BYKdb

Dataset for cluster orphancd of phylum actinobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

307 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A7K0NRJ7      -----------------------------------------------------------M
K6WHS4          ------------------------------------------------------------
A0A7K0NTR2      ------------------------------------------------------------
A0A1H6WL79      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A0A4Y3NEG0      ------------------------------------------------------------
A0A1Q2CI19      ------------------------------------------------------------
A0A512T3M3      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A839J1M0      ------------------------------------------------------------
A0A8A4Z8K4      ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A543PXP1      ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A6I2XCV4      ------------------------------------------------------------
A0A5R8VLL6      --MGPRHCLINREPGRRVACCRYPQFPHSSPRAPTSSRLYQTSTFGRVLAWQHAEAAPDT
A0A3L7ADK2      ------------------------------------------------------------
A0A538JQF8      ------------------------------------------------------------
A0A1H6YPK1      ------------------------------------------------------------
A0A0Q9TBP0      ------------------------------------------------------------
A0A0G3V3M7      ------------------------------------------------------------
A0A6I3DD56      ------------------------------------------------------------
A0A5Q2FA83      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A7W5GFA5      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A346XTB0      ------------------------------------------------------------
A0A542FTE6      ------------------------------------------------------------
A0A7Y9QM02      ------------------------------------------------------------
A0A6I1G2U1      ------------------------------------------------------------
A0A351ETF8      ------------------------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A6L5R0V7      MPASVASETIREASCSAECAETTRCSGSFDSLPLPMLAVSVIVGSARSSTRSIQWPRIRS
A0A2S0LQ32      ------------------------------------------------------------
A0A7T8DZN6      ------------------------------------------------------------
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A4V1VGV9      ------------------------------------------------------------
A0A2S5UYV0      ------------------------------------------------------------
A0A7W4UQ09      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A653YMF0      ------------------------------------------------------------
A0A7V9H755      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A346Y185      ------------------------------------------MEAVCLFCWQLWQGSQLE
A0A7W0HGW1      ------------------------------------------------------------
A0A259S8H9      ------------------------------------------------------------
A0A2W1Z497      ------------------------------------------------------------
A0A0Q5L115      ------------------------------------------------------------
A0A7G6YY64      ------------------------------------------------------------
A0A7J5B4S5      ------------------------------------------------------------
A0A852U976      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
A0A4U0RJZ4      ------------------------------------------------------------
A0A4R1FGL9      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A7D7WDT9      ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A6P1F176      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A7V9FXS6      ------------------------------------------------------------
A0A7W0PY69      ------------------------------------------------------------
A0A7W8YB99      ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A7W8TR75      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A7I7UD03      ------------------------------------------------------------
A0A7I7MI62      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      ------------------------------------------------------------
A0A7I9ZLK4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A7H2BCD6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A7T4T4U7      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A4R6Q3C6      ------------------------------------------------------------
A0A7T3CHP7      ------------------------------------------------------------
