--------------I--EGGT-G---LTDVL--IER-
A0A5R8Z2E7      WRVVLVDADLRRPSVPRYL---G--------------I--EGGT-G---LTDVL--IER-
A0A1L2ZMV4      SKVILIDADLRRSVQTDIF---Q--------------L--QSGA-G---LTDLL--SGA-
A0A6I3F378      ALVLIVDGDLRRPRIHTMF---G--------------L--SGEA-G---LVDAL--VGR-
A0A1S1CAD0      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
G5ET14          SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1E9DXX2      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1E8S156      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1E8S5S2      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1S1DFA8      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A2I1Z490      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1F0DAA9      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1F0PHK9      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1F0VZG6      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1E9G8X4      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1E9IAW2      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1E9ZBC9      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1E9ZDP4      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1F0R6B5      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1F0Z7N5      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1F1D897      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
D2NP38          SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1F1FV74      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1E9M791      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A291DEI8      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1S1D5T1      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1E8TRD6      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1F0XT88      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1F1EVP5      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
C6R548          SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A0K2RXS2      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A1F0KX60      SPVILIDADLRRPTVAKKL---K--------------L--DAKV-G---LTQVL--AGQ-
A0A542I3V2      EPVVVVDGDLRRPRIAGAF---N--------------L--VPGV-G---VTNVL--SGQ-
A0A2T0UZ65      RPVVIIDADLRRPNIANIL---E--------------V--SSTV-G---LSEVL--SGQ-
A0A1R4JTI6      VPTVLVDADLRRPTVAGSF---H--------------V--EGSV-G---LTNAV--VGN-
A0A4R7TM52      QRVVLVDGDLRRPMVASVF---G--------------L--VEGV-G---LTDVL--AGR-
A0A542XE74      QPVVLIDCDLRRPTQGDQF---N--------------V--DSGV-G---VTQVL--AGD-
A0A0G3V3F3      DKVVLIDADLRRPTIHEQL---S--------------V--PRTP-G---LTSVL--LGS-
A0A0Q7QDF6      QNVVLVDGDLRRPRLHEVF---G--------------A--EQNV-G---LTSVL--VGK-
A0A3S0V9U6      QPTVLIDADLRRPTIAKIF---G--------------I--DSGV-G---LSQVL--SGQ-
A0A5R8L819      QPVVLVDADLRRPMLANIF---G--------------I--VADV-G---LTDVL--ARR-
A0A261FQA1      RTVLLIDTDLRKPSMAGVL---G--------------I--NGKV-G---LAHVL--ARQ-
A0A1Q2CJ92      EPTVLIDADLRRPVQAERL---G--------------L--DGAV-G---LSQVL--AGT-
A0A2T0S3C8      QRVLLIDADLRRPRIADYL---G--------------L--EGAV-G---LTTVL--AGR-
A0A4Y8WZJ3      QRVVLVDGDLRRPVVAENF---G--------------L--ISTV-G---LTDVV--LGR-
A0A285VUW0      RRVLVLDADLRHPSVASEL---G--------------L--EGAV-G---LTSVL--AGD-
A0A2R7Z032      EKVVLIDADLRRPMLATTF---D--------------I--DGEV-G---LTQVL--AGD-
A0A1I0W453      TPVLLIDADLRRPMIATTF---E--------------V--DGAV-G---LTQAL--AGD-
A0A1H4LCS9      TPVLLIDADLRRPQIASTF---E--------------I--DGAV-G---LTQAL--AGD-
A0A4Q2RZP8      TPVLLIDADLRRPMIASTF---E--------------I--DGAV-G---LTQAL--AGD-
A0A0Q6VV12      TPVLLIDADLRRPQIATTF---E--------------I--DGTV-G---LTQAL--AGD-
A0A495NTA9      TPVLLIDADLRRPMIASTF---E--------------I--DGAV-G---LTQAL--AGD-
A0A0Q9QB08      TPVLLIDADLRRPMIATTF---E--------------I--DGAV-G---LTQAL--AGD-
A0A4Q2SA86      TPVLLIDADLRRPMLATTF---D--------------I--DGAV-G---LTQAL--AGD-
A0A4Z1C3Z0      TPVLLIDADLRRPMLATTF---E--------------V--DGAV-G---LTQAL--AGD-
A0A4Q2JUT1      STVVLVDGDLRRSMVAKTM---G--------------L--PSGA-G---LSDVL--AGR-
A0A542J310      TTVVLVDGDLRRSMVAKTM---G--------------L--PGGA-G---LSDVL--AGR-
A0A444BL03      QRVVIVDADLRRPTLAKVF---E--------------A--PGSI-G---LSHVL--TDQ-
A0A4Y8X357      QPVILIDADLRRPRQAGQF---G--------------V--DGRV-G---LSEVL--SGD-
R4LD52          QRVLIVDADLRRPRIAEYL---G--------------L--EGAA-G---LTTVL--AGK-
A0A4T2CD79      QKVVVVDGDLRKPMVASTF---N--------------V--VGGV-G---VTDLL--IGS-
A0A2N3YJR1      QSVVIVDADLRRPTLAKVF---D--------------R--ENTI-G---LSHVL--TDQ-
A0A6G8FYB9      QSVVIIDADLRRPTLAKVF---D--------------V--VGTV-G---LSHVL--TGQ-
A0A4Q4D742      RSVLLIDADMRNPNVAELL---G--------------L--ENSV-G---LLSVL--VGR-
A0A4Q2RU39      TKVLLIDADLRRPMIATTF---E--------------I--DGAV-G---LTQAL--AGD-
A0A4Q2SK58      TPVLLIDADLRRPMIATTF---E--------------I--DGAV-G---LTQAL--AGD-
A0A1C6T1J1      WRVLLVDADLRRPKVADYL---G--------------L--DGGV-G---LTDVL--VGD-
A0A2W2CFC8      WRVLLVDADLRRSKVGDYL---G--------------I--DSAV-G---LTDVL--VGD-
A0A2W2A4B0      LRTVVIDADLRRPNLANVF---G--------------I--EGSA-G---LSDIL--VGR-
A0A4Y9MDA5      ARVLLVDADLRRPAIAERL---G--------------L--EGAA-G---LTTVL--LGR-
A0A1H7N9P7      TRVLLVDADLRRPTIADRL---G--------------L--EAAA-G---LTTAL--LGR-
A0A1M7V0F8      ARVLLVDADLRRPAIADRL---G--------------L--EAAA-G---LTTVL--LGR-
A0A022KX11      RRTLLVDADLRNPSVAKTL---G--------------M--EGSV-G---LTTLL--LGD-
A0A4Q5A868      AKVLLIDADLRHPSVANKL---D--------------I--DGSA-G---LTHVL--SGQ-
A0A345NSU7      TKVLLIDADLRHPSVGTTL---G--------------L--EGGV-G---LTTVL--LGD-
A0A0W8I9Y2      RNVVVVDGDLRRPVITDLF---G--------------L--VPGV-G---VTDVL--TGQ-
A0A4Y5YMQ6      NRVLLVDADLRRPNVANVL---G--------------L--ENAV-G---LASVL--VDA-
A0A255G8R8      NRTLLIDADMRRPTVADNF---G--------------L--VGTA-G---LSTIL--AGQ-
A0A6G7Y423      ESVLLVDADLRAPQVAQRM---G--------------L--DGAL-G---LSHIL--TGR-
A0A2N4T4Q5      RDVVVVDGDLRRPVMTELF---G--------------L--VPGV-G---ITDVL--VGE-
A0A1M3LEY6      ARVLLIDGDLRSPSVADLF---G--------------I--EGGV-G---LTDVL--IGR-
A0A538AJI7      MRVLLIDGDLRRPGFARIM---R--------------V--NPHP-G---LAEVL--RGE-
A0A538AM15      ARVLLVDADLRRPSVARLL---A--------------I--GGSD-GPGLVNAIL--DPR-
A0A1V8PLV6      AKVLLIDADLRHPSVADHI---G--------------L--EGGA-G---LTHVL--SDQ-
A0A4R0U4F1      SKVLLIDADVRNPSVSKAL---G--------------I--EGAV-G---LTHLI--TNR-
A0A357ZCV8      QTVLVVDTDMRRRSLAHYM---R--------------L--KPSV-G---SYAVL--TGL-
A0A4R1CW45      VPTFLVDLDLRRGCVAEEL---G--------------I--EFEA-G---VSDYL--LGE-
A0A4R5Z7B0      KKVLLVDADLRKPTVHRSF---G--------------V--NNLF-G---FTTVL--TKQ-
A0A419GS64      KRVLLIDCDLRLPTQHELF---Q--------------I--TLDH-G---LTRMI--STY-
A0A2V2CXY5      TPTLLIDCDYRNSEMRTKY---G--------------IGSTEKIIG---GAHYL--AGK-
A0A2S8MDM2      HKVLLVDGDMRRPSLHQYL---D--------------L--LQPV-G---FSTVL--SGR-
A0A357ZDL3      KTVLLVDTDLRRRSLAMYL---N--------------L--RAPS-G---LYAVL--AKQ-
A0A4Y8ZIU8      QPVILIDADLRRPRQALQF---G--------------V--DGRV-G---LSEVL--NGD-
A0A0F0KYJ9      QPVVLIDGDLRRPMIGTVF---G--------------L--PKGA-G---ISDVL--AGC-
A0A538BBM6      SRVVLVDLDLRHPDAHRLL---D--------------R--PNSV-G---VVDVL--RGN-
A0A1I6GVG4      QPVVLIDGDLRRPMVDTVF---G--------------L--PKGA-G---ISDVL--AGR-
A0A1I6IST1      QPVVLIDGDLRRPMVDTVF---G--------------L--PKGA-G---ISDVL--AGR-
A0A412JBM5      KKTLLVDADVRKPSQQRLW---A--------------G--RNTSTG---LCKYL--VGL-
A0A510HHA8      KSTLLIDGDLRRPSLHAIF---S--------------L--RNIN-G---LVNAI--TGE-
A0A6G8Q9J3      RATLVIDCDLRGPTLHGIF---G--------------L--RDSP-N---LLDVL--ARE-
A0A1C2B334      HRVVLVDADLRRPTVAKRL------------------S--LNNSIG---LTDFL--IGQ-
R7Y679          KSVVLVDADLRRPAVASRL---Q--------------A--VSPDIG---LTDYL--RGS-
A0A5Q2F9A3      LRVLLIDADMRRPRVGQSL---R--------------L--EDAA-G---LSTIL--IGR-
A0A4R1BMZ2      KNTLILDCDFRRPVMHRFF---G--------------L--RNVW-G---VVDVL--VGK-
A0A023X491      KSVLLLDCDLRKPVVHSIF---E--------------L--RNTR-G---VVDAL--VGS-
A0A6G8QDQ0      KSTLIIDCDFRRPAMHQVF---G--------------L--RNFK-G---VVNVL--ANE-
A0A0K8Q3D9      ENVVVVDGDLRRPTLTDVF---N--------------L--VPGA-G---VTDVL--SGT-
A0A2R7RCA1      ENVVVVDGDLRRPTLVDVF---N--------------L--VPGV-G---VTDVL--TGT-
A0A1Q7WJN6      YRTLLIDGDVRRGGLHRIL---T--------------V--SRKP-G---LTDVL--AGD-
A0A6D1QMN1      NRVLLVDTDLRKPTVHFTF---Q--------------V--PNHV-G---LSNVV--TGQ-
A0A1E2SNF6      QPVVVVDADMRHPTQGKTF---G--------------I--PNGA-G---LSDVL--AGR-
Q6ADE8          QPVVVVDADMRHPTQGKTF---G--------------I--PNGA-G---LSDVL--AGR-
A0A1Q7CZ24      ARVLLVDMDLRRPAVAGQL---G--------------L--SGGKRG---LAEAL--LAD-
A0A2W6VLC6      THTLLVDADLRRPKTDVYL---G--------------I--EGGL-G---LTDVL--IGR-
A0A519G798      LRVLLVDGDLRRPKVASVL---G--------------L--ERSV-G---LTTVL--VGR-
A0A519GXS6      QRVVLVDADLRRPAVANLL---G--------------L--ENAV-G---LTSVL--VES-
A0A520EHH5      NRVVLVDADLRRPHIADYL---G--------------I--VGSV-G---VSSVL--AHD-
                   .::* * *                                                 

A0A538BYZ4      L---ALEDVTQLCPSFN-LS--V--VLAGRSPATHYELLKSPRLGELLGEARHRY--DYV
A0A348NU28      V---SIEDARMTRPGST-LD--V--LPSGSIPPNPAEMLTSDAMKRLLEEATARY--DYV
A0A4Q5APW3      A---SVKDVVQRYWKPN-LH--V--MPAGPKPPNASALLNSPIMVELLNNAIERY--DYV
A0A4Q5B0V3      A---SVKDVVQRYWKPN-LH--V--MPAGPKPPNASALLNSPIMVELLNNAIERY--DYV
A0A222TG79      A---ALEDVLQSTSFSG-----VDALAGGQIPPNPAELLTSQKASEGINSLSSLY--DYV
A0A6I3DFP2      ----DLSEALRKVAESPFLR--V--LSSGPPVEDPSAILGARAFRVVLDTLRAVR---LV
A0A1Q2CRV2      A---RLGDVVQPYGRTP-LD--V--LTAGRVPPNPAELLGHTRMRALLEDASKLY--DTV
A0A2S5WZJ5      V---SLEDALVASKIPG-LY--V--LPSGRIPPNPSEMLGSAAMKSIISLLSTDY---IV
K6WHS4          A---TLTDCIQHSSVAG-LD--V--LPSGPIAPNPAELLGSRKASDVFGSLRDSF--EYV
A0A1L2ZMQ6      A---ELDDVLQDFEPVPNLQ--V--LAAGRIPPNPSELLASKTMGKLLEDLSER---AFV
A0A3L8NYD3      I---DLRATIQDPGLPN-----LDVIAAGRIPPNPSELLGSQRMQSVIEELVAAD--YMV
A0A1M6K628      L---TVADALVSTSQPN-----LSVLPAGRIPPNPSEIVGSKRMADLIAHL-SET--HLV
A0A561E8R3      I---TLHDVMQPTTTPD-----LVVIPAGRIPPNPSELVGSRRMETAITEL-SKD--HLV
A0A3E2DN22      V---TLDDALMRTETKR-LQ--M--LAAGRIPPNPSELLGSQRMKDLLTELRKRG--YFV
A0A3Q9ULZ9      V---SLSDALTPTDVPG-LR--V--LVAGRIPPNPSELLGSVRMHNLISRLTKAG--YFV
A0A3S9JFL2      V---SLEDALNPTDVPG-MR--V--LVAGRIPPNPSELLGSVRMHNLIARLTKAG--YFV
A0A1Q2CI19      QG--SLNSVIRPTNIPG-VR--V--VTAGTRLAHPTAL--ASRMGPLVASARKRA--DVV
A0A512T3M3      DFG-PLSNLVRPTNLPG-VK--I--ITAGTQLEHPTSL--ASRMVALQEGTRQLA--DVV
W6JTW4          ALE-HLQQLVRPTNMPG-VS--I--IVAGTQLDHPTSL--ASRMGPLLEEARGLA--DVV
A0A0A0JTY0      SGDASLASLMRPTSVPG-VR--I--MSAGSSLAHPAAL--ASRMSHLLDEARGMA--DVV
A0A0A0JXF2      PGGTSLETVVRPTSVPG-VR--I--ITAGTVLTHPASL--ASRMGGLLEEAREMA--DVV
E6S8H2          DDT-PLGSLIRPTNVPG-VR--I--ITAGTRLEHPASL--ASRMGGLLTEARGLA--DVV
A0A0A0JGH0      EDT-PLEALIRPTNVPA-VR--I--ITAGTRLTHPASL--ASRMGHLLAEVRELA--DVV
N0E4U7          GDV-PLEALVRPTSVPG-VR--I--ITAGTRLTHPASL--ASRMGHLLEEVRGMA--DVV
A0A0A0IYK2      SDDASLGSVVRPTSVPG-VR--I--ITAGTSLAHPASL--ASRLGSLLEEVRGMA--DVV
A0A0Q9L0H3      SDGAALDAVVRPTSVPN-VR--I--ITAGTSLAHPAAL--ASRMGQMLEQARDLA--DVI
A3TMK0          GEG-SLSAVVRPTSVPG-VR--I--ITAGTSLAHPASL--ASRMGHLLEEARDMA--DVV
A0A543PXP1      EDA-SLEALIRPTSIPD-VR--I--ITAGTRLSHPASL--ASRMGGLLSETRGLA--DIV
A3TMH6          NES-SLEALIRPTSIDG-VR--I--MTAGTRLSHPASL--ASLMGGLIAELRDLA--DVV
A0A1H6WL79      A---SIDDVLQEWGPNPRLR--I--LTAGRIPPNPSELLGSRAMEHLLKDLAQR---AIV
A0A101LAM5      A---SIDDVLQEWGPNPHLR--I--LTAGRIPPNPSELLGSRAMEHLLRDLSQR---AMV
A0A4Y3NEG0      A---SIDEVLQEWGPNPHLR--I--LTAGRIPPNPSELLGSRAMEHLLNELSQR---AMV
A0A1H6YPK1      A---SIEEVTQQVGDSGRFS--V--VTAGVIPPNPSELVGSDTMRSLLYSFPED---TMV
A0A2R7MGI0      A---QIEQVAHQVDEEGRLF--V--VAAGRTPPNPTEMVGSQRLQSLARKLAEE---MVV
A0A2T7WQY4      A---QIEQVAHQVDDHGRLF--V--VAAGRTPPNPTEMVGSQRMQALARKLAED---MVV
A0A1G6GTN3      A---QIEQVARQVDQNGRLF--V--VAAGRTPPNPSEMVGSQRMQALARKLADD---MVV
A0A1N7DLV3      A---RIEQVAHQVDENGRLF--V--VAAGRTPPNPSEMVGSQRMQQLARTLADD---MVV
A0A1V2NSB5      A---RIEQVAHQVDEHGRLF--V--VAAGRTPPNPSEMVGSQRMQQLARTLADD---MVV
A0A0Q5Q5L3      A---QIEQVAHQVDEHGRLF--V--VAAGRTPPNPSEMVGSKRMQALSRKLAED---LVV
A0A0Q6DVM4      A---QIEQVAHQVDEHGRLF--V--VAAGRTPPNPSEMVGSKRMQALSRKLAED---LVV
A0A1R3WWR6      A---QIEQVAHQVDENGRLF--V--VAAGRTPPNPSEMVGSQRMQALTRKLAEE---LVV
A0A5Q2FA83      A---TVAEAAQKWGDSS-LH--V--LPSGAIPPNPSELLGSTAMETLFAELLQAY--DYV
A0A542FTE6      A---TPADVAQRVPGNLDLT--V--FTSGPTPPNPSELLGSNAMREFLDSLRRTG--AFV
A0A2S5UYV0      V---SLEDALTATKTPG-LY--A--LPSGRIPPNPSEMLGSEAMRSIIRLLSQD---YIV
A0A2S5X9U6      V---SLEDALVGSKIPG-LY--V--LPSGRIPPNPSEMLGSEAMKSIVSLLSKD---YIV
A0A2S5ULV5      V---SLEDALVGSKIPG-LY--V--LPSGRIPPNPSEMLGSEAMKSIVSLLSKD---YIV
A0A653YMF0      V---SLEDALVGSKIPG-LY--V--LPSGRIPPNPSEMLGSEAMKSIVSLLSKD---YIV
A0A4V1VGV9      A---PLASAIQQGDHKN-LA--V--ITSGRVPPNPSELLGSRRMSAVIEALGEE---YFV
A0A3Q9IY80      A---TVEDVAQRVGRKGNLL--V--LGAGKLPPNPSEVLGSERMKNLLRTLAKD---YTV
A0A0F0LP73      M---PIGPAIRQTSDPN-LF--V--LPAGGIPPNPSEMLGSTAFQRLLGELRRD---FFI
A0A1F1X071      V---SLEDVAEPTTVPL-LT--L--LPAGQIPPNPSELLGSRRMQELIEELSRQ---YFV
A0A3R8RWC7      V---SLEDVAEPTTVPL-LT--L--LPAGQIPPNPSELLGSRRMQELIEELSRQ---YFV
A0A4U0RJZ4      A---SLRQAIQPGDHKN-LS--I--ITSGRIPPNPSELLGSRRMSAVIDALEEE---YFV
A0A4R1FGL9      A---SLRQAIQPGDHKN-LS--I--ITSGRIPPNPSELLGSRRMSAVIDALEEE---YFV
E3B8H1          A---SLRQAIQPGDHKN-LS--I--ITSGRIPPNPSELLGSRRMSAVIDALEEE---YFV
A0A0Q5AWK6      I---PVEDAIRPTGTEG-LF--A--LPSGHIPPNPSEMLGSAAMRTLVERLSKD---YFV
A0A3N1NLD3      I---PVEDAIRPTATEG-LF--A--LPAGHIPPNPSEMLGSSAMRALIERLAED---YFV
A0A3N2FVI8      I---PVEDAIRPTATEG-LF--A--LPAGHIPPNPSEMLGSSAMRALIERLAED---YFV
A0A2S5XDQ6      I---PVDDAIRPTGTAG-LY--A--LPAGHIPPNPSEMLGSEAMRALVARLSKD---YFV
A0A2S5XNN6      I---PVDDAIRPTGTAG-LY--A--LPAGHIPPNPSEMLGSEAMRALVARLSKD---YFV
A0A3L7ADK2      A---ELQQVIQPCGDSEKLW--I--LGAGRIPPNPSELLGSRAMKELLAALGEQS---IV
A0A6I2XCV4      A---PIPDLEHPTNPQPTRVENLWFIPAPRTSASPAIVI--EELGRVIDSWRDDF--DIV
A0A5R8VLL6      A---EVDDVLQQRGDLPNLS--I--LGAGRTPPNPSELLSSHAMKQLLNSLAERG---IV
A0A538JQF8      P---DAPSLADVAQDTKVPG--VQVIAAGSRVANPGRLL--ARAADLVREARNLA--DFV
A0A0Q5JKD6      A---QIEQVAHQVDEHGRLF--V--VAAGRTPPNPSEMVGSQRMQSLARKLADDM---VV
A0A0Q9TBP0      E---DPSSYLIDIGVDNLTL-----LPAGTLPPNPAALLASGQMHLVLEELAAKA--DMI
A0A346XTB0      M---EPNEVLRRYKFSEQSQ--IPVVTAGQRRGDPAALLRTHAFRKGMERIVDSA--ELL
A0A0G3V3M7      A---DVLAVAQETGIPNIRF--IASAPTRTDPGTAIEMV-----KVAARLGRDIA--DLV
A0A6I3DD56      A---DVSAVAQETGVPNIRF--IASAPTRTDPGTAIELV-----KVAARLGREIA--DLV
A0A2W6DK08      V---DLSLHVRQSDIP---R--VDVVTAGTQLERPSTLP--ARMGNLVMQARELA--DIV
A0A2S0LQ32      V---PVSDVAQFVKGHPHLR--V--IPAGRIPPNPSELLGSQRMKALLDRLSQEA---VV
A0A2N6V1R5      M---QLSDVAQKIEGQPNLR--V--VPAGRIPPNPSELLGSQRMKALMDYLKDDA---MV
G9PHS6          M---QLSDVAQKIEGQPNLR--V--VPAGRIPPNPSELLGSQRMKALMDYLKDDA---MV
U1PLM7          M---QLSDVAQKIEGQPNLR--V--VPAGRIPPNPSELLGSQRMKALMDYLKDDA---MV
A0A6I1G2U1      T---RLEALARPTSVPGVKI-----ITAGTQLAHPASLA--TRMGTLIDEARPLA--DIV
A0A351ETF8      A---TRRDARQVFERDGIRF--DV-ITSGSKVQDPALLLRGDRWTSLADELFLYD---LV
A0A349B7N2      ----DVSGLIGRSHIPGVSA--ITHLDERLESVQPADLL--SWIRSTVQQARPTS--DVV
A0A346Y185      N---NLSEIIVPLTADEGQY--VPFIPAKSLGDDTAAFFRTPGFRQAITRLREVA--DLI
A0A259S8H9      V---PIGSAIRRTEEA-NLF--V--LPAGGIPPNPSEMLGSAAFQQLLTRLRQDF---FI
A0A0Q5L115      A---QLHQVMQQTEAASNLW--V--VGAGRIPPNPSELLGSQTFQDLVSTLAEHA---TV
A0A2W1Z497      A---DLADVMQQTDDVGNLW--I--VGSGRVPPNPSELLGSRMFRDILASLGEHA---TV
A0A1H4I042      V---SLSDALQETQFSG-LT--V--LAAGATPPNPSELLASHAAKNLLEELRGKF--DYV
A0A4R7A6D9      V---SLSDALQETQFSG-LT--V--LAAGATPPNPSELLASHAAKNLLEELRGKF--DYV
A0A4Q4D4T1      V---PLDSAVQGTDVPG-LD--V--LTSGTRPPNPSEIIQTAAMETVLIELGRRY--DIV
A0A261FE22      V---DAQTAVQQYWKPE-FQ--V--LPVEDNQGTAAVMLSSAVMENMIDQAAKHY--DHV
A0A5C8C085      A---SIDDVLQQHHELENLS--V--LAAGGIPPNPSELLGSQAMRRLLTLLSQRA---IV
A0A1E4BP96      A---TTGDVVQPVQGSQNLY--I--LASGRVPPNPSEVLGSRRMRDLVTSLTEHA---LV
A0A101KZQ4      A---DIDDVMQPWGESGNLV--V--LGAGKIPPNPSELLGSNTFQNLIQSLAQEA---IV
A0A439DNZ6      A---SLEDVLQETAFPG-VT--V--VTSGAVPPNPSELLGSLAAKKILDELRTGF--DYV
A0A0J6YE86      V---SIDDSLQKTRFPG-LS--V--LTSGAVPPNPSELLGSQSARKVLAELRSRF--DYV
A0A5Q5BFU2      A---SLSEALQNTRFPG-LT--V--LTSGAIPPNPSELLGSQSARRLLNELRAQF--DYV
A0A151BT98      V---GLKDVLVEPEPSLPLF--V--LPAGPVPPNASELLGSSAMQGLFQELVAEF--DFV
A0A2Y8ZRF8      L---ALKDVLVEPEPSLPLF--V--LPAGPVPPNASELLGSAAMRNLFQELVAEF--DFV
A0A2R9UAT1      A---EVDDVAQTFGHLDTLR--I--VAAGRTPPNPSEVLGSERMKDLLRELSREA---MV
A0A4Q5J5D7      V---DFEDVAQEHPDYPNLL--L--LAAGGVPPNPSELLGSQTMRQLLTELAKTA---LV
A0A1Y4CKD6      L---GVDDCIVLLEESG-IG--F--WGGAGPVQNPVEVLSDERLPSLFDGLRGQW--DYI
A0A0Q7KBQ4      T---SLDEATQVHDSG--IS--F--LGTGPKPPNPAEVLDTQAMRDLLHGLRSEY--DVV
A0A1F1IHY9      V---ELADALQTVGNRPSLQ--V--LASGPIPPNPSEILASDRFNDLINALAEDA---LV
A0A542HCT5      V---QFDEVAQQVGGLPNLR--V--LAAGRVPPNPSEMLGSKAMRRLLERLGETC---TV
A0A2S8WHZ8      A---DLEDVLQPYGHLPNLQ--V--LCSGRIPPNPSELLGSKAMKSLLSELALDA---VV
A0A537WNY9      S---SLDDAIRKTSNPS-LN--V--LTGGRRLADPGEML-TISFGSVLSQLAEMY--ETI
A0A5B8M469      V---PVQEAVRTVGREN-LM--V--LPAGGTPPNPSEMLGAHAFEALLRELRERF---FV
A0A1Y4CTD2      S---GVYELFQYKALRD-----------------PMAVFSGERLADVMAELSERF--DYI
A0A0Q5M6Z7      V---DLNDALQAPSDSPHLR--V--LGAGRVPPNPSELLGSRTMRELVSALADVA---IV
A0A3N3ZPU0      A---ELEDVLQDWEPGSNVH--L--LGAGRTPPNPSELLGSKTMRNLLARMGQDY---MV
A0A359IQX7      V---SIDDAIQNSELAN-LK--V--LSAGRIPPNPSELVGSQRMHNLLIALSENR---TV
A0A4R8TXC3      V---DIAEAVYQLEESN-LF--V--LTAGRIPPNPSELLGSDKMRQLVRELSEEF---VV
A0A433EDP2      V---DIAEAVYQLEESN-LF--V--LTAGRIPPNPSELLGSDKMRQLVRELSEEF---VV
A0A231VTW0      V---DIAEAVYQLEESN-LF--V--LTAGRIPPNPSELLGSDKMRQLVRELSEEF---VV
A0A433ECD0      V---DIAEAVYQLEESN-LF--V--LTAGRIPPNPSELLGSDKMRQLVRELSEEF---VV
U7V3Z1          V---DIAEAVYQLEESN-LF--V--LTAGRIPPNPSELLGSDKMRQLVRELSEEF---VV
A0A1F1J417      V---DIAEAVHQVEDSK-LF--V--LPAGRIPPNPSELLGSDKMRQLIEELSKEF---LV
A0A2A8D6P2      V---DIAEAVHQVEDSK-LF--V--LPAGRIPPNPSELLGSDKMRQLIEELSKEF---LV
A0A1F0THV9      V---DIAEAVHQVEDSK-LF--V--LPAGRIPPNPSELLGSDKMRQLIEELSKEF---LV
A0A5F0M6Y0      V---DIAEAVHQVEDSK-LF--V--LPAGRIPPNPSELLGSDKMRQLIEELSKEF---LV
D8USQ4          V---DIAEAVHQVEDSK-LF--V--LPAGRIPPNPSELLGSDKMRQLIEELSKEF---LV
E3H5W1          V---DIAEAVHQVEDSK-LF--V--LPAGRIPPNPSELLGSDKMRQLIEELSKEF---LV
A0A1F1QKB0      V---DIAEAVHQVEDSK-LF--V--LPAGRIPPNPSELLGSDKMRQLIEELSKEF---LV
A0A509JY23      V---DIAEAVHQVEDSK-LF--V--LPAGRIPPNPSELLGSDKMRQLIEELSKEF---LV
A0A448USF4      V---DIAEAVHQVEDSK-LF--V--LPAGRIPPNPSELLGSDKMRQLIEELSKEF---LV
A0A0Q9LZR0      V---EFEEVVQQVGGLPNLS--V--LAAGRVPPNPSEMLGSKAMRRLLEGLGETY---TV
A0A1N7E3F1      A---RLHEVIQTWGQPG-LS--V--LPSGRIPPNPSELLGSRVMRSVLAQLTEEY--DMV
A0A544ZKQ1      A---RLHDVIQTWGQPG-LS--V--LPSGRIPPNPSELLGSRGMRSVLAQLTEEY--DMV
A0A372P1T1      A---RLHDVIQTWGQQG-LS--V--LPSGRIPPNPSELLGSRGMRTVLAQLTEEY--DMV
A0A5D0Q2X0      A---RLHDVIQTWGQQG-LS--V--LPSGRIPPNPSELLGSRGMRTVLAQLTEEY--DMV
A0A5R8Z2E7      A---RLHDVIQTWGQQG-LS--V--LPSGRIPPNPSELLGSRGMRTVLAQLTEEY--DMV
A0A1L2ZMV4      V---DLDDVLQEWSGDPRLQ--V--LGAGRVPPNPSELLGSRAMKRLLTDLAQES---VV
A0A6I3F378      N---PLELVRHTLDGPD-----V--LPAGRSPYNSSELLSSRRMGEVLHELAAIY--DFV
A0A1S1CAD0      V---EIANAVHQLGESN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
G5ET14          V---EIANAVHQVGESN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1E9DXX2      V---EIANAVHQLGESN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1E8S156      V---EIANAVHQLGESN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1E8S5S2      V---EIANAVHQLGESN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1S1DFA8      V---EIANAVHQLGESN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A2I1Z490      V---EIANAVHQVDESN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1F0DAA9      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1F0PHK9      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1F0VZG6      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1E9G8X4      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1E9IAW2      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1E9ZBC9      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1E9ZDP4      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1F0R6B5      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1F0Z7N5      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1F1D897      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
D2NP38          V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1F1FV74      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLIKELSEEF---IV
A0A1E9M791      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLIKELSEEF---IV
A0A291DEI8      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLIKELSEEF---IV
A0A1S1D5T1      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1E8TRD6      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1F0XT88      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1F1EVP5      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
C6R548          V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A0K2RXS2      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A1F0KX60      V---EIANAVHQLGDSN-LF--V--LPAGRIPPNPSELLGSDKMRQLINELSEEF---IV
A0A542I3V2      A---QLVDVIQAPTVLSNLS--V--LGSGPTPPNPSELLGTNAMKQLLNTLAAGA---TV
A0A2T0UZ65      M---DYTDAMQATRHQD-VF--V--IAGGQVPPNPSELLGSARMRQLLQELTRDH---FV
A0A1R4JTI6      A---QVDDVLQPVSEVENLT--V--LASGPVPPNPSEILGSDRLEAILRSLAQDH---MV
A0A4R7TM52      A---DFEDVAQPVGQGGNLS--V--LGAGLLPPNPSEVLGSARMRDLLQRLAVDS---TV
A0A542XE74      V---PLEEALVESGTRG-LQ--I--LPAGRIPPNPSELVGSNAMHRLIERLAADH---MV
A0A0G3V3F3      ----DLSEALRKVAESPFLR--V--LSSGPPVEDPSAILGARAFRVVLDTLRAVR---LV
A0A0Q7QDF6      V---PLDSAVQGTDVPG-LD--V--LTSGTRPPNPSEIIQTAAMETVLIELGRRY--DIV
A0A3S0V9U6      V---GIEEAIQRFHESE-LY--V--VPAGRIPPNPSELLGSAKMRKLIEELAREY---LV
A0A5R8L819      S---TWREVSQPAHTPN-LT--V--LAAGRIPPNPSELVGSERMNLLLHELAAEA---IV
A0A261FQA1      A---KLDEAIQQYWKPT-FH--V--MPAGEQQANPSILINSKAMNMLLHAAAKQY--DNV
A0A1Q2CJ92      I---KLSDAMQATDHKH-LQ--V--LPAGRIPPNPAEMVGSSRMRSLIEHLSKAH---MV
A0A2T0S3C8      A---SIADVVQPWSEG--MW--A--LPSGSLPPNPSELLGSQHMADLLEQFREQY--DMV
A0A4Y8WZJ3      V---ELADALQTVGNRPSLQ--V--LASGPIPPNPSEILASDRFNDLINALAEDA---LV
A0A285VUW0      A---RAEDVIQRWRDTE-MY--V--LAGGEIPPNPSELLGSRAMERLFKQFLRDF--DFV
A0A2R7Z032      L---RAGEAMVSSGIDN-LW--L--LPAGRIPPNPSELLGSLRMSQLIDELARTH---LV
A0A1I0W453      V---EIRDVIIDSGMPN-LS--L--LPAGRIPPNPSELLGSLRMKQFIDDLAHDY---LV
A0A1H4LCS9      V---DIRDVIVDSGLTN-LS--V--LPAGRIPPNPSELLGSLRMKQFIEDLSHDY---FV
A0A4Q2RZP8      V---DIRDVIVGSGLSN-LS--L--LPAGRIPPNPSELLGSLRMKQFIEDLSHDY---LV
A0A0Q6VV12      V---DVRDVIVGSGMAN-LS--V--LPAGRIPPNPSELLGSLRMKQFIDDLSQDH---LV
A0A495NTA9      V---EVRDVIVGSGLAN-LS--L--LPAGRIPPNPSELLGSLRMKQFIDDLAQDH---LV
A0A0Q9QB08      V---DVRDVIVESGVAN-LS--L--LPAGRIPPNPSELLGSLRMKQFIDDLSADH---LV
A0A4Q2SA86      V---EVRDVIVESGMAN-LS--L--LPAGRIPPNPSELLGSLRMKQFIDELSHDY---FV
A0A4Z1C3Z0      V---DVRDVIVQSGMAN-LS--L--LPAGRIPPNPSELLGSLRMKQFIDELSHDY---FV
A0A4Q2JUT1      A---ALSEVLQRTPKSNNLL--V--LAAGSVPPNPSEVLGSERMHTLIADLTKHA---TV
A0A542J310      A---ALTEVLQRTPKSNNLL--V--LAAGSVPPNPSEVLGSERMHTLISDLTKHA---TV
A0A444BL03      V---DLEDAFQPTDQEN-VR--L--ITSGRTPPNPSELLGSARMHELVRELTVDN---IV
A0A4Y8X357      V---FLADALITLEDG--LV--L--LPAGRTPPNPSEQLGSSRMRELLEALSETH---MI
R4LD52          A---AVDDVLQRYGDH--LW--V--LPSGFLPPNPSELLGSQHMALLMDELRTAF--DTI
A0A4T2CD79      A---ELDDVLQPWGERGNLR--V--LGAGSIPPNPSELLGSHGMTTLLRELALDA---IV
A0A2N3YJR1      V---SLVDALQATDQPN-VR--L--ITSGRTPPNPSELLGSARMHDLVRELSVDN---IV
A0A6G8FYB9      V---PVEDVLLETDEPN-VR--L--VTSGRTPPNPSELLGSVRMHELVARLTEDH---VV
A0A4Q4D742      T---TIEQAIQPH-VSG-IS--F--MGTGPAAPNPAEVLESRAMRDLLARVRNEF--DTV
A0A4Q2RU39      V---EVKDVIVDSGMTN-LS--L--LPAGRIPPNPSELLGSLRMKQLIDELAEEY---LV
A0A4Q2SK58      V---EVKDVIIDSGMTN-LS--L--LPAGRIPPNPSELLGSLRMKQMIDDLALDY---LV
A0A1C6T1J1      V---QVGDVVQRWGDKS-LL--V--LPSGSTPPNPSELLGSKAMADLLLGLRESA--DIV
A0A2W2CFC8      V---PVGDVVQRWGDKS-LL--V--LPAGSAPPNPSELLGSKAMADLLLALRESA--DIV
A0A2W2A4B0      V---ELADVLQPWGRAG-LS--V--IPSGTVPPNPSELVGSPAFTALIEDVAALF--DVV
A0A4Y9MDA5      A---GLPDLVQEWGTSG-LH--V--LTAGPVPPNPSELLGSPAMRRLLEAAREEY--DHV
A0A1H7N9P7      A---SVADLVQEWGTAG-LH--V--LPSGPVPPNPSGLLGSPVMRRLLERLRDDY--DHV
A0A1M7V0F8      A---TVADLVQDWGTEG-LH--V--LASGPVPPNPSELLGSPAMRRLLERLRDEY--DHV
A0A022KX11      A---DLDDVIQTWG-SAGMD--V--LPAGPIPPNPSELLGSAPMEALLTRLMQEY--DFV
A0A4Q5A868      A---SVKDVVQRYW-KPNLH--V--MPAGPKPPNASALLNSPIMVELLNNAIAQY--DYV
A0A345NSU7      A---DVHDVVQPWGGN-NLH--V--LTAGEVPPNPSELLGSSKMHELFERLSEQY--DFI
A0A0W8I9Y2      V---QVDEVLQTYDKFPNLQ--V--LGAGRTAPNPTELLSSKAMHAMLETLAED---ALV
A0A4Y5YMQ6      V---TFDDAVIS---TAGVD--V--LTAGEHVPNPAQLLASQKMTELVEGLRPRY--DFV
A0A255G8R8      A---TLSDLVQPFSGHPDLY--V--LTSGVVPPNPTELLDSAQMRALLDEALAEY--DVV
A0A6G7Y423      G---TLDGLAIR-TEPAGLA--V--LPAGAVPPNPSELLGSDAMAHLITAAERSY--DYV
A0A2N4T4Q5      A---EVDDVLQVYDKFPNLQ--V--LGAGRTPPNPTELLASQAMRTMLAELAED---AFV
A0A1M3LEY6      A---RLSDVTQAWGLR-NLS--L--LPAGAMPPNPSELLGSQAMVNLLRHVEKEY--DVV
A0A538AJI7      T---PIMEAAQKGWAE-NVW--I--LPTAHDPEA--GDLLARRLTDVLDEARENF--DLV
A0A538AM15      L---PLERVARPLPPF-NLS--V--IPAGQAPPSPYEVLKSPRLGELLEEARLRY--DYV
A0A1V8PLV6      A---AVKDAVQRYW---KPN--LHILPAGPKPLNASMLLNSKTMSKLLDTALHTY--DYV
A0A4R0U4F1      V---SSHDAIQRYW---KPN--FHVLPAGKQTMNPSILLNSRAMKALVEQVSGAY--DYV
A0A357ZCV8      A---KLSDAVVSTP---IPN--LFFLDTEPNIPSPTDVLSSKSFAKLVEVLESNF--EYV
A0A4R1CW45      ME--SLHEVGLHID---GTK--LAVFPTHTVSMDSAEAIASGRFDTLVETMRKHTGEAVV
A0A4R5Z7B0      A---TLGSTVLETE---EKD--LYILTSGPVPPNPAELLSSKSMEQFIEEAKEQF--DYV
A0A419GS64      ----DEGDDPFAFGDQVMDG--LTVIGSGPPPPNPSEIISSRRFRKFIKNASAAY--DTV