A0A7Y5U6C1      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A7W9IKV0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A7Z9A2N0      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
A0A7T9UPU8      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A838H0S5      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A7G6YA19      ------------------------------------------------------------
A0A853CXS3      ------------------------------------------------------------
A0A7W8YB56      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A7W8TSW5      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A7X7XPM3      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A7K0PFV4      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A7K0MUQ7      ------------------------------------------------------------
A0A7K0U619      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A810MDE3      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A7X0KT97      ------------------------------------------------------------
A0A853DGU7      ------------------------------------------------------------
A0A7Z0A2Z7      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A849PJI9      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A6J4MTQ2      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A7Y9H290      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A6V8KDX4      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A7V9PCQ0      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A6L6AM03      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A6G8FYB9      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A838JYQ6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A7V8X3I0      ------------------------------------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A838JNW7      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A7K0NRJ7      TPRDATTTPTAIAKAVGRSRLARLKPRSRGFWSRPTMSPDTTRGTEGLERRVSCPHMDLA
K6WHS4          ------------------------------------------------------------
A0A7K0NTR2      --------------------------------------------------------MRPA
A0A1H6WL79      -----------------------------------------MERTTQLLQDDKPQGMSGN
A0A101LAM5      --------------------------------------------------------MSGN
A0A4Y3NEG0      -----------------------------------------------MLQDDKPQGMSGN
A0A1Q2CI19      --------------------------------------------------------MSLK
A0A512T3M3      --------------------------------------------------------MTLR
W6JTW4          --------------------------------------------------------MPLR
A0A839J1M0      --------------------------------------------------------MSLH
A0A8A4Z8K4      --------------------------------------------------------MSLH
A0A0A0JTY0      --------------------------------------------------------MTLQ
A0A0A0JXF2      --------------------------------------------------------MTLQ
E6S8H2          --------------------------------------------------------MTLS
A0A0A0JGH0      --------------------------------------------------------MTLQ
N0E4U7          --------------------------------------------------------MTLR
A0A0A0IYK2      --------------------------------------------------------MTLQ
A0A0Q9L0H3      --------------------------------------------------------MTLQ
A3TMK0          --------------------------------------------------------MTLQ
A0A543PXP1      --------------------------------------------------------MTLK
A3TMH6          --------------------------------------------------------MTLN
A0A6I2XCV4      ------------------------------MSTPETPQDFSRANSSPNQPDLFGSSTALR
A0A5R8VLL6      GNHEKGEVMAEEEFFRTGPVAPGPFAMPAHSARQPAGGIGSLSNPEIGGSEASAAGMGVS
A0A3L7ADK2      ------------------------------------------MDAETNPDIVNDNDRSLR
A0A538JQF8      -----------------------------------------------------------M
A0A1H6YPK1      --------------------------------------------------------MEFR
A0A0Q9TBP0      ------------------------------------------------------------
A0A0G3V3M7      --------------------------------------------------------MRPA
A0A6I3DD56      --------------------------------------------------------MRPA
A0A5Q2FA83      --------------------------------------------------------MQFR
A0A2R7MGI0      ----------------------------------------------------------MQ
A0A2T7WQY4      --------------------------------------------------------MDMQ
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1N7DLV3      ----------------------------------------------------------MQ
A0A1V2NSB5      ----------------------------------------------------------MQ
A0A1R3WWR6      ----------------------------------------------------------MQ
A0A1G6GTN3      ----------------------------------------------------------MQ
A0A7W5GFA5      --------------------------------------------------------MDIQ
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A2W6DK08      --------------------------------------------------------MGIK
A0A346XTB0      ---------------------------------------------------MEEQLRRGP
A0A542FTE6      --------------------------------------------MASTVDEQITPTLDLR
A0A7Y9QM02      --------------------------------------------MASTVDEQVTPTLDLR
A0A6I1G2U1      ------------MGFVRDKPVHRVGIDSRVGGRSVDAAHERFEHELMGDARGADTTMNAR
A0A351ETF8      -----------------MSAAVVGVRPVNVAELQHVRGSFCMAEQPSNQDSSSLAVLDLR
A0A349B7N2      ------------------------------------------------------------
A0A4Q2JUT1      ----------------------------------MDPTRSWSTAPRMGRWHDPEVSMELR
A0A6L5R0V7      RTSSGTEASKSTRTTESRTRTSKAVDIPWTLLAHGSPHRGWN------RWHDPEVSMELR
A0A2S0LQ32      ------------------------------------------------------------
A0A7T8DZN6      ------------------------------------------------------------
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A4V1VGV9      --------------------------------------------------------MTAL
A0A2S5UYV0      --------------------------------------------------------MTVL
A0A7W4UQ09      --------------------------------------------------------MTVL
A0A2S5X9U6      --------------------------------------------------------MTVL
A0A2S5ULV5      --------------------------------------------------------MTVL
A0A653YMF0      --------------------------------------------------------MTVL
A0A7V9H755      --------------------------------------------------PYARPKTDIL
A0A3Q9IY80      --------------------------------------------------------MELR
A0A0F0LP73      --------------------------------------------------------MTVL
A0A346Y185      RTSRWRGGSSWGQRRKACGSSLRVVRVSAEVRGGVHLLEAHRSGRLNPMDSLQAPATSVE
A0A7W0HGW1      ------------------------------------------------------------
A0A259S8H9      ----------------------------------------------------------ML
A0A2W1Z497      --------------------------------------------MAPDARPDERTSRTLA
A0A0Q5L115      -------------------------------------------MDRPDTEPRPRTL-DLQ
A0A7G6YY64      -------------------------------------------MDRPDTEPRTRTL-DLQ
A0A7J5B4S5      --------------------------------------------------------MTVL
A0A852U976      --------------------------------------------------------MTVL
A0A1F1X071      --------------------------------------------------------MTIE
A0A3R8RWC7      --------------------------------------------------------MTIE
A0A4U0RJZ4      --------------------------------------------------------MTIL
A0A4R1FGL9      --------------------------------------------------------MTIL
E3B8H1          --------------------------------------------------------MTIL
A0A7D7WDT9      ----------------MRQHRVATSGLRYDGVVYERLRAQGQGAPLSVSSVRGFARVTVL
A0A0Q5AWK6      --------------------------------------------------------MTVV
A0A6P1F176      --------------------------------------------------------MTVV
A0A3N1NLD3      --------------------------------------------------------MTVV
A0A3N2FVI8      --------------------------------------------------------MTVV
A0A2S5XDQ6      --------------------------------------------------------MTVV
A0A2S5XNN6      --------------------------------------------------------MTVV
A0A5C8C085      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A7V9FXS6      -----------------------------------------MQRAYQDGARGGDAETGLP
A0A7W0PY69      -----------------------------------------------------MSEQALP
A0A7W8YB99      ------------------------------------------------------------
A0A1L2ZMQ6      ----------------------------------------------MPIDEDQRQGEGLR
A0A7W8TR75      ----------------------------------------------MPIDEDQRQGEGLR
A0A151BT98      --------------------------------------------------------MTIR
A0A2Y8ZRF8      --------------------------------------------------------MTIR
A0A2R9UAT1      ------------------------------------------------------------
A0A3E2DN22      --------------------------------------------------------MTIV
A0A3Q9ULZ9      --------------------------------------------------------MTVI
A0A3S9JFL2      --------------------------------------------------------MTVI
A0A3L8NYD3      ---------------------------------------------------MEAARVTVV
A0A1M6K628      ------------------------------------------MAIARRKPRTGRDILDLV
A0A561E8R3      --------------------------------------------------------MTVT