A0A2V2CXY5      A---DMADVIYQTN---IPN--GYMIPTTSAIANPTILLEGTRFSHMIESCAKTF--SYV
A0A2S8MDM2      A---LLGEALQKTR---FPG--LTVLTSGSIPPNPSELLGSQSARRLLSELRSQY--DYV
A0A357ZDL3      V---ALNDAVMTTQ---AGN--LFFLDAEAGIPNPVDILSSNRFKALVKTLREGF--DYV
A0A4Y8ZIU8      V---ALQDVLVPVG---DHG--LLLLPAGRTPPNPSEQLGSARMRDLLTALAE-T--HMV
A0A0F0KYJ9      A---TIAEVAQRFG---NGQ--LLVVAAGKVPPNPSEVLGSARMRELLKSIAR-E--AIV
A0A538BBM6      T---VVEDALQYVPVTRETG--MYFLSTGSSVSNPTELLGAGRTARLLGALAEQA--DLV
A0A1I6GVG4      A---TIAEVAQRFG---NGQ--LLVVTAGKVPPNPSEVLGSARMRELLKSIAR-E--AIV
A0A1I6IST1      A---TIAEVAQRFG---NGQ--LLVVTAGKVPPNPSEVLGSARMRELLKSIAR-E--AIV
A0A412JBM5      GEL-GLASIE-------GIP--LDIAFCGVIPPNPSELLSSTRMKRFLEASRKAY--DYV
A0A510HHA8      R---GLQEVLSEP----LPN--LKVCPSGPVPPNPAELLSSNRFSALVEEARETF--DYV
A0A6G8Q9J3      D---GLGEAWQEA----APR--LKVVAGGPTPPNPAELLGSRRFSELLGRASREF--DYV
A0A1C2B334      G---DLPDLLQQGG---LDR--LDVLATGQLPPNPAELLGSSRARELFDTLAASY--DYV
R7Y679          A---PVGDVLQRSG---VGG--FDVLAAGALPPNPAELLGSRRTGQLLDELCELY--DYV
A0A5Q2F9A3      A---SLREVVQVAG---MGT--LQVLTSGPVPPNPAELLGSISMVRLLECATHEY--DAV
A0A4R1BMZ2      R---SLPDTMQEV----LVG--LNVLTCGPIPPNPAELLSSQRFAEFVARVRAEF--DYV
A0A023X491      E---NVEELWQTP----LDN--LSVLTSGPVPPNPAELLGSERFGALLGDLARRF--EYV
A0A6G8QDQ0      L---ELQETWHEP----VPF--LKVATVGPLPSRPAELLGSKRFSELLEKAREQF--DYV
A0A0K8Q3D9      A---DLDDVLQPWGA--LPN--LSVLGSGRIPPNPSELLGSRAMKNMLQALAQ-N--ATV
A0A2R7RCA1      A---ELADVLQPWGA--LPN--LSVLGSGRIPPNPSELLGSQAMKNMLNALAE-N--AIV
A0A1Q7WJN6      V---TAEAALQRTP---YSG--LSFIGCGSRRHRGPELLSSAAMPRLVASLRPHY--EAI
A0A6D1QMN1      S---TLDEAALETS---IPR--LDVLPSGPVPPNPSELLASKAFERFVKSVSDAY--DYV
A0A1E2SNF6      V---SLREVLQDPDVSLHTH--IRVLTAGRTPPNPSELLGSRTMRELLAALSE-L--AVV
Q6ADE8          V---SLREVLQDPDVSLHTH--IRVLTAGRTPPNPSELLGSRTMRELLAALSE-L--AVV
A0A1Q7CZ24      SGL-SLEDTVETLA---HFN--LSVLPAGRATVAPYELLKSPRLEALLDEARQRY--DYI
A0A2W6VLC6      A---RVEDVVIDMA---PRG--FSVLPAGRIPPNPSELLSSPRMKQLIAQLSLAY--DVV
A0A519G798      S---ELQDSIQKHT---DSG--IYFLASGPIPPNPTEVLQSRAAQELFDRVSQMF--DMV
A0A519GXS6      I---AVEDAIIATA-TG-----LDVLTAGEEAPNPAELLASQRMRVLLEGLREEY--DLV
A0A520EHH5      A---GLDEVVQTTGHTD-----LWALGSGPAPPNPSELLGSSTAQSLLRDLGRAF--DYV
                                                                           :

A0A538BYZ4      LLDTPPVVVVPDCRVIEKWVDGFLLVVAARKTPRKLLEEALTVMDP--AKILGLVFNGED
A0A348NU28      IIDSPPVMSVADANLLAPFVDGVIVVVDAGKTRRNQLIQAAASLESAGGRIVGLVLNKVR
A0A4Q5APW3      LVDTAPMVVANDAVIFVRRGGSLIMVCRRDQTLKRDLREISEELTTLDLSANGVIFNCAR
A0A4Q5B0V3      LVDTAPMVVANDAVIFVRRGGSLIMVCRRDQTLKRDLREISEELTTLDLSANGVIFNCAR
A0A222TG79      IVDTPPVLPVTDAVIASRLVDGVIVVVRSGASRRPDLESMLSHLGRANAAVVGVVLGDAQ
A0A6I3DFP2      VVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTE
A0A1Q2CRV2      IIDSPPLLPVTDAAVLAGETAGVLVVVGSGIVRRPELTASLEVLERVEARVLGLVFNRVK
A0A2S5WZJ5      VIDAPPLLPVTDAAVLSTRVDGVVLVATAGRTRREDASAARDMIDQVNGRLLGTVLNMVP
K6WHS4          VVDTPPCLPVTDAQVVSRLVDGVLVVVRIDKSAKHELSDTTRQMDTAGVHAMGVVINGTP
A0A1L2ZMQ6      IIDAPPLLPVTDGAVLAKASDGALIVVKAGKPTIDELAKATENLDRVGANKLGVILNQVP
A0A3L8NYD3      LIDAPPLLPVTDAGLLSGIVDGSILVLAVGKTYKEQARLAAKVLQQVGGHVLGSVLNRAP
A0A1M6K628      IIDAAPLLPVADAGLVSAVSDGVLLVVQHGKTLREQIALATRNLDNVDAALLGFVMNQVP
A0A561E8R3      IIDAPPLLPVTDAGLLARSADGALLVMHVGRTRAEHIRLCARILTQVGGRLFGGVMNLTP
A0A3E2DN22      VIDAPPLLAITDAGLLGAIADGTIYVAVVGKTHRDQVSLVAKRLEQVGAPLLGSVLTRVP
A0A3Q9ULZ9      VLDAPPLLAVTDAGLLATSTDGVIMVHVVGGTHKEQVTLCTKRLEQVGAVLLGSVLTRAP
A0A3S9JFL2      ILDAPPLLAVTDAGLLATSTDGVIMVNVVGGTHKEQVTLCTKRLEQVGAVLLGSVLTRAP
A0A1Q2CI19      IIDSAPLLEAAEVFDILPHVDDVVLVARSGRLSAASAQRTKEMLARFNIPVVGAVIVGAP
A0A512T3M3      IVDSAPLLAASEVFDLLPLVDTIMLVVRSGRLSETSGNRVSELLGRFRVPVSGVLLIGTS
W6JTW4          LVDTAPLLAASDVFDILPLVDTVLVVVRSGRITHAAGSRLAELLGRFKVPVSGVLLIGSK
A0A0A0JTY0      LIDTAPLLEASDVFDILPMVDTLLLVVRSGRLTEVAGNRVAELVGRFQVPVSGVLIVGAP
A0A0A0JXF2      LIDTAPLLEASDVFDILPMVDTILLVVRSGRLTEPDGNRVAELVGRFQVPVSGVILVGAK
E6S8H2          LVDSAPLLAASDVFDVLPLVDTVLLVVRSGRLTEVAGHRVSELLGRFQVPVAGVVVVGAQ
A0A0A0JGH0      IIDSAPLLAASDVFDILPIVDTVVLVVRSGRLTDVAARRVAELLGRFQVPISGVVLVGAR
N0E4U7          IIDSAPLLAASDVFDVLPIVDTVLLVVRSGRLTDVAAHRVAELLGRFQVPISGVVLVGAR
A0A0A0IYK2      LIDTAPLLEASDVFDILPMVDTLLLVVRSGRLTELAGNRVAELVGRFQVPVSGVILLGAP
A0A0Q9L0H3      LIDSAPLLEASDVFDVLPTVDTLLLVVRSGRLTEVSGNRVAELVGRFQVPVSGVIIVGAQ
A3TMK0          LIDTAPLLEASDVFDILPMVDTLLLVVRHGRLTEVAGNRVAELVGRFQVPVSGVIIVGAK
A0A543PXP1      LIDTAPLLAASDVFDLLPLVDTVLMVVRNGRITEVAGRRVSELLGRFNVPVSGVLIVGVR
A3TMH6          LIDTAPLLAASDVFDVLPVVDTVVVVVRHGRITDVAGRRVAELLGRFHVPVTGVVIVGAP
A0A1H6WL79      LIDAPPLLPVTDAAVLSRVADGTLVVARARKTTRDTLYRALSNLTRVQGRVLGVILNCVA
A0A101LAM5      LIDAPPLLPVTDAAVLSRVADGTLVVARARKTTRDTLYRALGNLTRVRGRVLGVILNCVA
A0A4Y3NEG0      LIDAPPLLPVTDAAVLSRVADGTLVVARARKTTRDTLFRALGNLTRVRGRVLGVILNCVA
A0A1H6YPK1      IVDSPPLVPVSDAAVLAARTDGALVVARAGATSADMLEEALRILDRVQGRALGVILDGVA
A0A2R7MGI0      IVDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLTRAIENISKTRGRLLGIVLNRVP
A0A2T7WQY4      IVDSPPTLAVADAAVIGSWADGVVLVVTAGRTTDDMLTRAVDNLSKTRGRLLGIVLNRAP
A0A1G6GTN3      IVDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLTRATENIAKTRGHLLGVVLNRMP
A0A1N7DLV3      IIDSPPTLAVADAAVIANWADGAVLVVTAGRTTDDMLQRAVGNIAKTRGRLLGVVLNRVP
A0A1V2NSB5      IIDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLQRAVGNIAKTRGRLLGVVLNRVP
A0A0Q5Q5L3      IVDSPPTLAVADAAVIASWADGTVLVVTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAP
A0A0Q6DVM4      IVDSPPTLAVADAAVIASWADGTVLVVTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAP
A0A1R3WWR6      IIDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLSRATENISKTRGHLLGVVLNRAP
A0A5Q2FA83      LVDSPPVLPVIDPILIDRLVGGMLMVISVNTTLKRDLAQAVKQLRTVDAKVAGFALNRMP
A0A542FTE6      VLDAPPLLAVTDGAVLSTIADGVIMTVDAASSTQDQLQRAVGAVHRVGGKILGVVLNRVP
A0A2S5UYV0      VIDAPPLLPVTDAAILSTRVDGVVLVATAGRTRREDVGAARDMLSQVHGRLLGTVLNMVP
A0A2S5X9U6      VIDAPPLLPVTDAAVLSTRVDGVVLVASAGRTRREDVSAARDMLKQVHSRMLGTVLNMVP
A0A2S5ULV5      VIDAPPLLPVTDAAVLSTRVDGVVLVASAGRTRREDVMAARDMLKQVHSRMLGTVLNMVP
A0A653YMF0      VIDAPPLLPVTDAAVLSTRVDGVVLVASAGRTRREDVAAARDMLKQVHSRMLGTVLNMVP
A0A4V1VGV9      VLDAPPLLPVTDAGLLAVAADGAAVVYQHGRTHREQVGLCAKILEQVGAHYYGSILNMTP
A0A3Q9IY80      IVDAPPLIPVTDAAVLSHSADGAIIITSVGKTTFEALTKALQNLERAGSRALGVVLNRVP
A0A0F0LP73      VIDAPPVLPVTDASVMSAFVDGVVFVIAMGRTRKTEVVEARTQLAQIRARILGVVLNFVA
A0A1F1X071      IIDAPPVLAVTDAQLLTRHSDGAILVAVPGQTRTAAMQKAVEAIRAVNGTVYGAVLNRAS
A0A3R8RWC7      IIDAPPVLAVTDAQLLTRHSDGAILVAVPGQTRTAAMQKAVEAIRAVNGTAYGAVLNRAS
A0A4U0RJZ4      VLDAPPLLPVTDAGLLSVAASGAAVVYHHGTTHKEQIALCTKILDQVGAHYFGSILNMTP
A0A4R1FGL9      VLDAPPLLPVTDAGLLSVAASGAAVVYHHGTTHKEQIALCTKILDQVGAHYFGSILNMTP
E3B8H1          VLDAPPLLPVTDAGLLSVAASGAAVVYHHGTTHKEQIALCTKILDQVGAHYFGSILNMTP
A0A0Q5AWK6      IIDAPPILPVTDASIVATVVDGVVFVVASNRTRRPEVTAARRILAQVRGRVLGTVLNMVT
A0A3N1NLD3      IIDAPPILPVTDASIVATVVDGVVFVVASNRTRRPEVTAARRIVQQVRGRVLGTVLNMVS
A0A3N2FVI8      IIDAPPILPVTDASIVATVVDGVVFVVASNRTRRPEVTAARRIVQQVRGRVLGTVLNMVS
A0A2S5XDQ6      IIDAPPVLPVTDASIVATVVDGVVFVVASNQTHRPEVVAARRIVQQVRARVLGTVLNMVT
A0A2S5XNN6      IIDAPPVLPVTDASIVATVVDGVVFVVASNQTRRPEVVAARRIVQQVRARVLGTVLNMVT
A0A3L7ADK2      ILDAPPILPVTDAVVLANSADGVVLVASARNTTYEQFGRAQQLIKRGGAHLLGTVLNRVP
A0A6I2XCV4      FLDTPPMLTTNDATDLLASADLTMLVIRSGQTRTVAAERVSGLLARFGAPVIGTIFNGCS
A0A5R8VLL6      IIDAPPLLPVTDAVLLAKIADGAIVVVRAGQTTKEQLTKSLGNIRKVNATILGTLLNCVP
A0A538JQF8      LIDTAPTLIVNDAIDFMPEVDCVIPVLKCGSTTNDAAFRMGELLVRMGARVLGVVLVGVP
A0A0Q5JKD6      IIDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLTRATDNIAKTRGHLLGVVLNRMP
A0A0Q9TBP0      VVDSPPVLTGADTLELAALADMVVVVTRERVSRRRQLVAVRETLRQVSVESVGIVYNGVG
A0A346XTB0      IVDSSPLLAVADATIVAGSVDGIVIVVSHG-TPFSELQKVKERLKFVSTPLLGYVFNRSD
A0A0G3V3M7      IVDSPPILLANDAAELSTFCDATVLMVRAGWTRRGGVVAASDLLRRLEATTVGVVLVGAE
A0A6I3DD56      IVDSPPILLANDAAELSTFCDATVLMVRAGWTRRGGVVAASDLLRRLEATTVGIVLVGAE
A0A2W6DK08      LIDSAPMLLANDATDLMPYVDTVLVVSYASRTTSEEARRASELLARTRAPAIGVALVGVK
A0A2S0LQ32      LLDAPPLLPVTDAALLSALADGAILTFEVGGTYKEQARLTGKILGQVDARLLGVVLNRAS
A0A2N6V1R5      IMDAPPLLPVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRAS
G9PHS6          IMDAPPLLPVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRAS
U1PLM7          IMDAPPLLPVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRAS
A0A6I1G2U1      IVDTAPILAASDGFDILPIVDTVLFVVRSGRLTEAAGLRVSELLGRFHVPVTGAILVGTP
A0A351ETF8      IIDAPPVLAVTDAVLIGRAVNGQILLTRLGATKRSDLAEAAKLLATNGSRSLGVVVNRDQ
A0A349B7N2      LIDTAPFLTVNDARDLLDVADQVVVVARSGKTSRQSADRMSELLARLSAKVVGVVL----
A0A346Y185      IVDSPPLLLASDASAIATNVDGIVVVVS-RGTSMKLLEEMRERLDRIGTPVLGYIYTKAK
A0A259S8H9      VVDAPPVLAVTDASVLSSVVDGLVFVVAMGRTRRVEIVEARTQLEQVRARVLGVVLNLVS
A0A0Q5L115      ILDAPPVLAVTDAVVLAAKADGVLMTASAARTTFDQLDRALQLVTRGGGDVLGVVLNRVP
A0A2W1Z497      VLDAPPILAVTDAVVLAAGADGLVVTVSAQGTTIDQLGRALQLVARGGGTVLGAVLNRVP
A0A1H4I042      IVDSCPLLAVTDAALLAANADGALLLGRYGQTRRDQLKNATDALQNVGAALLGSVFVMTP
A0A4R7A6D9      IVDSCPLLAVTDAALLAANADGALLLGRYGQTRRDQLKNATDALQNVGAALLGSVFVMTP
A0A4Q4D4T1      LVDAPPLLPVADAALLSVISDGAILVVRHGRTGHDQVRAASERITTVGGRLLGTIISMSP
A0A261FE22      IIDTAPMQVSNDASLFAREGATLLLVVAQTVGRKKVLRDVAHEFKVSRVKISGVAFNRVA
A0A5C8C085      LVDAPPLLPVTDGAVLTTMADGAFIVVSAGRTLDNELEASLEHIKAVNGTTLGIVFNGVA
A0A1E4BP96      IVDSPPTLLVADAAVLSRVTDGALLVTSAGRTTHEMLQRSLENIAKVNGRLLGVVLNKAT
A0A101KZQ4      LIDAPPLLPVTDAAILTARTDGALVVSRVRKTTYDELESALNNLQRVNAHALGLILNGVP
A0A439DNZ6      VVDSSPLLAVTDAAILAAASDGVLIVARYGETKREQLAHAVGNLRSVGAPILGAVFTITP
A0A0J6YE86      IIDSTPLLAVTDAAILAAGADGVLIMARFGQTKREQLAHAVGSLESVGAPLLGAVFTMVP
A0A5Q5BFU2      IVDSTPLLAVTDAAILAAGADGVLIMARFGHTTHEQLTHAVGSLESVGAALLGAVFTMIP
A0A151BT98      VFDSPPMLPVVDALELEKLTGNLILVARGGQVSRRELQITLKALETVDANLSGTVLNYAD
A0A2Y8ZRF8      VFDSPPMLPVVDALELEKLAGNLILVARGGQVSRRELQVTLKALETVDANLSGTVLNYAD
A0A2R9UAT1      IVDAPPLLPVTDAAVLTHSADGAIVVVGAGRTTIDVLKKAMNNLERAGGRALGVVLNRVP
A0A4Q5J5D7      IVDAPPLLPVTDAAVLTAVADGAFVVISSGRTVDTELRDALANLDAVRGRALGVILNRVA
A0A1Y4CKD6      VLDASPCGMFQDAAMLANWVDEVLFVVRFDKVGRHNVQDALSMLDGERASVLGYVLNGCP
A0A0Q7KBQ4      VIDAPPMLPVADASILMREVDGALMLVRHGSTTREQLRLAVARIETVGGKLFGTILNRTP
A0A1F1IHY9      IIDAPPLLPVTDAAILARRFDGCLLVVSAGRTTYDEFSKAVSSIRKIDGEVLGAVLNRVP
A0A542HCT5      IVDAPPLLPVTDAAVLTASADGALVVVSAGQTLDTQLRDALANLAAVNGHTLGVVLNRVS
A0A2S8WHZ8      LVDAPPLLPVTDAAILSTSADGILVVVRAGSTTGDELGKAIENLKKVDANILGAILNQVP
A0A537WNY9      VIDGTPLAPISDARVIARFADASVIVVSAGSATRRQLRTAIERLSVISVRPTAVVLNDAP
A0A5B8M469      VVDAPPVLPVTDALLVGAVADGTLFVVAVGQTRKAEVTAARRLLEQAKSRLLGVVLNKVP
A0A1Y4CTD2      FVDCSPVAAAADAELWMRQVDTVVLVVRQDMTDVRVINDTVDVAWKSAGDFSGFVLN--A
A0A0Q5M6Z7      ILDAPPLLSVTDAAIMGTIADGVVITVGAKQVTGEQLEKAYRSVVRVNGKVLGVVLNKIP
A0A3N3ZPU0      VIDSPPLLPVTDPSVLAKGADGVVIVTQANKTNLDDLTKAVARLHTVGATILGAVLNQVP
A0A359IQX7      IVDAPPLLPVTDGGLLTAAADGAILVMATGRTYKEQLRVCARILKQVNGRLLGSVMNLAP
A0A4R8TXC3      VLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAP
A0A433EDP2      VLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAP
A0A231VTW0      VLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAP
A0A433ECD0      VLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAP
U7V3Z1          VLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAP
A0A1F1J417      IVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP
A0A2A8D6P2      IVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP
A0A1F0THV9      IVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP
A0A5F0M6Y0      IVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP
D8USQ4          IVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP
E3H5W1          IVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP
A0A1F1QKB0      IVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP
A0A509JY23      IVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP
A0A448USF4      IVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP
A0A0Q9LZR0      IVDAPPLLPVTDAAVLTASADGALVVVSAGHTLDTQLRDALANLATVNGHTLGVVLNRVS
A0A1N7E3F1      IVDAPPLLPVTDAAALGAICDGALLVVRHGKTRNEQVLRAGELLSSINARLVGTVLNFVP
A0A544ZKQ1      IIDAPPLLPVTDAAALGAICDGALLVVRHGKTRREQVLRAGELLSSINARLVGTVLNFVP
A0A372P1T1      IIDAPPLLPVTDAAALGAICDGALLVVRHGKTRREQVLRAAELLSSINARLVGTVLNFVP
A0A5D0Q2X0      IIDAPPLLPVTDAAALGAICDGALLVVRHGKTRREQVLRAGELLSSINARLVGTVLNFVP
A0A5R8Z2E7      IIDAPPLLPVTDAAALGAICDGALLVVRHGKTRREQVLRAGELLSSINARLVGTVLNFVP
A0A1L2ZMV4      IVDSPPLLPVTDASVLSTSADGVLVVARAGSTSIEALKKATDRLDRVNGHVLGVVLNQVP
A0A6I3F378      IIDTPPVLPVSESLAVSRHADGTILVVRSGRTRSQQLQRTLGEFDRIGSPVLGIVLNGLD
A0A1S1CAD0      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAP
G5ET14          VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAP
A0A1E9DXX2      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAP
A0A1E8S156      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAP
A0A1E8S5S2      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAP
A0A1S1DFA8      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAP
A0A2I1Z490      VIDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLLGMVLNRAP
A0A1F0DAA9      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAP
A0A1F0PHK9      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAP
A0A1F0VZG6      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAP
A0A1E9G8X4      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP
A0A1E9IAW2      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP
A0A1E9ZBC9      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP
A0A1E9ZDP4      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP
A0A1F0R6B5      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP
A0A1F0Z7N5      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP
A0A1F1D897      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP
D2NP38          VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP
A0A1F1FV74      VVDVPPLLPVTDASLLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAP
A0A1E9M791      VVDVPPLLPVTDASLLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAP
A0A291DEI8      VVDVPPLLPVTDASLLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAP
A0A1S1D5T1      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAP
A0A1E8TRD6      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAP
A0A1F0XT88      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAP
A0A1F1EVP5      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAP
C6R548          VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAP
A0A0K2RXS2      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNAKLLGMVLNRAP
A0A1F0KX60      VVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNAKLLGMVLNRAP
A0A542I3V2      LIDAPPLLPVTDAAVLSRAADGVIVVAKAGRTTRDEFERSLRALQKVQAPVLGAIFNCVP
A0A2T0UZ65      ILDAPPLLPVTDAALLSGAADGTILVFAVGKTHKDQVEACAKMIQQVGGRILGIVLNMAP
A0A1R4JTI6      IVDAPPLLPVTDAAILAAKYDGCVLVVTAGRTTRDELAKSLGNLEKVNGDVLGTVLNRVP
A0A4R7TM52      IIDAPPLLPVTDAAVLAHNADGAMIVASVGKTTVERLQKAIQNLDRAGARCLGVVINRVP
A0A542XE74      IIDAPPVLAVTDGALLSAAADGTILVTRLGRTHRAALEQSTKLLDQTKARLLGVVLNAAS
A0A0G3V3F3      VVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTE
A0A0Q7QDF6      LVDAPPLLPVADAALLSVISDGAILVVRHGRTGHDQVRAASERITTVGGRLLGTIISMSP
A0A3S0V9U6      LIDAPPLLPVTDGSLLSTSVDGAILVTKVGSTRRDQAEGAKAMIDKVQGNVLGAVMNMAP
A0A5R8L819      ILDAPPLLPVTDAAVLSRQADGAIIVVTAGKTTYDLLKRALANIEKVGGRALGVVLNRVP
A0A261FQA1      IVDSTPMSVANDSAVFAKEGGTLLMVVGQGVAQKKTLKASAEEFELVGVKPAGAVVDMVK
A0A1Q2CJ92      IIDAPPLLPVTDATLLSASADGAVVVVQSGTTRREQLEVAAHKLRQVDGNLLGVVLNKVA
A0A2T0S3C8      IVDCPPLLPVTDGAVVAARADGALLLARSHKTTSSQIQTAARALQSVDARLLGCVFNMVS
A0A4Y8WZJ3      IIDAPPLLPVTDAAILARRFDGCLLVVSAGRTTYDEFSKAVSSIRKIDGEVLGAVLNRVP
A0A285VUW0      LVDSPPILPVTDALVMSRLTGGLLMVVSAASTRRRHLQEALRTLEAAEAEVSGFVLTKTP
A0A2R7Z032      LLDAPPLLPVTDAGLLSAFCDGALLVQATGQTYIEQSEHCRRILDQVGSRLLGIVLNKAP
A0A1I0W453      ILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQSCRRILDQVGSRLLGVVLNKAP
A0A1H4LCS9      ILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGGRLLGVVLNKAP
A0A4Q2RZP8      ILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGSRLLGVVLNKAP
A0A0Q6VV12      ILDAPPLLPVTDAGLLSAFCDGALLVQAAGRTQIEQSQQCRRILDQVGSRLLGVVLNKAP
A0A495NTA9      ILDAPPLLPVTDAGLLSAFCDGALLVQAAGRTQIEQSQHCRRILDQVGSRLLGVVLNKAP
A0A0Q9QB08      ILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQQCRRILDQVGSRLLGVVLNKAP
A0A4Q2SA86      ILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGSRLLGVVLNKAP
A0A4Z1C3Z0      ILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGSRLLGVVLNKAP
A0A4Q2JUT1      IIDAPPLLPVTDGAVLAHQADGALVVVTLGKTTYDLLEKALDTLRKARGRALGIVLNKAP
A0A542J310      IIDAPPLLPVTDGAVLAHQADGALIVVTLGKTTYDLLDKALDTLRKARGRALGVVLNKVP
A0A444BL03      ILDAPPLLPVTDAGVLSASCDGSLLVFAVGRTHKEQAELAARMMGQVGGRVLGVVLNMAP
A0A4Y8X357      LVDAPPVLPVTDSTLLANAVDGTILVVRHGTTRKEHVEVARDMLARVHARVLGVVLNGVP
R4LD52          IVDCPPLLPVTDAAVVAARADGALLLARSHKTTTAQVSNAVTALQSVDARLLGCVLNMVA
A0A4T2CD79      LVDAPPLLPVTDAAILAAISDGAIIVVSAGRTTTDELERALAGISMGGGRTLGVVLNRVP
A0A2N3YJR1      ILDAPPLLPVTDAGVLSASCDGALFVFAVGKTHREQARLAARMMGQVGGRVLGVVLNLAP
A0A6G8FYB9      ILDAPPLLPVTDAGVLAGFCDGTLLVFAVGRTHKEQARLAARMMSQVGGRVLGVVLNLAP
A0A4Q4D742      IIDAPPMLPVADASILLTEVDGALLLVRHGSTTREQLRLAVERVETVGGQLFGCVLNRTP
A0A4Q2RU39      ILDAPPLLPVTDAGLLSAFCDGALLVQASGKTHIEQSQHCRRILDQVGSRLLGVVLNKAP
A0A4Q2SK58      ILDAPPLLPVTDAGLLSAFCDGALLVQASGKTQIEQSQHCRRILDQVGSRLLGVVLNKAP
A0A1C6T1J1      IIDTAPLLAVTDGVVVAVQSDGALLVSQQGRTSRTQVAAAARALHAVSVRLLGCVLNMAK
A0A2W2CFC8      IIDTAPLLAVTDGVVVAVQADGALLISQHGRTARTQVAAAARALNAVSVRLLGCVLNMAK
A0A2W2A4B0      IVDTPPLGSVTDAALVSRAVQNMLLVVASGRVRRAEVSSSIESLATVGASVQGVVVTMAR
A0A4Y9MDA5      VVDTAPVLPVADAAILSRSVDGVLLLANVTRVRRAQLTEALRSLAQVEAGVQGVVLNQVH
A0A1H7N9P7      VLDTAPVLPVSDAAVLSRSVDGLVVLADVTRVRRAQLSQSLHSLAQVQATVLGVVLNQVR
A0A1M7V0F8      VLDTAPVLPVADAAILSRSVDGLLVLANATRVRRPQLTETLRSLAQVGGTVLGVVLNQVR
A0A022KX11      LIDSPPVVPVIDAVVIERLTGGLLMVVGVDRTKKRDLAAALKQLETVGAHVSGFARNFVA
A0A4Q5A868      LIDTAPMVVANDAVIFVRRGGSLVMVCRRDQTLKRDLREISEELATLDLSANGVIFNCAR
A0A345NSU7      LVDTPPVLPVTDAMVIEKLTGGMLMVVASGETRKRHVSEAMRVLETTGTHVAGFVLTKAP
A0A0W8I9Y2      LVDAPPLLPVTDAALLTASADGAIIVATAQKTTTDELSKALENLHQVHGNVLGVVLNRV-
A0A4Y5YMQ6      VIDTAPLLSVADATIISQYVDSTIVVVNTRKTTRAQLERCLAALRGVGANLAGLVLNNVR
A0A255G8R8      LIDSPPLLPVSDGLVLGKLVGGALLVTGIERVKKPQLAESLAALGTVDVKVQGVVLNMVR
A0A6G7Y423      LFDAPPLLPVTDAVVLASQTGGAILVARSGVVRRPQFEGAVDLLKAGDVATLGVVLNDVT
A0A2N4T4Q5      LVDAPPLLPVTDAALLTASADGALVVATAQGTTVDELGKALGNIEHVRGRVLGVVLNHVP
A0A1M3LEY6      LIDGPPLLPVTDSALLSKQVRGALLIVAAGRTHRGQVHGSVEALQNVGAHVAGVVLTMLP
A0A538AJI7      VIDTPPLLSTDDARTIATMAKGILLVVTRGTLAR-SVNEAVVAIEALQAPLMGIVANRFK
A0A538AM15      VLDTPPLCPVQDCRVIAHWIDGFLLVVAAHHTPR-RLVEEALNVVE-RGKMLGLVFNGGD
A0A1V8PLV6      IVDTAPMVVANDAAVFGAKSNGIVLVSGRDMTMKRDLKEIAVQLDNLNVPVMGFVFNFAK
A0A4R0U4F1      IIDTAPMQVANDAAVFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGLAMNYGE
A0A357ZCV8      IFDTPPVGTFVDAAIIGTLVDGVIFVVRPKHTKRKEMAFAYDQLGKADVHILGACANYRE
A0A4R1CW45      IFDLPPVFANDDAVLSTRALDGYIMVVDSGRTSRRQLADAMEMLNPVPC--LGTVLNRYA
A0A4R5Z7B0      LFDTPPLLAVADPQILANKVDASVFVVFSGKTEIDQAKKAKELLENAQSKLVGVVLNHKE
A0A419GS64      IIDTPPVGIVSDAAIISTMVDGTILVLDLKGGHRNMSVRAKKTLEKVNANILGLVMNNLK
A0A2V2CXY5      LVDTPPLGSVADALNVAPHCDGTVLVVRSGATPRKLVDNSVQLLKRTETPLLGIVLNRAD
A0A2S8MDM2      VVDSTPLLAVTDAAIMAAGADGVLVIARHGSTKKDQLTHAVSSLHSVGAPVLGAVFTMMP
A0A357ZDL3      VFDSPPLGPFVDAAIVGALVDGVVMVVRPRHTKRKDLLFAYDQLKKSESRILGACASYND
A0A4Y8ZIU8      LVDAPPVLPVTDSTLLSTAVDGTVLVVRHGKARKEHVEVARDMLAGVNARVLGVVLNGTP
A0A0F0KYJ9      IVDAPPLVPVTDAAVLAHSADGAIIVGTVGKTTYEVLGKAIGNLERAGARALGLVLNKVP
A0A538BBM6      LVDTAPVLPVADTLVVGRFAAGALLVIEARATPVPSISRAKDALTRNQTRILGLVLNRLK
A0A1I6GVG4      IIDAPPLIPVTDAAVLAHSADGAIIVGTVGKTTFEVLGKAIGNLERAGARALGLVLNKVP
A0A1I6IST1      IIDAPPLIPVTDAAVLAHSADGAIIVGTVGKTTFEVLGKAIGNLERAGARALGLVLNKVP
A0A412JBM5      IVDTAPINTVADAQILSPLVDGVILVALSQKSTRGELNAAIDSVSRAGGNLCGVVINGMD
A0A510HHA8      LIDSPPVEPVADPLILATQADGVLVVLDGQRTRKGSLRKALHDLRSVKANVLGTVMNNFD
A0A6G8Q9J3      LLDAPPLELVSDAAILATQADGVLLAMDAQKTRKIALRRAVRGLQLVGANVLGVVVNNVE
A0A1C2B334      IVDTPPILPVSDGAVVSQWVPNAILVVRADSTKRPELAAAWQQWKATNVRLVGVVVNDAS
R7Y679          LVDSPPVLPVTDAVVVSQWVDGGIIVVRAGGTTRQELVASLAQLHASRVSILGVVLNGVN
A0A5Q2F9A3      VIDAPPLLPVTDAAILSGMTTGALLVVGSGEVRAPQLAAALESLESVEGRLLGIVLNKLR
A0A4R1BMZ2      LIDAPPVGLVSDPVVISTQGDGVMLVLDAHSTGKGALRKSLHSLEAVGANIIGTVMNNVR
A0A023X491      LIDVPPVQVVSDAAIVAAQADGVILVFDAQSTRKLSVRRSIRTIESVGAKVLGTVMNNAR
A0A6G8QDQ0      LLDAPPTAPVSDPAILATQGDGVLLVLDAQKTRKASLRKAKRTLDAVGASVLGTVMNNVK
A0A0K8Q3D9      LIDAPPLLPVTDAAVLSRIADGAIVVIRAGKTTQVELENSLGNLQKVRGRVLGAVLNYVP
A0A2R7RCA1      LIDAPPLLPVTDAAVLSRAADGAIVVIRTGRTTQEQLAQSLGNLDKVKGRILGAVLNYVP
A0A1Q7WJN6      IVDTPPLVAGVDAFVLGTVTGALVLVLRAGMSDRDVATAKLDVLDRLPVRLLGAVVNDVR
A0A6D1QMN1      IFDAPPVNAVTDPQIIASLTDGTVLVIRSGVTEIEDAQHAVANLKKVEAHLLGTVLNDRA
A0A1E2SNF6      IVDAPPLLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTGVVLNRVP
Q6ADE8          IVDAPPLLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTGVVLNRVP
A0A1Q7CZ24      VLDTPPFVPVPDCRVITKSVDGFLVVVTVHRTPWGVLTEALDLIDP--AKVVGLVVNGDD
A0A2W6VLC6      IIDAPPLLPVSDAAVLAKQTRGALVLVGAGRVTRNQLQESLEGLRAVGATVAGVVLSMAP
A0A519G798      IIDGPPLLPVSDAAIMARDVDGAILVVRHGKTTKEQLKQATMRLEQVDANLLGVMVNMTP
A0A519GXS6      VVDTAPVLSVSDATVISQYVDATVIVVNTRRTGKAKIEQAVAALQSVRANLAGIVLNNVA
A0A520EHH5      VVDSPPLLPVTDAATLATQCDGTILVTRYGDTRREELTRAAANLENVGASLLGVVMSMVP
                ..*  *     :                                        .       

A0A538BYZ4      RPL------------------SLYYGGAEYYGEADGRLARGAGIARWLQWAKRGGDALRR
A0A348NU28      RKR---------------KESAYYTANTDA------------------------------
A0A4Q5APW3      ESK-------------KSLEHSNYYYYYSDSSKKGRFSLK--------------------
A0A4Q5B0V3      ESK-------------KSLEHGNYYYYYSDSSKKGRFSLK--------------------
A0A222TG79      SRA------------------------------------------GYYANSYALEYGQVG
A0A6I3DFP2      VVN----------------RSAYYEA----------------------------------
A0A1Q2CRV2      RSE-----------------GEAYGYRHSYYS-------------DHPRAAPKKGDRKSK
A0A2S5WZJ5      PRD------------------TADGYEYRRNRSYYVTADRKGMPVMKSIKRGHEQPEAFA
K6WHS4          VRQ------------------SPYRFRY------------------------------YG
A0A1L2ZMQ6      TRG---------------AEASRYGYYGKYYSKKETKAKAAADLQEPSVTDNPPTEQIQT
A0A3L8NYD3      LGG---------------IGGVVYGYGHATHS-QDYYSAYDRTGGDRSNGNTLRARFLYR
A0A1M6K628      KKD---------------LGAAAFGYGYSGAS-PRYYYAEDDGRRRPAAEVS--------
A0A561E8R3      PKN---------------MGSAVYGYGYSGKKYNGYGYGYGDSPAPTPAQPS--------
A0A3E2DN22      RKK---------------MGDVLYGYGAANYGYGSYYGDYGKRG-------------YSS
A0A3Q9ULZ9      RKA---------------MGDVLYGYGAGSFGYSSYNSYYTDKNGKKKRRKKKMSLEEDY
A0A3S9JFL2      KKA---------------MGDVLYGYGAGSFGYSSYNAYYTDENGKKKRRKKRMSLEEDY
A0A1Q2CI19      LRK----------------GDIGYGSG---YGYGYGETKGKAKGKR-------GGARAVA
A0A512T3M3      RSR----------------GH-GYGYG---YGYGESGRRRSEKPVD----H--RAQRGAF
W6JTW4          ASR----------------SR-SYGYG---YGYG-SPRSTSKKPRSGGHGP--RSAHGTS
A0A0A0JTY0      TKR----------------AD-AYGYG---YGDDRMSKRKAKRARKGARSRQSGPVGP--
A0A0A0JXF2      ARR----------------GD-AYGYG---YGETRKAKKKVKRERKLAEKR--GPVAPAT
E6S8H2          SKR----------------SA-GYGYG---YGYGYG------------YGD--KKKGKAR
A0A0A0JGH0      GRR----------------AD-GYGHS---YGYGDTARPQRDSPSPKMELD--PRQQPSA
N0E4U7          GRR----------------AD-GYGYG---YGHGDT-KKRKGARSARVEAD--RSLRPTR
A0A0A0IYK2      EKR----------------AD-AYGYG---YGENRQSKRKAKRARK-RAQS--RSARSAA
A0A0Q9L0H3      TMR----------------AD-AYGYG---YGENRQSKKKARRGRK-RQQL--RAAEPVA
A3TMK0          AKL----------------GD-TYGYG---YGDARKTKKKVKRGRRLADQR--RPAAPVV
A0A543PXP1      TE--------------------RSTYG---YGRGYGYGYGVSKQKR-GRSI--GGAQGAR
A3TMH6          TRG----------------AG-RYGYG---YGSGYGQGYDAERSKGIRRVL--PGRRGTT
A0A1H6WL79      TKG---------------QGDLNYGYY---GAYVSADESRDTIPPRSGMNPTSQPGHAGV
A0A101LAM5      TKG---------------PGDLNYGYY---GAYGSAEDLKDHQPPAPSTTTTSASRRS--
A0A4Y3NEG0      TNG---------------PGDVNYGYY---GAYGSAENPQDDTPPVPGTVLSAPAGAL--
A0A1H6YPK1      PVG-------------PRVKHYGYGNT---SPGLSSLGGAPAQHDEDDSWEHDEALRKVF
A0A2R7MGI0      LRG-----------PDSSYYGARYGGH---YGYGESHA-TGAEGIKRSTRRGARGVAAKS
A0A2T7WQY4      LRG-----------PDSSYYGARYGGA---YGYSEPDA-DTRKGAKRTRGRDRRPSSVMG
A0A1G6GTN3      VRG-----------VDSGYYGAQYGGY---YGYGAERS--STKAWWRFRRRGQTTPVAAA
A0A1N7DLV3      LRG-----------ADSNYYGSQYGGY---YGYGAPSSGVDRPRWWRRPWRRATVEKKDA
A0A1V2NSB5      LRG-----------ADSNYYGSQYGGY---YGYGAPGSGAERTRWWRRPWRRQVGDAGDA
A0A0Q5Q5L3      LRG-----------ADSGYYGMQYGGY---YGYGIGRT--EKSTWWRRVLRKSSTEPGAA
A0A0Q6DVM4      LRG-----------ADSGYYGMQYGGY---YGYGIGRT--EKSTWWRRVLRKSSTEPGAA
A0A1R3WWR6      LRG-----------VDSTYYGGRYGGY---YGYGAPRG--TTRSWWRFGRRPRTADSENT
A0A5Q2FA83      NDD----------------SASRYGGY---YAYGRSKKDKSKREAVASRHGSLEEAVPVT
A0A542FTE6      ERG----------------ADAQYYGY---YGQKAYYTPTQRPKVEDDAPPPQAPPIANT
A0A2S5UYV0      PRD----------------TADGYEYR---RNRSYYVTADKKGMPVFKSSKGHVDLLE--
A0A2S5X9U6      PRD----------------TADGYEYR---RNRSYYVTADKKGMPKFKAVKGHADPSEQF
A0A2S5ULV5      PRD----------------SADGYEYR---RNRSYYVTADKKGMPKFKAVKGHTDPSEHF
A0A653YMF0      PRD----------------SADGYEYR---RNRSYYVTADKKGMPKFKAVKGHTDPSEHF
A0A4V1VGV9      PKQMGSTIYG---YGAGNYGGATYGYG---YGSSE----DPSAATAPTPSPEVRDLTLTE
A0A3Q9IY80      RK-----------------GRGGY-HD---YRYAGDYYRSKGGEDGFDIDLTEDTAGTMV
A0A0F0LP73      MRN----------------SANGYGY----YRKNSHYYAQTSRNDDAAGDDEVAALISEA
A0A1F1X071      TGRLNRLAYGDAVYGYSAYGKYGYGAL---GGYDESAVVPDAEEVDVEQAGGPAEPGPAS
A0A3R8RWC7      TGRLNRLAYGDAVYGYSAYGKYGYGAL---GGYDESAVVPDSEEVDVEQAGGPAEPGPVS
A0A4U0RJZ4      PRSMGSTVYG---YGAGNYATAGYGYG---YGYGYGHTDESDEASALTPAHELADITLHA