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ---------------------------------MNDRRYGLDLSPVRDEEQGLDMAELAS
A0A0Q7KBQ4      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A7I7UD03      ------------------------------------------------------------
A0A7I7MI62      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      ------------------------------------------------------------
A0A7I9ZLK4      ------------------------------------------------------------
A0A1F1IHY9      --------------------------------------------------------MSLS
A0A7H2BCD6      --------------------------------------------------------MTVL
A0A3S0V9U6      --------------------------------------------------------MTLL
A0A7T4T4U7      --------------------------------------------------------MTLL
A0A1S2N0P2      --------------------------------------------------------MTLL
A0A0Q3BEY5      --------------------------------------------------------MTLL
A0A4R6Q3C6      --------------------------------------------------------MTLL
A0A7T3CHP7      --------------------------------------------------------MTLL
A0A7Y5U6C1      ----------------------------------------------MDGLAGTPEAPSLR
A0A542HCT5      -----------------------MPQTNPKGAERPLASVLLHFALLGGALRGEFIGVELT
A0A537WNY9      --------------------------------------------------------MDLR
A0A5B8M469      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A1Y4CTD2      ---------------------------------------------------MVLDGVTVR
A0A3N3ZPU0      -------------------------------------MPQQDTSDEQYLDAPVHIAHRLR
A0A359IQX7      --------------------------------------------MLRVGTLETGRPMTLL
A0A7W9IKV0      --------------------------------------------------------MDLL
A0A1N7E3F1      --------------------------------------------------------MELL
A0A544ZKQ1      --------------------------------------------------------MELL
A0A5D0Q2X0      --------------------------------------------------------MELL
A0A5R8Z2E7      --------------------------------------------------------MELL
A0A0Q9LZR0      --------------------------------------------------------MELT
A0A1F1J417      --------------------------------------------------------MTIL
A0A2A8D6P2      --------------------------------------------------------MTIL
A0A1F0THV9      --------------------------------------------------------MTIL
A0A5F0M6Y0      --------------------------------------------------------MTIL
E3H5W1          --------------------------------------------------------MTIL
A0A1F1QKB0      --------------------------------------------------------MTIL
A0A509JY23      --------------------------------------------------------MTIL
A0A448USF4      --------------------------------------------------------MTIL
A0A7Z9A2N0      --------------------------------------------------------MTIL
A0A433EDP2      --------------------------------------------------------MTIL
A0A231VTW0      --------------------------------------------------------MTIL
A0A433ECD0      --------------------------------------------------------MTIL
A0A7T9UPU8      --------------------------------------------------------MTIL
U7V3Z1          --------------------------------------------------------MTIL
A0A6I3F378      ------------------------------------------------MEPQLTPARTLG
A0A838H0S5      -----------------------------------------------METRTVEEVGTGP
A0A1S1CQC5      --------------------------------------------------------MTIL
A0A1E9T6I0      --------------------------------------------------------MTIL
A0A1F1GHA7      --------------------------------------------------------MTIL
A0A1S1CAD0      --------------------------------------------------------MTIL
G5ET14          --------------------------------------------------------MTIL
A0A1E9DXX2      --------------------------------------------------------MTIL
A0A1E8S156      --------------------------------------------------------MTIL
A0A1E8S5S2      --------------------------------------------------------MTIL
A0A1S1DFA8      --------------------------------------------------------MTIL
A0A2I1Z490      --------------------------------------------------------MTIL
A0A1F0DAA9      --------------------------------------------------------MTIL
A0A1F0PHK9      --------------------------------------------------------MTIL
A0A1F0VZG6      --------------------------------------------------------MTIL
A0A1E9G8X4      --------------------------------------------------------MTIL
A0A1E9IAW2      --------------------------------------------------------MTIL
A0A1E9ZBC9      --------------------------------------------------------MTIL