A0A4R1FGL9      PRSMGSTVYG---YGAGNYATAGYGYG---YGYGYGHTDESDEASALTPAHELADITLHA
E3B8H1          PRSMGSTVYG---YGAGNYATAGYGYG---YGYGYGHTDESDEASALTPAHELADITLHA
A0A0Q5AWK6      AQD----------------GDTGY-YY---YDRKNSYYTQPQQAATENAAVGRS------
A0A3N1NLD3      AQD----------------GDAGYSYY---YDRKNPYYAEPDGGRSRGRSAGRRAAAEEP
A0A3N2FVI8      AQD----------------GDAGYSYY---YDRKNPYYAEPDGGRSRGRSTGRRAAAEEP
A0A2S5XDQ6      ARD----------------GDTGY-YY---YDRKNAYYAEPQPATGRKR-----------
A0A2S5XNN6      ARD----------------GDTGY-YY---YDRKNAYYAEPQPATGRKR-----------
A0A3L7ADK2      TSG---------------QDAHQYGY----YGGTYY------------------------
A0A6I2XCV4      AAD---------------MEGYYGYYGAGYYGSGYYGSGYY-------------------
A0A5R8VLL6      AK-------------------EFEGYSYY-------------------------------
A0A538JQF8      TSR---------------RVRSPYGR----------------------------------
A0A0Q5JKD6      LRG---------------ADSGYYGSQYGGYYGYGVPSSSPNGRWRLGLR----------
A0A0Q9TBP0      DSA---------------RATYSY------------------------------------
A0A346XTB0      SST---------------AGAYGYGYGVAE------------------------------
A0A0G3V3M7      HGA---------------RAGYYGYYGYYGYGYGYAHPGEVPKMSRL-------------
A0A6I3DD56      HGA---------------RAGYYGYYGYYGYGYGYAHPGEVPKMSRL-------------
A0A2W6DK08      GR----------------------------------------------------------
A0A2S0LQ32      RRS---------------MGSVYYGYGYGSYGHHYYYGERPRGWRRL----LPG------
A0A2N6V1R5      RRN---------------LGSVYYGYGYGGYGQNYYYYEEDEKRKLLGFIPLPGHRKRKR
G9PHS6          RRN---------------LGSVYYGYGYGGYGQNYYYYEEDEKRKLLGFIPLPGHRKRKR
U1PLM7          RRN---------------LGSVYYGYGYGGYGQNYYYYEEDEKRKLLGFIPLPGHRKRKR
A0A6I1G2U1      SR-----------------RSDGYGYGYG-------------------------------
A0A351ETF8      ES-----------------PDKYSYYGQY-------------------------------
A0A349B7N2      -----------------------VGSGDTPATKRYYYSK---------------------
A0A346Y185      LD-----------------GAGYGDYAYRY-GYSYAYGYGE-------------------
A0A259S8H9      LR-----------------GGD-NGYGYYRKNSRYYMKSHRAATAEDGDDAVDAFAAMAN
A0A0Q5L115      TK-----------------GRDAREYGYF--GGSYYYYEGD-------------------
A0A2W1Z497      TR-----------------GQDARDYGYY--GGAYYAGDDDGSEPAPGTD----------
A0A1H4I042      PRS---------------RS-------------------------AYGGAYYYYGDNRGS
A0A4R7A6D9      PRS---------------RS-------------------------AYGGAYYYYGDKRGS
A0A4Q4D4T1      KKE---------------TARYGYGYGYDD--------------------------GKGR
A0A261FE22      HER---------------SRKG-----------------------NYYYYEESETKAKKS
A0A5C8C085      ARD---------------AYTSAYYYSQDADPSAKKRPKADKEPKPKKGKKPAPDSFEPG
A0A1E4BP96      RRG---------------RPDYGYAYGSGAADTRPAFVPR--------------------
A0A101KZQ4      LKG---------------AQASNYGYAYKA----------------------YYRQDTKG
A0A439DNZ6      TRG---------------GASDNYSYYGYSYGD----------GTSNSAVATTPRMKVMR
A0A0J6YE86      TRG---------------TGSYSYNYGYYGEDEGRRGGNSSTRGGSAESSKTTSANASES
A0A5Q5BFU2      TRN---------------NASYSYGYYGYGEEA---TGQQARHGLPTETRVEKSSPSSAT
A0A151BT98      HFS------------------------------------------DDYGYGSKYGYGEQE
A0A2Y8ZRF8      SFS------------------------------------------DDYGYGHKYGYGEQP
A0A2R9UAT1      RSG---------------GG--YYDYRYTG---------------DYYQADQTPYDEAVH
A0A4Q5J5D7      RRD---------------AAAGYYGGTYELS--------------DKDKVPAAVGATDEA
A0A1Y4CKD6      QTA---------------GS---YGYGYGRYGYGKY---------GYGSYGDGYGGLADE
A0A0Q7KBQ4      RRA---------------GDVYGYGYGYG------------------YGQEQHEPIGEQA
A0A1F1IHY9      ASG---------------TAASAY---------------------QYYGATYYTASQQQD
A0A542HCT5      PKS---------------SSAGYYSGSYAA-------------------------LEEHS
A0A2S8WHZ8      TKG---------------AGAAQYGY-----------------------YGKYYYSNTEQ
A0A537WNY9      IGD---------------S--------------------------SYYHMGPEKTSMPRR
A0A5B8M469      VND---------------RDGGYSYYHNNR---------------SYYTRPESGKRRRDA
A0A1Y4CTD2      FQG---------------EWSLTHGRGYSAY-----------------------------
A0A0Q5M6Z7      PRG---------------IDSHDYGYYRSNYYTSNADESGEAQPVASIEAGGDTSVDGQA
A0A3N3ZPU0      RKG---------------SGANEYGYYSDA---------------YYYSSSSRH------
A0A359IQX7      LRG---------------IGAVVYGYGYG----------------TYTYSSKYYRYARDT
A0A4R8TXC3      RKG---------------LGNSYYGFGYAN---------------SYVGYATYYGYSKDG
A0A433EDP2      RKG---------------LGNSYYGFGYAN---------------SYVGYATYYGYSKDG
A0A231VTW0      RKG---------------LGNSYYGFGYAN---------------SYVGYATYYGYSKDG
A0A433ECD0      RKG---------------LGNSYYGFGYAN---------------SYVGYATYYGYSKDG
U7V3Z1          RKG---------------LGNSYYGFGYAN---------------SYVGYATYYGYSKDG
A0A1F1J417      RKG---------------LGNSYYGFGYAN---------------SYVGYASYYGYSKDG
A0A2A8D6P2      RKG---------------LGNSYYGFGYAN---------------SYVGYASYYGYSKDG
A0A1F0THV9      RKG---------------LGNSYYGFGYAN---------------SYVGYASYYGYSKDG
A0A5F0M6Y0      RKG---------------LGNSYYGFGYAN---------------SYVGYASYYGYSKDG
D8USQ4          RKG---------------LGNSYYGFGYAN---------------SYVGYASYYGYSKDG
E3H5W1          RKG---------------LGNSYYGFGYAN---------------SYVGYASYYGYSKDG
A0A1F1QKB0      RKG---------------LGNSYYGFGYAN---------------SYVGYASYYGYSKDG
A0A509JY23      RKG---------------LGNSYYGFGYAN---------------SYVGYASYYGYSKDG
A0A448USF4      RKG---------------LGNSYYGFGYAN---------------SYVGYASYYGYSKDG
A0A0Q9LZR0      PKS---------------SSAGYYSGNYGP-----------------------LQETPQR
A0A1N7E3F1      AKH---------------GSY--YGYGYG------------------------YEADPVE
A0A544ZKQ1      AKH---------------GSYYGYGYGYG------------------------YGYDSAA
A0A372P1T1      AKH---------------GSYYGYGYGYG------------------------YGYDAAA
A0A5D0Q2X0      AKH---------------GSY--YGYGYG------------------------YGYDAAA
A0A5R8Z2E7      AKH---------------GSY--YGYGYG------------------------YGYDAAA
A0A1L2ZMV4      RKG---------------SSAGQYGYYSDS---------------YYYTSTDGQRTRRQS
A0A6I3F378      RKH---------------TRYGYGAYGYDASK----------------------------
A0A1S1CAD0      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKEG
G5ET14          RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKEG
A0A1E9DXX2      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKEG
A0A1E8S156      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKEG
A0A1E8S5S2      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKEG
A0A1S1DFA8      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKEG
A0A2I1Z490      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKEG
A0A1F0DAA9      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKEG
A0A1F0PHK9      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKEG
A0A1F0VZG6      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKEG
A0A1E9G8X4      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKDG
A0A1E9IAW2      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKDG
A0A1E9ZBC9      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKDG
A0A1E9ZDP4      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKDG
A0A1F0R6B5      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKDG
A0A1F0Z7N5      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKDG
A0A1F1D897      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKDG
D2NP38          RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKDG
A0A1F1FV74      RKG---------------LGNSYYGFGYAS---------------TYVGYATYYGYGKDG
A0A1E9M791      RKG---------------LGNSYYGFGYAS---------------TYVGYATYYGYGKDG
A0A291DEI8      RKG---------------LGNSYYGFGYAS---------------TYVGYATYYGYGKDG
A0A1S1D5T1      RKG---------------LGNSYYGFGYAS---------------SYVGYSTYYGYGKDG
A0A1E8TRD6      RKG---------------LGNSYYGFGYAS---------------SYVGYSTYYGYSKDG
A0A1F0XT88      RKG---------------LGNSYYGFGYAS---------------SYVGYSTYYGYSKDG
A0A1F1EVP5      RKG---------------LGNSYYGFGYAS---------------SYVGYSTYYGYSKDG
C6R548          RKG---------------LGNSYYGFGYAS---------------SYVGYSTYYGYGKDG
A0A0K2RXS2      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYSKDG
A0A1F0KX60      RKG---------------LGNSYYGFGYAS---------------AYVGYATYYGYGKEG
A0A542I3V2      TKG---------------VDSYAYY--------------------GAYTAAPEAASSGSA
A0A2T0UZ65      KRG---------------MGSVMYGDGYSTYYSHGSY--------EYYKSGPKKGRRRAA
A0A1R4JTI6      TRG---------------KEAGYYGYYGK----------------SYYSSSATPDQDFDV
A0A4R7TM52      VRG---------------RGKGYDEYRYSG---------------DYYAAPAATTVPLDS
A0A542XE74      KRS---------------LTDSAYS-----YTGYTGYYK------DYYAAAEPEQQSPER
A0A0G3V3F3      VVN---------------RSAYYEA-----------------------------------
A0A0Q7QDF6      KKE---------------TARYGYGYGYD--------------------------DGKGR
A0A3S0V9U6      AKG---------------IGSQYYGFGYGGYRSEYK---------SYYGRSGQGSESAGT
A0A5R8L819      KRG---------------GG--YYGGHYGR---------------EYYASAEVQAVSAVP
A0A261FQA1      EQR---------------GKG------------------------DYYYSDKAAKHSSQG
A0A1Q2CJ92      KKD---------------LGEATFGYGYGSYTS------------KYYRTDEAQKPHRRE
A0A2T0S3C8      AKG---------------PEGYYY---------------------EQYGMTSQHRRGAWR
A0A4Y8WZJ3      ASG---------------TAASAY---------------------QYYGATYYTASQQQD
A0A285VUW0      AER---------------SGSYNY---------------------QYYGRETPVTAGETR
A0A2R7Z032      LKG---------------VGAIAYGDGYG-YGGYGA-QA------EYASREAYSTAGKGK
A0A1I0W453      VKG---------------ASAIAYGGGYGGYGGYGGYRA------EYTSREAYSTAGKGR
A0A1H4LCS9      IKG---------------AAAIAYGGGYGGYGGYGGYKS------EYASREAYSTAGKGR
A0A4Q2RZP8      VKG---------------AAAIAYGGGYGGYGGYGGYKA------EYASREAYSTAGKGR
A0A0Q6VV12      VKG---------------ASAIAYGGGYSGYGGYGGYRA------EEATREAYSTAGKGR
A0A495NTA9      VKG---------------ATAIAY-GGYGGYGGYGGYKA------EEETREKYSTAGKG-
A0A0Q9QB08      VKG---------------AASIAYGGGYGTYGGYGGYEA------DDTSREADATAGGGR
A0A4Q2SA86      VKG---------------AAAIAYGGG---YGGYGGYQA------EYASQEADATAGKGW
A0A4Z1C3Z0      VKG---------------AAAIAYGGG---YGGYGGYQA------EYASLEAESSAGKGW
A0A4Q2JUT1      IRG---------------ADAATYSYEYR----------------RDYTSSGSEGTTEAS
A0A542J310      MRG---------------TDSATYSYEYR----------------HDYTTPATEVTPAV-
A0A444BL03      KRR---------------AGGVMYGYGYGGYASYASDTKTRKDYAKAASRGKHAE-----
A0A4Y8X357      ASG---------------VGSDYYGGGLGSHED------------EYHAYYRAPAESRKA
R4LD52          AKG---------------PDAY-----------------------HYYDEYSTRGRGSRR
A0A4T2CD79      TKG---------------AGGRGYGYYHGSYS-------------EDAPVVGALIANGRL
A0A2N3YJR1      KGR---------------AGAVMYGYGYGGYATYASDTKSRRDYEKAS------------
A0A6G8FYB9      QRK---------------VGGVVYG-GY-GYSSYSSDYASRKAYDTAPVAESDVVEPVVP
A0A4Q4D742      RRA---------------SD-------------------------DAYGYGYGHGYGYGS
A0A4Q2RU39      VKG---------------ANAIVYG---GGYGGYGGGYKSEYKSVEVYSTAGKGRRRKPA
A0A4Q2SK58      IKG---------------ANAIVYGGGYGGYGGYGGGYKSEYKSREAYSTAGKGRRRREA
A0A1C6T1J1      VPK---------------A--------------------------DAYQYEAYRVVAGLG
A0A2W2CFC8      LAK---------------A--------------------------EAYQYEAYQVL----
A0A2W2A4B0      SRG---------------A-------------------------RDAYAVYGADVPPETQ
A0A4Y9MDA5      REA------------------------------------------DVYGYAADAAAEARR
A0A1H7N9P7      REA------------------------------------------EVYGYAADVVAGTDR
A0A1M7V0F8      RDE------------------------------------------DVYGYAAEAQPPA-R
A0A022KX11      SKG-------------SDYRYGYHRYEEEM------------------------------
A0A4Q5A868      ESK-------------KSLEYSNYYYYYSD------------------------------
A0A345NSU7      AQP-------------S----AYYSYYGGE------------------------------
A0A0W8I9Y2      -PT-------------TGADAGYYGYYGKS------------------------------
A0A4Y5YMQ6      EQK-------------K----EKYLYTMEP------------------------------
A0A255G8R8      RKE-------------RGDAYGYYAYGSEP------------------------------
A0A6G7Y423      SPE-------------KGQE-AYYGRDHRPAGPGAAGARRARRRRLTYRRGGPSRPSRIR
A0A2N4T4Q5      TTG-----------------ADAGFYGYYGKSYYASDDSGGDAPEAPLRPAKEVPDAGTA
A0A1M3LEY6      TRG-----------------PDAYGYGRYGYGAYGYGYGYGRTAQAGFSQIISPAESPGR
A0A538AJI7      ESS-----------------VPYYY-----------------------------------
A0A538AM15      HAP-----------------ASFYGYYGY---------------YGGAPQTAQTSPNGHD
A0A1V8PLV6      ERK---------------VSANGNYYYYYDEGGKKSRKKSKHKS----------------
A0A4R0U4F1      TEK---------------PQ--KGGYYYYGDESDDNGRKRQIQHKKSEKMKKD-------
A0A357ZCV8      SVA---------------SESYYAYYSADGKRVKDRPAADAASQL---------------
A0A4R1CW45      GGM---------------LDSYGYGSANYDSYYSE-------------------------
A0A4R5Z7B0      VKS---------------ND----YYYYYGAK----------------------------
A0A419GS64      IDK---------------DARPYQY-----------------------------------
A0A2V2CXY5      MNS---------------KSNMYYHRYYRSSYYYNSYGSRSQKQK---------------
A0A2S8MDM2      TRG---------------SSSYGYSYSYYGTETPRHAPP---------------------
A0A357ZDL3      RAS---------------ADSYYAYYTVTGHRVRDKYNEDGAYEFLGGEQESVKVEGLSA
A0A4Y8ZIU8      ASG---------------VGSDYYGGGYASKGDDYHAYYQAPRDAESRSAGETTPEAGAG