A0A1E9ZDP4      --------------------------------------------------------MTIL
A0A1F0R6B5      --------------------------------------------------------MTIL
A0A1F0Z7N5      --------------------------------------------------------MTIL
A0A1F1D897      --------------------------------------------------------MTIL
D2NP38          --------------------------------------------------------MTIL
A0A1F1FV74      --------------------------------------------------------MTIL
A0A1E9M791      --------------------------------------------------------MTIL
A0A291DEI8      --------------------------------------------------------MTIL
A0A1S1D5T1      --------------------------------------------------------MTIL
A0A1E8TRD6      --------------------------------------------------------MTIL
A0A1F0XT88      --------------------------------------------------------MTIL
A0A1F1EVP5      --------------------------------------------------------MTIL
C6R548          --------------------------------------------------------MTIL
A0A0K2RXS2      --------------------------------------------------------MTIL
A0A1F0KX60      --------------------------------------------------------MTIL
A0A542I3V2      -----------------------------------------MTGKHEVNSDESAAGMGVR
A0A2T0UZ65      --------------------------------------------------------MTFL
A0A0Q5M6Z7      ----------------------------------------------------------MR
A0A7G6YA19      ------------------------------------------MTTPTDNTENQSKGRDLR
A0A853CXS3      ------------------------------------------MSLQTDTADTQAKGRDLR
A0A7W8YB56      -------------------------------------------MEYTTESQPKALNEQVR
A0A1L2ZMV4      -------------------------------------------MEYTAENQPQALNHQVR
A0A7W8TSW5      -------------------------------------------MEYTAENQPQALNHQVR
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      --------------------------------------------------------MELQ
A0A542XE74      --------------------------------------------------------MTIL
A0A0Q7QDF6      --------------------------------------------------------MTSR
A0A7X7XPM3      -------------------------------------------MAPVHRHRPRSFPVQLR
A0A5R8L819      ----------------------------------------------------MRSVVELG
A0A7K0PFV4      ------------------------------------------MSSFSDPETPDASDRALW
A0A0G3V3F3      --------------------------------------------------------MDLA
A0A7K0MUQ7      ------------------------------------MSPDTTRGTEALERRVSCRHMDLA
A0A7K0U619      ------------------------------------MSPDTTRGTEALERRVSCRHMDLA
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      --------------------------------------------------------MSIA
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      --------------------------------------------------------MDVR
A0A810MDE3      --------------------------------------------------------MDVR
A0A4Y8WZJ3      -------------------------------------------------MAPAPPVMSLS
A0A7X0KT97      ------------------------------------------------------------
A0A853DGU7      --------------------------------------------------------MTVV
A0A7Z0A2Z7      ------------------------------------------------------------
A0A285VUW0      --------------------------------------------------------MSVR
A0A849PJI9      --------------------------------------------------------MTII
A0A2R7Z032      --------------------------------------------------------MTFA
A0A6J4MTQ2      --------------------------------------------------------MTFG
A0A1I0W453      --------------------------------------------MVGGGAPPRLAGMTFG
A0A0Q6VV12      --------------------------------------------------------MTFG
A0A495NTA9      --------------------------------------------------------MTFG
A0A1H4LCS9      --------------------------------------------------------MTFG
A0A4Q2RZP8      --------------------------------------------------------MTFG
A0A0Q9QB08      --------------------------------------------------------MTFG
A0A7Y9H290      --------------------------------------------------------MTFG
A0A4Q2SA86      --------------------------------------------------------MTFG
A0A4Z1C3Z0      --------------------------------------------------------MTFG
A0A6V8KDX4      ------------------------------------------------------------
A0A444BL03      --------------------------------------------------------MTLL
A0A7V9PCQ0      --------------------------------------------------------MELR
A0A4Y8X357      --------------------------------------------------------MNLL
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A6L6AM03      --------------------------------------------------------MTFG