A0A0F0KYJ9      RRG---------------SGAAYYGYQYHGDYYRNDGQELPTGTVRGDNANIYAKSK---
A0A538BBM6      AQD---------------SG---YSYGYYGYGEPEPNGERPAGE----------------
A0A1I6GVG4      RRG---------------SGAAYYGYQYHGDYYRSDEQELPSGTVRGDS--------PRR
A0A1I6IST1      RRG---------------SGAAYYGYQYHGDYYRSDEQELPSGTVRGDSLAPTRPRMPRR
A0A412JBM5      MKA---------------TK--YSYRYKYEDKYGGAKDYGYGYGYGYGNSGHRRQARGRS
A0A510HHA8      GGR---------------GG--YAYHQGYTR-----------------------------
A0A6G8Q9J3      DSG---------------EG--YPL-AGYASG----------------------------
A0A1C2B334      DRA---------------GA--YHNTYYGDTDTPRMASQRSRSHDIAQVGLRR-------
R7Y679          LKA---------------RD--NRYGYYAQASREGVTA----------------------
A0A5Q2F9A3      GKD---------------VG--YSAYRNRSGQGPEPRRVARRAAGEEPADRQRVIA----
A0A4R1BMZ2      GGK---------------GG--YYRYGYGGYTYK--------------------------
A0A023X491      PAR---------------NG--T----YGGYTYSYGEAAGS-------------------
A0A6G8QDQ0      GGQ---------------KG--L----YSAYSY---------------------------
A0A0K8Q3D9      TKG---------------TD--AYAY--HGTYTS-----------------AVAPSVLGE
A0A2R7RCA1      TKG---------------TD--AYSY--YGTYTS-----------------APTSA----
A0A1Q7WJN6      S---------------------------GGDYRQYSYYLAGYEVADEDELREPAQSLLRD
A0A6D1QMN1      VEK---------------SN--YYYYYTEGN-----------------------------
A0A1E2SNF6      RRG---------------AD--AVNYGYYGAKYGYGYYHDASLTAGPEAAPAPAATPVPT
Q6ADE8          RRG---------------AD--AVNYGYYGAKYGYGYYHDASLTAGPEAAPAPAATPVPT
A0A1Q7CZ24      TRR---------------SS--YYDVY-AGSSRG--------------ARGRGAWSRA--
A0A2W6VLC6      TRG---------------PD--AYGYG-YGSYGTYS-----------ASVPDTGWSVSHA
A0A519G798      KRG---------------GK--GYGYG-YGYGYGYG-----------PDKPRN-------
A0A519GXS6      VS-----------------RRDSYYYTSDR------------------------------
A0A520EHH5      ATG---------------RGRDQYGYDFEPGRVPTPPTQSAPVRTNRH------------
                                                                            

A0A538BYZ4      QRSRRGP-----------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      VRDSAER-----------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A1Q2CRV2      KRRARAEVAA--------------------------------------------------
A0A2S5WZJ5      VQTDASAAQTPQPTFAAVAPAAAPARESLAPTRPSASSAPRATPAASQPTPPPQTPGSEL
K6WHS4          VNVENNA-------------------DDMSVDKVGTSSAS--------------------
A0A1L2ZMQ6      PASVASRSRHNEGTRGTSSQSMTVTKPAPDNFDEIVF-----------------------
A0A3L8NYD3      RMRRREEREQAQREQTLRERTAARENEHGQPPVELTSIAGKRRSS---------------
A0A1M6K628      -----GARQGRGRSQSTPRPRRVAADDQRVEVVDASADAVVMEPASTQL-----------
A0A561E8R3      -----PPATPAAPTATMGTQPATAGDNITDQELGLSRRDRRSKQGK--------------
A0A3E2DN22      YGSEEQESRESIAVVQEAQ--------------PAEGLVRVPKKDRADTDTEITP-----
A0A3Q9ULZ9      FGAVEPAPLGSHPTQDQPSSEGEQEDATSGGSQPSRAVRTNGSDT-DQIPAGLRPVGP--
A0A3S9JFL2      FGRVELAPVNSRPTEDEPT--------------PSRVTSSSASRSQENRPADLTPVGP--
A0A1Q2CI19      --------------------------------------------------DEKPEASLV-
A0A512T3M3      DPAADEDGQSSDIDT--------HG-------------------------SSGPRSAA--
W6JTW4          ASRRDRLGRAEAPSTIRGGGEARHD-------------------------AAGPRPAV--
A0A0A0JTY0      ------------------------------------------------------PTGHMG
A0A0A0JXF2      PSTSSRPTTGPAEETRSRDAV-----------------------------GTADPTTTVD
E6S8H2          KRLPSSAVQGPPELSE----------------------------------ERVPESRS--
A0A0A0JGH0      PSVAVPQHASAPEVDR----------------------------------WSLPPRVD--
N0E4U7          ADAST-QFAGSEDGAR----------------------------------PFSPQADG--
A0A0A0IYK2      EQETTFVDSRTPGASPVHSAESRDTSRNPEDAPDDLQLDVTPGGEVPTATDEAHAATR--
A0A0Q9L0H3      --------------------------------------------------DELHPPTT--
A3TMK0          --------------------------------------------------TESEPDDF--
A0A543PXP1      --------------------------------------------------AKRPAHDV--
A3TMH6          DG------------------------------------------------SSTPPHPA--
A0A1H6WL79      SVDGNGFEAHSPWQGPAKAAEITSQAMLSGLGHAIAGPSNSLTNSSDTPSFLAPESQW--
A0A101LAM5      ---------------------------------PDADAVNPVPDIREASPFLGSVSTW--
A0A4Y3NEG0      ---------------------------------AD-NPATPLPEPREASTFLAPDSPW--
A0A1H6YPK1      PEDVLHRADDVPVLAERDDELVFGQAPEGAEKGPGGHESIDETHSEERPPGEISFGHS--
A0A2R7MGI0      GPAETGPRRRSNAAPDDARAL----------------HAGE-------------------
A0A2T7WQY4      APGATGPRRRSGTASDDARVG----------------ASGE-------------------
A0A1G6GTN3      EDREAGSRTQPADPPPENVSGLRTLAPVTTPAVPGGEVTDEITVPATSGETAAGTLP---
A0A1N7DLV3      GEQAPGPRRRSAELPPSNVRGLRTLAPGRKGSPVPGDSGGE-GVVPVAAPAADVPDD---
A0A1V2NSB5      GASAPGPRRRSAELPPSNVSGLRTLSARRNPVAASGDFTGE-GAVAVAPPAAVVADE---
A0A0Q5Q5L3      EEH--GKRRTSADLPAENVSALRPLSHRRTKDRDAGEATSEVEVVRTSEPPVDAGAP---
A0A0Q6DVM4      EEH--GKRRTSADLPAENVSALRPLSHRRTKDRDAGEATSEVEVVRTSEPPVDAGAP---
A0A1R3WWR6      TDT--GPRRQSADPPPENVRGLRTLSHGRTSASNQDDSSGE-NVASVTTAPSPVGRR---
A0A5Q2FA83      SAAIPGSPSGTEQDEETVRAARTALSSLFTEDPDDTQFSMPAITSEPVTQGTPLAAPA--
A0A542FTE6      TNLRPEDLP------------------------------------RRTRRNPPTIAPS--
A0A2S5UYV0      -PQPEKNASAAISLAPRPNSQSSEQPPQAVVAQQQ----------APASETPSDLSST--
A0A2S5X9U6      RAQNDAVPAQRESLAP----SQPAQVRSAPVVPAQ----------LETQSAEP-------
A0A2S5ULV5      GAQPDVAAPQRESLSP----SRPAQPAAEQAAPSQ----------PQAGPVPSSAPTA--
A0A653YMF0      GAQPDVVAPQRESLSP----SRPSQPATGQAVPEQ----------AQAAPVQASAPTA--
A0A4V1VGV9      GRSSADLPGKEDAARLRQPAPQAPTPPEPATAVRAPSAPSRAGASEASGPNVAPHGRQ--
A0A3Q9IY80      SAGAPGAASTPSPSSATRPASG-----------------------VTGSPAATGTATP--
A0A0F0LP73      ELSPAAFDGEPPAPEESGAEDEGASRERRASRSRTVSDDAASSRATHARPRIAQTGQR--
A0A1F1X071      APA---------------------------EPGPVVEP------------DGHEPEGD--
A0A3R8RWC7      APAAAVAAPDAPRPADTEAPRRAAQASPRPEAQPVAHPARAADESAPVEHDENEPEGD--
A0A4U0RJZ4      PESSPAAGPQADRGNAGAPFDTTRHDPMRGASSEAPSASAN----VECAPREATPATS--
A0A4R1FGL9      PESTPAAGPQVDRGNAGVPLDTTRHDPMRGESSQAPSASAN----VERAPRQATPATS--
E3B8H1          PESTPAAGPQVDRGNAGVPLDTTRHDPMRGESSQAPSASAN----VERAPRQATPATS--
A0A0Q5AWK6      ---------------------------------------------ARRSPRTQALEPV--
A0A3N1NLD3      ARSLPAVRPAEPARAVEPERT------------------------RAAEPERTRVAEP--
A0A3N2FVI8      ARSLPAVRPAEPARAVEPERTRAAEPERAAEPERAAEPERAAEPERAAEPERTRVTEP--
A0A2S5XDQ6      ---------------------------------------------AAAAPRRSELAPV--
A0A2S5XNN6      ---------------------------------------------AAAAPRRSELAPV--
A0A3L7ADK2      ------------------------------------------------------------
A0A6I2XCV4      ----------------------------------------------------GSGYYGSG
A0A5R8VLL6      ------------------------------------------------------------
A0A538JQF8      ------------------------------------------PPQYQLNLPSWKSPAGGG
A0A0Q5JKD6      ------------------------------------------RRGKKAEVVDAEQEATPR
A0A0Q9TBP0      --------------------------------------TSRERAVTGTDAAPDSAPTRAG
A0A346XTB0      ------------------------------------------------------------
A0A0G3V3M7      ------------------------------------------------------------
A0A6I3DD56      ------------------------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      -------------------------GRRHTRHQEPAETQEHVPAAS--------------
A0A2N6V1R5      ENQIVSIQEEEVHPLPKDKQSNRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAAS
G9PHS6          ENQIVSIQEEEVHPLPKDKQSNRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAAS
U1PLM7          ENQIVSIQEEEVHPLPKDKQS-RRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAAS
A0A6I1G2U1      ------------------------------------------------------------
A0A351ETF8      ------------------------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A346Y185      ------------------------------------------------------------
A0A259S8H9      LSPAPLGDAAATAEAPRDGGATVEEGTFTTSSGPADIITDGDAADAGEEASPAIVRPHGS
A0A0Q5L115      --------------VGTGGAVGAGAGSGTAPA----------SREAVTAPAPVV------
A0A2W1Z497      ----------GGAEHGTDGDAEARAARGARPSGGSRLTPSLPDRDASVPRSPVV------
A0A1H4I042      NSRHSRKT----------------------------------------------------
A0A4R7A6D9      NSRHSHKT----------------------------------------------------
A0A4Q4D4T1      RRR---------------------------------------------------------
A0A261FE22      SKRSSRKASASAPATQARPQVQAQAPRSARTAVSGK------------------------
A0A5C8C085      PGPEPSDQTDNGPDDRPGRRVASWSN----------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A101KZQ4      RRSAVANPVANDEA----------------------------------------------
A0A439DNZ6      RLRRYRPAYQSPGTDPASENEN--------------------------------------
A0A0J6YE86      RDRSAGDLPARPVTQRRYKTT---------------------------------------
A0A5Q5BFU2      SAQGDSEVAEPAGTRQTRETD---------------------------------------
A0A151BT98      MAASGRTRSRRSDKRG--------------------------------------------
A0A2Y8ZRF8      PAARG--QSRRTGKRG--------------------------------------------
A0A2R9UAT1      NPPNNVDGITRPVVETQPAATGDPQDQLAPLRRTRRRAG---------------------
A0A4Q5J5D7      DATEVSSKHRRRTA----------------------------------------------
A0A1Y4CKD6      VDEGVKPVVEPEIVEEEVVPPRGKHFRV--------------------------------
A0A0Q7KBQ4      RRMVGALGRGESRSSSGRRVSR--------------------------------------
A0A1F1IHY9      VAGRS-------------------------------------------------------
A0A542HCT5      KQQQTHEPAGR-------------------------------------------------
A0A2S8WHZ8      DPKADAKPSRRLQDPVPVDQPVISSNRFGEIPGLGAHAGSSEPEFRRLRRRR--------
A0A537WNY9      GRRSSERLASRR------------------------------------------------
A0A5B8M469      AKKVTPVPAPHEVASPATAAQARATAAAGRSGMPQARLVEPQMPAPVAPAPAAPTPVTSP
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      NEQRSRRASRS-------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      AQQRGRRAGKPKADRPARAK----------------------------------------
A0A4R8TXC3      TKKKVKSRKKAKK-----------------------------------------------
A0A433EDP2      TKKKVKSRKKAKK-----------------------------------------------
A0A231VTW0      TKKKVKSRKKAKK-----------------------------------------------
A0A433ECD0      TKKKVKSRKKAKK-----------------------------------------------
U7V3Z1          TKKKVKSRKKAKK-----------------------------------------------
A0A1F1J417      KKKVSSGAHGA-------------------------------------------------
A0A2A8D6P2      KKKVSSGAHGA-------------------------------------------------
A0A1F0THV9      KKKVSSGAHGA-------------------------------------------------
A0A5F0M6Y0      KKKVSSGAHGA-------------------------------------------------
D8USQ4          KKKVSSGAHGA-------------------------------------------------
E3H5W1          KKKVSSGAHGA-------------------------------------------------
A0A1F1QKB0      KKKVSSGAHGA-------------------------------------------------
A0A509JY23      KKKVSSGAHGA-------------------------------------------------
A0A448USF4      KKKVSSGAHGA-------------------------------------------------
A0A0Q9LZR0      AVRSEAGTAATR------------------------------------------------
A0A1N7E3F1      QETSSRTPQPQTPMPV--------------------------------------------
A0A544ZKQ1      QETVSETPQPQAPMPV--------------------------------------------
A0A372P1T1      QEATPETPQPQAPIPV--------------------------------------------
A0A5D0Q2X0      QEATPETPQPQAPIPV--------------------------------------------
A0A5R8Z2E7      QEATPETPQPQAPIPV--------------------------------------------
A0A1L2ZMV4      GKRRAASSSSK-------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A1S1CAD0      DKKSSKKSSTKK------------------------------------------------
G5ET14          DKKSSKKSSTKK------------------------------------------------
A0A1E9DXX2      DKKSSKKSSAKK------------------------------------------------
A0A1E8S156      DKKSSKKSSTKK------------------------------------------------
A0A1E8S5S2      DKKSSKKSSTKK------------------------------------------------
A0A1S1DFA8      DKKSSKKSSTKK------------------------------------------------
A0A2I1Z490      DKKSSKKSSTKK------------------------------------------------
A0A1F0DAA9      DKKSSKKSSTKK------------------------------------------------
A0A1F0PHK9      DKKSSKKSSTKK------------------------------------------------
A0A1F0VZG6      DKKSSKKSSTKK------------------------------------------------
A0A1E9G8X4      DKKSSKKSSAKK------------------------------------------------
A0A1E9IAW2      DKKSSKKSSAKK------------------------------------------------
A0A1E9ZBC9      DKKSSKKSSAKK------------------------------------------------
A0A1E9ZDP4      DKKSSKKSSAKK------------------------------------------------
A0A1F0R6B5      DKKSSKKSSAKK------------------------------------------------
A0A1F0Z7N5      DKKSSKKSSAKK------------------------------------------------
A0A1F1D897      DKKSSKKSSAKK------------------------------------------------
D2NP38          DKKSSKKSSAKK------------------------------------------------
A0A1F1FV74      DKKSSKKSSAKK------------------------------------------------
A0A1E9M791      DKKSSKKSSAKK------------------------------------------------
A0A291DEI8      DKKSSKKSSAKK------------------------------------------------
A0A1S1D5T1      DKKSSKKSSAKK------------------------------------------------
A0A1E8TRD6      DKKSSKKSSAKK------------------------------------------------
A0A1F0XT88      DKKSSKKSSAKK------------------------------------------------
A0A1F1EVP5      DKKSSKKSSAKK------------------------------------------------
C6R548          DKKSSKKSSAKK------------------------------------------------
A0A0K2RXS2      DKKSSKKSSTKK------------------------------------------------
A0A1F0KX60      DKKSSKKSSTKK------------------------------------------------
A0A542I3V2      DRDVERDRPGTEKDGAEI------------------------------------------
A0A2T0UZ65      KKAKDRVGAGRRG-----------------------------------------------
A0A1R4JTI6      TSRNAGSTRE--------------------------------------------------
A0A4R7TM52      PGAAASPSVTEGEPRVLADQPSRRSRRTSALSQD--------------------------
A0A542XE74      SRADDVEDAEPTSSRAARKRRRSKNTVG--------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      RRR---------------------------------------------------------
A0A3S0V9U6      KK----------------------------------------------------------
A0A5R8L819      AVTPAAGDNPADGQGLRRRSRRSA------------------------------------
A0A261FQA1      TSEKSHEPTEKAEQ----------------------------------------------
A0A1Q2CJ92      RARRVTKLVETDDQAAELAEPRRPVA----------------------------------
A0A2T0S3C8      DRMRAPATTELRDLMACGEPESAPERRLDEPIGSGR------------------------
A0A4Y8WZJ3      VAGRS-------------------------------------------------------
A0A285VUW0      GSRRQSGGARRLARRKGARAARR-------------------------------------
A0A2R7Z032      RRSK--------------------------------------------------------
A0A1I0W453      RRKEAKAKAAKVDKVEKVDTAEKPSASEKAGTS---------------------------
A0A1H4LCS9      RKLLKVGKKD--------------------------------------------------
A0A4Q2RZP8      RKLTKLGRKS--------------------------------------------------
A0A0Q6VV12      RRKLVRSSSDKA------------------------------------------------
A0A495NTA9      RRKLVKSLKG--------------------------------------------------
A0A0Q9QB08      RRKHPKKAAKNAAKKDAE-------AEAQTEADAGV------------------------
A0A4Q2SA86      RKKADKGDKAADAEQAE--------AAAEAEKAARS------------------------
A0A4Z1C3Z0      RKKADKADKPDKADKPDKPAQAEQAEAGEAEKATRS------------------------
A0A4Q2JUT1      PETGKPDSKRRGRKRA-AKDAELVTEPPANERGSRD------------------------
A0A542J310      ------ESVRPGNVEAPAKDDELVPEAPRRG-GRRS------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      EAPLDGAGTDAAAEARGSTVAEERRG----------------------------------
R4LD52          AGPVAPVRVAVGRLPELMGAGRPGKERSKVGSAS--------------------------
A0A4T2CD79      TPTIPVTAAESADSTARAESTELKDPTAAL------------------------------
A0A2N3YJR1      ------------------RGRHGTD-----------------------------------
A0A6G8FYB9      AGPGVPVPVAKPASKVRRTAARKAD-----------------------------------
A0A4Q4D742      ALPQAVRPEQPEKSGDEASTLSRS------------------------------------
A0A4Q2RU39      KAEKAEKAEKSEKAGKS-------------------------------------------
A0A4Q2SK58      KVDKADTPVTPDKPARPVKAGRTSKR----------------------------------
A0A1C6T1J1      TPSVPADRATSGRHAEHAAAGVS-DRTQELTRLPR-------------------------
A0A2W2CFC8      SSSLPVDRATAGRHAEQTAADEPVDNAEELTRLSR-------------------------
A0A2W2A4B0      RSHRSAVPGSTSEVTP--------------------------------------------
A0A4Y9MDA5      PLPAARVPAPAAEPVGPVGVGARKK-----------------------------------
A0A1H7N9P7      PVPTAPAPLPAARSAEAADRPASRR-----------------------------------
A0A1M7V0F8      VGELPAVPVPAGRIGQL-------------------------------------------
A0A022KX11      --------------------------------------------------TRRARKAART
A0A4Q5A868      ------------------------------------------------------------
A0A345NSU7      --------------HASTRPDGPRKRKRRQGKRDKRMSKSRPHAEAAASARAERAVDGGE
A0A0W8I9Y2      --YYANSDDQPAPKTGAQPVVAAPAAKQPWGTAPRAESSDAHQPAGASTRQEPTVPSAED
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      --GRQRSSSAATGRRAA-----------PSGQRPDDLVL---------------------
A0A6G7Y423      PVGRSNTATAAPSRAAVSVVTAAARSTQPATPAPEGTSAARAAAITPAPTRTASRRAAGA
A0A2N4T4Q5      APASRAPDTGSTAALETESPADAAVSDLPADESERFDLAAWQRPGKGTHRA---------
A0A1M3LEY6      RQSSAVPPSGPARTTAQARQESV-------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      RGRLGRTVARVGHMLQRRRRGGR-------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      AVALDTAAPDPAADYVSLAGKGGKKKSKKSRRA---------------------------
A0A4Y8ZIU8      R-----------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      RGESEAA-----------------------------------------------------
A0A1I6IST1      ASKTRVGS----------------------------------------------------
A0A412JBM5      GQS---------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      DADLLQRDSDASGS-WVGENYEVDHAMIEEYVPPRRRVKS--------------------
A0A2R7RCA1      PGPVAEAEPDLTGPFWEGPGESVQ---VPESVSAGRRARG--------------------
A0A1Q7WJN6      PQ----------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      PAEPDAADRDATDPHSTSGSVPEPVPAEPANRGRRAARHG--------------------
Q6ADE8          PAEPDAADRDATDPHSTSGSVPEPVPAEPANRGRRAARHG--------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      AAEASAGVAGAARTESTAGREGTPHREAPFS-----------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A2S5WZJ5      PSRRSRRGA---------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ----------------------------RGTRAKRSDES---------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A3E2DN22      ---------------------------------RRAK-----------------------
A0A3Q9ULZ9      ----------------------------QPKPARRAR-----------------------
A0A3S9JFL2      ----------------------------RPRPARRAR-----------------------
A0A1Q2CI19      ------EPAEDV----------------QAQRSK--------------------------
A0A512T3M3      ------VPGSGA----------------RSPRANRATG----------------------
W6JTW4          ------VEASPD----------------DSV-SDRSGG----------------------
A0A0A0JTY0      DFF---DDAEQP----------------ESRRSRRTSSSA--------------------
A0A0A0JXF2      PVLGVDDDDVEP----------------DSRRTRRRASSL--------------------
E6S8H2          ------ARREAS----------------RKRSSRRTSSSA--------------------
A0A0A0JGH0      ------DPQDAA----------------PSRRSRHSSH----------------------
N0E4U7          ------APDDAA----------------LSRRARRTSSSA--------------------
A0A0A0IYK2      ------GEVGEE----------------RRRSRRRSSSSA--------------------
A0A0Q9L0H3      ------GDERPR----------------ESRHDRRTSSSL--------------------
A3TMK0          ------LDDASR----------------ESRRTRRASSA---------------------
A0A543PXP1      ------DSKSDP----------------DSRQTRRTSSSSL-------------------
A3TMH6          ------ESEPGA----------------ESRRDRRTTSA---------------------
A0A1H6WL79      ------RSPS------------------DG-RGRRSAPPS--------------------
A0A101LAM5      ------RAPQ------------------DGSRGRRSAPPS--------------------
A0A4Y3NEG0      ------RAPQ------------------DGSRGRRSAPPRQV------------------
A0A1H6YPK1      ------VDAVEV----------------AVSGRSAVRDTMHLRRLFRT------------
A0A2R7MGI0      -------------------------------VFRDLG-----------------------
A0A2T7WQY4      -------------------------------VRRSRG-----------------------
A0A1G6GTN3      ----------------------------R--RRTRRG-----------------------
A0A1N7DLV3      ----------------------------RTSRRRQRG-----------------------
A0A1V2NSB5      ----------------------------RTPRRRRRG-----------------------
A0A0Q5Q5L3      ----------------------------R--RRRTTP-----------------------
A0A0Q6DVM4      ----------------------------R--RRRTTP-----------------------
A0A1R3WWR6      ----------------------------R--QR---------------------------
A0A5Q2FA83      ------PASSPD--------ETIDAPSPALSRGRRFAE----------------------
A0A542FTE6      ------DEMNDA----------------PAERSHLA------------------------
A0A2S5UYV0      ------PEVQGA----------------PTRRSRRGA-----------------------
A0A2S5X9U6      -------VSEQP----------------QSRRSRRGA-----------------------
A0A2S5ULV5      ------VATEQP----------------QSRRSRRGA-----------------------
A0A653YMF0      ------VATEQP----------------QSRRSRRGA-----------------------
A0A4V1VGV9      ------SGEAPSPQG-------------PRTRRARRRADLGE------------------
A0A3Q9IY80      ------TVVATD----------------STRRSRRSKR----------------------
A0A0F0LP73      ------S---------------------TPVRARRAKDANDLDPDATA------------
A0A1F1X071      ------SAAAAR----------------TSPRGRRAASTWGR------------------
A0A3R8RWC7      ------SAPAAR----------------TSPRGRRAASTWGR------------------
A0A4U0RJZ4      ------GSDGAP----------------PSRRSRRFRANDDA------------------
A0A4R1FGL9      ------DSDGAP----------------PSRRARRFRANDDA------------------
E3B8H1          ------DSDGAP----------------PSRRARRFRANDDA------------------
A0A0Q5AWK6      ------ESRAER----------------PTASRRTLR-----------------------
A0A3N1NLD3      ------ERAVEPARSLEHVVRAAPKAEVPSSFRRPAR-----------------------
A0A3N2FVI8      ------ERAAEPARSLEHVVRAAPKAEVPSSFRRPAR-----------------------
A0A2S5XDQ6      ------ESRALP----------------PQTSRRAAR-----------------------
A0A2S5XNN6      ------ESRALP----------------PQTSRRAAR-----------------------
A0A3L7ADK2      -----ANEETPATTATAQPSDESTVVEGDSATPIAAATPLAAPEEATSRRTVRRSGH---
A0A6I2XCV4      YYSSGEGQPAQTGQPAQLGQRVRPTPVAPMDAPQTPTSTNGSAEGDAQS-----------
A0A5R8VLL6      -----SPEPDSLDSTSSPEKAAARDKTASPDKAARPQPANSRETRSPVSEVGRDKFSKSS
A0A538JQF8      IRRATKARSAKKAAKKSSARAPAKTGPDTTNASADEPVVHEAPAAGPGSRVSDGKPRLRW
A0A0Q5JKD6      RRSGGLPPENVSGLRTLSQRRMSATAEGEATSEIAVASTAEPDTVDTMSRRRARRG----
A0A0Q9TBP0      KDQAGDPVPSAGTPPPSGDTHHGSAPTGHRDTPPVAPAGHGDSRKTAVAEPGDDVA----
A0A346XTB0      -----DDDGQRRLLPGSRRRNGGNEGTRGSHRDADRDADRDADPDGEGA-----------
A0A0G3V3M7      -----FPWRKPTNGAGTVRRKPDPEQVGVSASNQGANSSSEAFDDPSF------------
A0A6I3DD56      -----FPWRKPTNGAGTVRRKPDPEQVGASASNQGAPASTEAFDDTSA------------
A0A2W6DK08      ------------SYRNLMSYSNGSRGSDRDARFAAVISANDRAHSDRHWRRAEMSELIWH
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      PRVSTVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTS
G9PHS6          PRVSTVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTS
U1PLM7          PRVSTVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTS
A0A6I1G2U1      -----SASEDPAAKASGRRGRRGARAAGDQPRPRTRREAKERAADGGLSSADLSSGSAED
A0A351ETF8      ----------------------AEQTAETADA----------------------------
A0A349B7N2      -----DPTSEPLPPPTDGQEQRGIESDELDALDAEGELPEVHPADR--------------
A0A346Y185      -----TPDDRRPQKEVKPRRRPGGRHREKATTK---------------------------
A0A259S8H9      NGRAAAARARRSVPPVEVAEPVGERVDGEDEAHDAAKPRYARRNARP-------------
A0A0Q5L115      -----APTPPAAPTPAPVPAPAGAAAAAAAAAAPGGEPAPARVPASPASPAAPTSPAVPA
A0A2W1Z497      -----SPYDPSLELPSRRSRRRAAAVGGTDDTRP--------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      SAGPVEPKPVDSQQESPWPFTELDLPDPSLSDQASDPSQLTSRRSGRRASGLPRGDQ---
A0A1Y4CTD2      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A4R8TXC3      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
D8USQ4          ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A6G8FYB9      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A022KX11      EPRAKQRARG--------------------------------------------------
A0A4Q5A868      ----SNKKRSKKGRFSLK------------------------------------------
A0A345NSU7      ALEFRSRARQRLDRRNGSG-----------------------------------------
A0A0W8I9Y2      AAPAPRAERSNGQGSAEHESFGLEAWGRSGSSTGSTAQGH--------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A255G8R8      ---TPRQARE--------------------------------------------------
A0A6G7Y423      PPPSPRRPRQYHSRTAVR------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
                                                                            

A0A538BYZ4      --------------------------------------
A0A348NU28      --------------------------------------
A0A4Q5APW3      --------------------------------------
A0A4Q5B0V3      --------------------------------------
A0A222TG79      --------------------------------------
A0A6I3DFP2      --------------------------------------
A0A1Q2CRV2      --------------------------------------
A0A2S5WZJ5      --------------------------------------
K6WHS4          --------------------------------------
A0A1L2ZMQ6      --------------------------------------
A0A3L8NYD3      --------------------------------------
A0A1M6K628      --------------------------------------
A0A561E8R3      --------------------------------------
A0A3E2DN22      --------------------------------------