A0A4Q2RU39      --------------------------------------------------------MTFA
A0A4Q2SK58      --------------------------------------------------------MTFA
A0A2N3YJR1      --------------------------------------------------------MTLL
A0A6G8FYB9      --------------------------------------------------------MTLL
A0A4Q4D742      ----------------------------------------------------MGVHVELR
A0A1C6T1J1      --------------------------------------------------------MDLY
A0A2W2CFC8      --------------------------------------------------------MDPL
A0A2W2A4B0      ----------------------------------------------------------MT
A0A4Y9MDA5      --------------------------------------------------------MSLS
A0A1H7N9P7      --------------------------------------------------------MSLS
A0A1M7V0F8      --------------------------------------------------------MTLS
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A838JYQ6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A7V8X3I0      ------------------------------------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A838JNW7      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      -----------------------------------------MS-----------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      -------------------------------------------------MYVTSGDDSN-
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      -----------MLLGALGLG---------AAALVLSGQTT---------RYDGSAEVLI-
A0A1Q2CRV2      ------------------------------------------------------------
A0A261FE22      -------------------------------------------------MAKNSDGAMT-
A0A7K0NRJ7      AHFRIIARAWKQILIAGVLV---------AVAMFFWSNRA-ER------VYEATALLAV-
K6WHS4          ------------------------------------------------------------
A0A7K0NTR2      DYLRIIRRRWWVLLVTVVIA---------MTFVMLMRPSS-SD------AVERNKPGLS-
A0A1H6WL79      DLLSVVRSHWLGILVITVLM---------TGGSLGWYALQ-PK------VYAAESSGIV-
A0A101LAM5      DLLSVVRSHWLGILFITVLM---------VGGSLGWYALQ-PK------VYSAESSGIV-
A0A4Y3NEG0      DLLSVVRSHWLGILLITVFM---------VGGSLGWYTLQ-PK------IYSAESSGIV-
A0A1Q2CI19      DFLSILRHRWLVIVLCVLIA---------AGVVFAITPAE-RDVSPRIGSYTATSTLLV-
A0A512T3M3      DYLIVFRHYGALIVATILAA---------ATLTWVLTPAH-AQGPVT--SYTATATLLA-
W6JTW4          EYLRILLHRAPLIAGATVVA---------GLLSWFLVPAG-TQNAPR--SYTATAQMTV-
A0A839J1M0      DFIKILRQRWWVILLCTLVA---------AGAMFLATPAR-TDTTQRIGSYTATTTLLV-
A0A8A4Z8K4      DFIKILRQRWWVILLCTLVA---------AGAMFLATPAR-TDTTQRIGSYTATTTLLV-
A0A0A0JTY0      DYFKVFRHRWIIIVICALVA---------GAITWFITPAS-SDTTKKVGSYTATATMLVT
A0A0A0JXF2      DYIKVFRHRWIVIVLCAVIA---------AGVTWLVTPAS-ADTTKKVGSYTATATILV-
E6S8H2          EYLKVFRQRWLIIAITTLVA---------GAVMWVTSPAV-ADTSQKASSYTATATLLV-
A0A0A0JGH0      DYIRIIRQRWIVIVICAAVA---------GLVTWFLTPAN-ASSVKDAPSYTATATVLV-
N0E4U7          DYLTIARRRWPIIVACALVA---------AAVTWFLTPAQ-TDEAEVAPSYTATATLLV-
A0A0A0IYK2      DYIKVFRHRWMVILVCALVA---------GAVTWFVTPAS-ADTTKKVGSYAATATILV-
A0A0Q9L0H3      DYIKVFRHRWPVILICALVA---------GAATWFITPAS-SDTTKKVGSYTATATLLV-
A3TMK0          DYIKVFRHRWPVILICALVA---------GAATWFITPAS-SDTTKKVGSYTATATILV-
A0A543PXP1      DYLKVFRHRWPVIVACALSA---------AAIMWLVTPAQ-TATAQKASSYTATATLLV-
A3TMH6          DYLKAFRRRWLVIALCAVVA---------GAVMWTVTPAH-PEVTRSTGSYTATATLLV-
A0A6I2XCV4      HYAAVVRRRWRWIAAGLVLG---------MVGGLISTVIA-TS-TAPKSSYFKATNTIV-
A0A5R8VLL6      DYARVARTYWKHITVITLIV---------TVLATAWSAFR-PR------VFAAEATAIV-
A0A3L7ADK2      DFVRMIRTYWMGALLIIALS---------IASGAVWTLFQ-PQ------VFEAKATGIV-
A0A538JQF8      PFPRSVRAAHTLILANNTLAPEDTQKPLNVYALFIKVGEV-PKLAAERLGYKKEAFELV-
A0A1H6YPK1      DYLDVLRSRWLSIAVCTLVV---------GAVAYLWSDMQ-PR------VYSTSAEALV-
A0A0Q9TBP0      -----------MALLVLLAA---------VAVSCAYSLAA-TP------LYIATADVLI-
A0A0G3V3M7      DYLRIVRRRWWVLLVTVVIA---------MTFALLTRPSS-AA------TAKASRPGVS-
A0A6I3DD56      DYLRIIRRRWWVLLVTVVIA---------MTFALLTRPSS-SE------TIRANRPGVS-
A0A5Q2FA83      EFLAILGSRWKTVLVSLLLV---------VAATVATTLRI-TP------TYEATTRVFF-
A0A2R7MGI0      RVVRILRAYWKTIGALLALG---------ALAGLGWSALQ-PR------VYTADASGYV-
A0A2T7WQY4      RVVRILRAYWMTIGALFALG---------ALVGLGWSALQ-PR------VYTADASGYV-
A0A0Q5Q5L3      --MRILRAYWKAIVVMTVLG---------GLAGLGWSATQ-AR------VYSADASGYV-
A0A0Q6DVM4      --MRILRAYWKAIVVMTVLG---------GLAGLGWSATQ-AR------VYSADASGYV-
A0A1N7DLV3      RVARILRAYWKAIVALTLAG---------GLAGLGWSALQ-PR------VYTADASGYV-
A0A1V2NSB5      RVARILRAYWKAIVALTLAG---------GLAGFGWSALQ-PR------VYTADASGYV-
A0A1R3WWR6      RVVRILRAYWKAIVALTIAG---------GLVGLAWSAVQ-PR------VYTADASGYV-
A0A1G6GTN3      RVVRILRAYWKAIVALIATG---------ALAGLGWSSLQ-PR------VYTADASGYV-
A0A7W5GFA5      RMVRVVRAYWKAIVALIVVG---------GLAGFGWSALQ-PR------VYTADASGYV-
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      -MVRVVRAYWKAIVALIVVG---------GLAGLGWSSLQ-PR------VYTADASGYV-
A0A2W6DK08      DYLTALQRRWPVVVVAGLLG---------LLIGYLVAPGA-ANQLSGKGSYVATATVLQ-
A0A346XTB0      SLLESLWRYRVVVAGVTLFM---------GLLGYVVGLQE-DV------RYVAQGTLFL-
A0A542FTE6      EFLRAVRAYWVGALGILLIC---------IAIAALWTLTQ-PR------VWTSVATGVV-
A0A7Y9QM02      EFLRAVRAYWVGAMSILLIC---------IAIAALWTLTQ-PR------VWTSVATGVV-
A0A6I1G2U1      EYWKVIRRKWPVIVATSLAA---------AVVMFLITPAE-PPPVERVTSYTATATLIV-
A0A351ETF8      AHLAIVRKYWWFTVLVVVCA---------VAVAFLLTQRQ-ER------IYSTSAQVLL-
A0A349B7N2      ------------MVLGLTLG---------WVTTPSSAGPD-EP------DYYRATHTLV-
A0A4Q2JUT1      DYLRGLRRHWVAILLLTLVG---------VGAGYGWTVLQ-TP------VYVASTSGIV-
A0A6L5R0V7      DYLRGLRRHWVAIVLLTLVG---------VGAGYGWTVLQ-TP------VYVASTSGIV-
A0A2S0LQ32      -----MKVNAVFIICCVVVG---------GLLGFGYAKTQ-PK------LYQSSAQATI-
A0A7T8DZN6      -----MKVNAVFIICCVVVG---------GLLGFGYAKTQ-PK------LYQSSAQATI-
A0A2N6V1R5      ----MTRVNLGFLILCVLLG---------LAGGFGYASAQ-PW------TYTATSQAMV-
G9PHS6          ----MTRVNLGFLILCVLLG---------LAGGFGYASAQ-PW------TYTATSQAMV-
U1PLM7          ----MTRVNLGFLILCVLLG---------LAGGFGYASAQ-PW------TYTATSQAMV-
A0A4V1VGV9      DLVRIMRANLKLLALAALIG---------TLLAAGYTLTR-PT------LYSASSTAQV-
A0A2S5UYV0      DFLRLTGRSWRTLLIGVAIG---------LLAAFGYTQVQ-PH------VFTANSSGFV-
A0A7W4UQ09      DFLRLTGRNWKTLAIGVIVG---------LIAAFGYTQVQ-PH------VFAASSSGYV-
A0A2S5X9U6      DFLRLTGKSWKILAVGAIVG---------LLAAFGYTQIQ-PK------EYEANSAGFV-
A0A2S5ULV5      DFLRLTGKSWKILAIGVIVG---------LLAAFGYTQIQ-PK------VYEADSAGFV-
A0A653YMF0      DFLRLTGKSWKILAVGVIIG---------LLAAFGYTQIQ-PK------VYEADSAGFV-
A0A7V9H755      DLVYTGSDPYEVRRIANAV----------AEASQAHDAAG-AQ------KDARRRRGFL-
A0A3Q9IY80      TYLRILRAHWLGLIVLVVVG---------VVSAFGWTLLQ-PK------VYSADASGIV-
A0A0F0LP73      DFLVLIRRGWFFLALGLLFG---------ALGGFVTAQLT-PP------VYTAQATGFI-
A0A346Y185      ALVGVLRSSIGRILLVGVAA---------GLLGFGLSALQ-SL------RYTAEADLLL-
A0A7W0HGW1      -----MRKNAWIVAAVVALA---------VTLSLVRSTLQ-PE------IWASQALVRV-
A0A259S8H9      DLFTILRRGWLYLAAGLLLG---------ALAGFGYAQTL-AP------VYTSQATGF--
A0A2W1Z497      DYVRMFRTYWFGAVLIVLAC---------VAAAGAWTLTQ-PR------VYTSGASGFV-
A0A0Q5L115      DYLRIVRSYWLGAFLIVLLG---------VTAGAGWTLTQ-TR------VYESSASGVV-
A0A7G6YY64      DYLRIVRSYWLGAFLIVLLG---------VTAGAGWTLTQ-TR------VYESSASGVV-
A0A7J5B4S5      DFLRLTGRSWRTLLIGVAIG---------LLGAFGYTQVQ-PH------VFTANSSGFV-
A0A852U976      DFLRLTGRSWRTLLIGVAIG---------LLAAFGYTQVQ-PH------VFTANSSGFV-
A0A1F1X071      DFLRLLLRNLLLLVAGLVLG---------AATGYGLSFTQ-ST------TYSASALGYV-
A0A3R8RWC7      DFLRLLLRNLLLLVAGLVLG---------AAAGYGLSFTQ-ST------TYSASALGYV-
A0A4U0RJZ4      DLVRIIRTNLKLLLLSMLLG---------IVVAAGYTLTR-PV------EYQATSTAQI-
A0A4R1FGL9      DLVRIIRTNLKLLLLSMLLG---------IVVAAGYTLTR-PV------EYQATSTAQI-
E3B8H1          DLVRIIRTNLKLLLLSMLLG---------IVVAAGYTLTR-PV------EYQATSTAQI-
A0A7D7WDT9      DFLVLTRRGWRILTLMIVLG---------ALGGAAYGFLA-PK------SYQAQSTGFI-
A0A0Q5AWK6      DFIAFIRRNWKALVVAVLVG---------VTAMAAFSFVT-PK------VYESSSAGFV-
A0A6P1F176      DFIAFIRRNWKILAIAVVVG---------VAAVAAFSAVT-PR------VYESKSAGFV-
A0A3N1NLD3      DFIAFIRRNWKILVVAVLVG---------VSAMAAFSAVS-PK------VYDSSSAGFV-
A0A3N2FVI8      DFIAFIRRNWKIIVVAVLVG---------VSAMAAFSAVT-PK------VYDSSSAGFV-
A0A2S5XDQ6      DLIAFIRRNWRTLVGAVLVG---------ALAMAAFSFLT-PK------VYESSSAGFV-
A0A2S5XNN6      DLIAFIRRNWRTLVVAVLVG---------ALAMAAFSFLT-PK------VYESSSAGFV-
A0A5C8C085      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      -------------------------------------------------MYTASASGYV-
A0A7V9FXS6      QILDALRWRWKAILLFAFFF---------TLGATLLVERL-PS------QYDSEAVVAF-
A0A7W0PY69      DLVDALRWRWKPAVLIAACI---------FAGALLYVSTL-PA------QYDGQAVIAI-
A0A7W8YB99      ------------------------------------------------------------
A0A1L2ZMQ6      ILMAVVRRFWPVLLIATLVG---------ALCGFGWAALQ-PK------MYQSTSSGLI-
A0A7W8TR75      ILMAVVRRFWPVLLIATIVG---------ALCGFGWAALQ-PK------MYQSTSSGLI-
A0A151BT98      DFLRIMRQRWRWLLGTLLVV---------LAVAAVSTLMQ-PK------TYEASARFYL-
A0A2Y8ZRF8      DFLRIMRQRWRWLLGTLLIV---------LIAAAVSTMLQ-PK------TYEASARFYL-
A0A2R9UAT1      ------------------------------------------------------------
A0A3E2DN22      DVVRILRRNLALLVICTLAG---------GLLGAVYQLTR-SE------TFTAKATGMV-
A0A3Q9ULZ9      DFVRLLRRNLLLLVICGVVG---------MGAAAAYVFTR-PV------QYVAQSTAMV-
A0A3S9JFL2      DLVRLLRRNLALLLVCGLVG---------IAAAAAYVFTR-PV------QYVAESTAMV-