A0A3Q9ULZ9      --------------------------------------
A0A3S9JFL2      --------------------------------------
A0A1Q2CI19      --------------------------------------
A0A512T3M3      --------------------------------------
W6JTW4          --------------------------------------
A0A0A0JTY0      --------------------------------------
A0A0A0JXF2      --------------------------------------
E6S8H2          --------------------------------------
A0A0A0JGH0      --------------------------------------
N0E4U7          --------------------------------------
A0A0A0IYK2      --------------------------------------
A0A0Q9L0H3      --------------------------------------
A3TMK0          --------------------------------------
A0A543PXP1      --------------------------------------
A3TMH6          --------------------------------------
A0A1H6WL79      --------------------------------------
A0A101LAM5      --------------------------------------
A0A4Y3NEG0      --------------------------------------
A0A1H6YPK1      --------------------------------------
A0A2R7MGI0      --------------------------------------
A0A2T7WQY4      --------------------------------------
A0A1G6GTN3      --------------------------------------
A0A1N7DLV3      --------------------------------------
A0A1V2NSB5      --------------------------------------
A0A0Q5Q5L3      --------------------------------------
A0A0Q6DVM4      --------------------------------------
A0A1R3WWR6      --------------------------------------
A0A5Q2FA83      --------------------------------------
A0A542FTE6      --------------------------------------
A0A2S5UYV0      --------------------------------------
A0A2S5X9U6      --------------------------------------
A0A2S5ULV5      --------------------------------------
A0A653YMF0      --------------------------------------
A0A4V1VGV9      --------------------------------------
A0A3Q9IY80      --------------------------------------
A0A0F0LP73      --------------------------------------
A0A1F1X071      --------------------------------------
A0A3R8RWC7      --------------------------------------
A0A4U0RJZ4      --------------------------------------
A0A4R1FGL9      --------------------------------------
E3B8H1          --------------------------------------
A0A0Q5AWK6      --------------------------------------
A0A3N1NLD3      --------------------------------------
A0A3N2FVI8      --------------------------------------
A0A2S5XDQ6      --------------------------------------
A0A2S5XNN6      --------------------------------------
A0A3L7ADK2      --------------------------------------
A0A6I2XCV4      --------------------------------------
A0A5R8VLL6      TSF-----------------------------------
A0A538JQF8      SWSAGAEDFLGREGPA----------------------
A0A0Q5JKD6      --------------------------------------
A0A0Q9TBP0      --------------------------------------
A0A346XTB0      --------------------------------------
A0A0G3V3M7      --------------------------------------
A0A6I3DD56      --------------------------------------
A0A2W6DK08      PSTPAPNGFLPERRP-----------------------
A0A2S0LQ32      --------------------------------------
A0A2N6V1R5      AAFGAPQASVPTRRSLRERRNG----------------
G9PHS6          AAFGAPQASVPTRRSLRERRNG----------------
U1PLM7          AAFGAPQASVPTRRSLRERRNG----------------
A0A6I1G2U1      AFDPYEGYDVRRDLATTDDSGDPPVLGQTRRQRRASSG
A0A351ETF8      --------------------------------------
A0A349B7N2      --------------------------------------
A0A346Y185      --------------------------------------
A0A259S8H9      --------------------------------------
A0A0Q5L115      SPVEAPGGALTRREIRERERTR----------------
A0A2W1Z497      --------------------------------------
A0A1H4I042      --------------------------------------
A0A4R7A6D9      --------------------------------------
A0A4Q4D4T1      --------------------------------------
A0A261FE22      --------------------------------------
A0A5C8C085      --------------------------------------
A0A1E4BP96      --------------------------------------
A0A101KZQ4      --------------------------------------
A0A439DNZ6      --------------------------------------
A0A0J6YE86      --------------------------------------
A0A5Q5BFU2      --------------------------------------
A0A151BT98      --------------------------------------
A0A2Y8ZRF8      --------------------------------------
A0A2R9UAT1      --------------------------------------
A0A4Q5J5D7      --------------------------------------
A0A1Y4CKD6      --------------------------------------
A0A0Q7KBQ4      --------------------------------------
A0A1F1IHY9      --------------------------------------
A0A542HCT5      --------------------------------------
A0A2S8WHZ8      --------------------------------------
A0A537WNY9      --------------------------------------
A0A5B8M469      --------------------------------------
A0A1Y4CTD2      --------------------------------------
A0A0Q5M6Z7      --------------------------------------
A0A3N3ZPU0      --------------------------------------
A0A359IQX7      --------------------------------------
A0A4R8TXC3      --------------------------------------
A0A433EDP2      --------------------------------------
A0A231VTW0      --------------------------------------
A0A433ECD0      --------------------------------------
U7V3Z1          --------------------------------------
A0A1F1J417      --------------------------------------
A0A2A8D6P2      --------------------------------------
A0A1F0THV9      --------------------------------------
A0A5F0M6Y0      --------------------------------------
D8USQ4          --------------------------------------
E3H5W1          --------------------------------------
A0A1F1QKB0      --------------------------------------
A0A509JY23      --------------------------------------
A0A448USF4      --------------------------------------
A0A0Q9LZR0      --------------------------------------
A0A1N7E3F1      --------------------------------------
A0A544ZKQ1      --------------------------------------
A0A372P1T1      --------------------------------------
A0A5D0Q2X0      --------------------------------------
A0A5R8Z2E7      --------------------------------------
A0A1L2ZMV4      --------------------------------------
A0A6I3F378      --------------------------------------
A0A1S1CAD0      --------------------------------------
G5ET14          --------------------------------------
A0A1E9DXX2      --------------------------------------
A0A1E8S156      --------------------------------------
A0A1E8S5S2      --------------------------------------
A0A1S1DFA8      --------------------------------------
A0A2I1Z490      --------------------------------------
A0A1F0DAA9      --------------------------------------
A0A1F0PHK9      --------------------------------------
A0A1F0VZG6      --------------------------------------
A0A1E9G8X4      --------------------------------------
A0A1E9IAW2      --------------------------------------
A0A1E9ZBC9      --------------------------------------
A0A1E9ZDP4      --------------------------------------
A0A1F0R6B5      --------------------------------------
A0A1F0Z7N5      --------------------------------------
A0A1F1D897      --------------------------------------
D2NP38          --------------------------------------
A0A1F1FV74      --------------------------------------
A0A1E9M791      --------------------------------------
A0A291DEI8      --------------------------------------
A0A1S1D5T1      --------------------------------------
A0A1E8TRD6      --------------------------------------
A0A1F0XT88      --------------------------------------
A0A1F1EVP5      --------------------------------------
C6R548          --------------------------------------
A0A0K2RXS2      --------------------------------------
A0A1F0KX60      --------------------------------------
A0A542I3V2      --------------------------------------
A0A2T0UZ65      --------------------------------------
A0A1R4JTI6      --------------------------------------
A0A4R7TM52      --------------------------------------
A0A542XE74      --------------------------------------
A0A0G3V3F3      --------------------------------------
A0A0Q7QDF6      --------------------------------------
A0A3S0V9U6      --------------------------------------
A0A5R8L819      --------------------------------------
A0A261FQA1      --------------------------------------
A0A1Q2CJ92      --------------------------------------
A0A2T0S3C8      --------------------------------------
A0A4Y8WZJ3      --------------------------------------
A0A285VUW0      --------------------------------------
A0A2R7Z032      --------------------------------------
A0A1I0W453      --------------------------------------
A0A1H4LCS9      --------------------------------------
A0A4Q2RZP8      --------------------------------------
A0A0Q6VV12      --------------------------------------
A0A495NTA9      --------------------------------------
A0A0Q9QB08      --------------------------------------
A0A4Q2SA86      --------------------------------------
A0A4Z1C3Z0      --------------------------------------
A0A4Q2JUT1      --------------------------------------
A0A542J310      --------------------------------------
A0A444BL03      --------------------------------------
A0A4Y8X357      --------------------------------------
R4LD52          --------------------------------------
A0A4T2CD79      --------------------------------------
A0A2N3YJR1      --------------------------------------
A0A6G8FYB9      --------------------------------------
A0A4Q4D742      --------------------------------------
A0A4Q2RU39      --------------------------------------
A0A4Q2SK58      --------------------------------------
A0A1C6T1J1      --------------------------------------
A0A2W2CFC8      --------------------------------------
A0A2W2A4B0      --------------------------------------
A0A4Y9MDA5      --------------------------------------
A0A1H7N9P7      --------------------------------------
A0A1M7V0F8      --------------------------------------
A0A022KX11      --------------------------------------
A0A4Q5A868      --------------------------------------
A0A345NSU7      --------------------------------------
A0A0W8I9Y2      --------------------------------------
A0A4Y5YMQ6      --------------------------------------
A0A255G8R8      --------------------------------------
A0A6G7Y423      --------------------------------------
A0A2N4T4Q5      --------------------------------------
A0A1M3LEY6      --------------------------------------
A0A538AJI7      --------------------------------------
A0A538AM15      --------------------------------------
A0A1V8PLV6      --------------------------------------
A0A4R0U4F1      --------------------------------------
A0A357ZCV8      --------------------------------------
A0A4R1CW45      --------------------------------------
A0A4R5Z7B0      --------------------------------------
A0A419GS64      --------------------------------------
A0A2V2CXY5      --------------------------------------
A0A2S8MDM2      --------------------------------------
A0A357ZDL3      --------------------------------------
A0A4Y8ZIU8      --------------------------------------
A0A0F0KYJ9      --------------------------------------
A0A538BBM6      --------------------------------------
A0A1I6GVG4      --------------------------------------
A0A1I6IST1      --------------------------------------
A0A412JBM5      --------------------------------------
A0A510HHA8      --------------------------------------
A0A6G8Q9J3      --------------------------------------
A0A1C2B334      --------------------------------------
R7Y679          --------------------------------------
A0A5Q2F9A3      --------------------------------------
A0A4R1BMZ2      --------------------------------------
A0A023X491      --------------------------------------
A0A6G8QDQ0      --------------------------------------
A0A0K8Q3D9      --------------------------------------
A0A2R7RCA1      --------------------------------------
A0A1Q7WJN6      --------------------------------------
A0A6D1QMN1      --------------------------------------
A0A1E2SNF6      --------------------------------------
Q6ADE8          --------------------------------------
A0A1Q7CZ24      --------------------------------------
A0A2W6VLC6      --------------------------------------
A0A519G798      --------------------------------------
A0A519GXS6      --------------------------------------
A0A520EHH5      --------------------------------------
                                                      

© 1998-2021Legal notice