A0A3L8NYD3      DFVRLTRVNWRVIFATFSLG---------LVAALLYTLHQ-PV------VYTATSKGYV-
A0A1M6K628      QLWALARRNWLTLLLATILG---------VAVGAGISYLQ-PT------LYSATSVGYV-
A0A561E8R3      DFVRFSRTNALLLLLFTIVG---------GALMFGYTFTK-PT------LYSATAQGLV-
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      NYLRIARRMWWLFLACVAIG---------VGCLYVASYVSYTP------LYRSEATFTI-
A0A0Q7KBQ4      -----MRSRWVFSVSTFVVG---------AVATILLVLSM-SP------VYGSSAKLFI-
A0A5Q5BFU2      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A7I7UD03      ------------------------------------------------------------
A0A7I7MI62      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      ------------------------------------------------------------
A0A7I9ZLK4      ------------------------------------------------------------
A0A1F1IHY9      KAMSMLQRHWMILVAAPLIG---------VLLAGLWVLTQ-NP------RYASTANALV-
A0A7H2BCD6      DFIRLTRANLRYLLAGLLIG---------ALLGLGYSLLQ-PR------VYASTSTGYV-
A0A3S0V9U6      DFIRLTRANIILLVVGILVG---------ALVGYGTTLIQ-PK------TYAATSSGYV-
A0A7T4T4U7      DFLRLTRANLKYLIIFTVAG---------ALLGLGVAALQ-PK------VYSATSSGYV-
A0A1S2N0P2      DFLRLTRANLKYLIIFTVAG---------ALLGLGVAALQ-PK------VYSATSSGYV-
A0A0Q3BEY5      DFLRLTRANLKYLIIFTVAG---------ALLGLGVAALQ-PK------VYSATSSGYV-
A0A4R6Q3C6      DFLRLTRANLKYLIIFTVAG---------ALLGLGVAALQ-PK------VYSATSSGYV-
A0A7T3CHP7      DFLRLTRANLKYLIIFTVAG---------ALLGLGVAALQ-PK------VYSATSSGYV-
A0A7Y5U6C1      EYVQIAQRRKWIIALGAVLV---------PFAAIVISFLQ-HP------TYGSSAEVLI-
A0A542HCT5      DYLRVARAYWRGIVAFVLLG---------VAVAAGVSLVT-PK------VYQADASGFV-
A0A537WNY9      DLLNLLWRRRILFVATILAV---------IGTAFGSVQVV-TP------EYEATSTLAL-
A0A5B8M469      ------------------------------------------------------------
A0A2S8WHZ8      --MQVVRAYWRGIIGIFLIC---------ILLAFLWTLTQ-PR------IYAATSSGLV-
A0A1Y4CTD2      EAARQVAQNWWVVLALALAT---------FLGMTGVGKLTYVP------EYTSAATLVI-
A0A3N3ZPU0      AVARAAGWYWKVALALIVLS---------VAAGAAIALLM-PK------VYSSTNTVMV-
A0A359IQX7      DFVRMTRHNAWLLLASVVLG---------LVAAAGYSLTQ-PT------LYGSVSTGIV-
A0A7W9IKV0      YYVRLMRRNWPFLLLSLVLG---------VGTALTVTANT-PP------KYIATISMLV-
A0A1N7E3F1      RYARLMRRYWPLLLLSVLAG---------VGTAHVVTVNT-AP------RYLASITMLV-
A0A544ZKQ1      YYARLMRRYWPLLLLSVLAG---------VGTAHVVTVNT-PP------RYLASITMLV-
A0A5D0Q2X0      YYARLMRRYWPLLLLSVLAG---------VGTAHVVTVNT-PP------KYLASITMLV-
A0A5R8Z2E7      YYARLMRRYWPLLLLSVLAG---------VGTAHVVTVNT-PP------KYLASITMLV-
A0A0Q9LZR0      DYLRVARTYWRGLVAFMLLG---------VAVAGGLSLVT-PK------VYQADASGFV-
A0A1F1J417      DFVRTTRANLVLLIAGIVIG---------AIAGLGYSLLQ-PK------VYAASASGYV-
A0A2A8D6P2      DFVRTTRANLVLLIAGIVIG---------AIAGLGYSLLQ-PK------VYAASASGYV-
A0A1F0THV9      DFVRTTRANLLLLIAGIVIG---------AIAGLGYSLLQ-PK------VYAASASGYV-
A0A5F0M6Y0      DFVRTTRANLLLLIAGIVIG---------AIAGLGYSLLQ-PK------VYAASASGYV-
E3H5W1          DFVRTTRANLLLLIAGIVIG---------AIAGLSYSLLQ-PK------VYAASASGYV-
A0A1F1QKB0      DFVRTTRANLLLLIAGIVIG---------AIAGLGYSLLQ-PK------VYAASASGYV-
A0A509JY23      DFVRTTRANLLLLIAGIVIG---------AIAGLGYSLLQ-PK------VYAASASGYV-
A0A448USF4      DFVRTTRANLVLLIAGIVIG---------AIAGLGYSLLQ-PK------VYAASASGYV-
A0A7Z9A2N0      DFVRTTRANLVLLILGIIIG---------ALLGVGYSLTQ-PK------VYAASASGYV-
A0A433EDP2      DFVRTTRANLVLLILGIIIG---------ALLGVGYSLTQ-PK------VYAASASGYV-
A0A231VTW0      DFVRTTRANLVLLILGIIIG---------ALLGVGYSLTQ-PK------VYAASASGYV-
A0A433ECD0      DFVRTTRANLVLLILGIIIG---------ALLGVGYSLTQ-PK------VYAASASGYV-
A0A7T9UPU8      DFVRTTRANLVLLILGIIIG---------ALLGVGYSLTQ-PK------VYAASASGYV-
U7V3Z1          DFVRTTRANLVLLILGIIIG---------ALLGVGYSLTQ-PK------VYAASASGYV-
A0A6I3F378      DYLSAVWRRKYLALSTTVLC---------ACLAAGWSVTQ-TS------VYRASTEVVI-
A0A838H0S5      GLLEAVWQYRWAAAIVTLVA---------GAVGFAASFLQ-PT------EYEAQAQLLL-
A0A1S1CQC5      EFFRTTRANLWLLIIGIIIG---------AAVGFGYASLQ-PK------VYAASSSGYV-
A0A1E9T6I0      EFFRTTRANLWLLIIGIIIG---------AAVGFGYASLQ-PK------VYAASSSGYV-
A0A1F1GHA7      EFFRTTRANLWLLIIGIIVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1S1CAD0      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
G5ET14          EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1E9DXX2      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1E8S156      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1E8S5S2      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1S1DFA8      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A2I1Z490      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1F0DAA9      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1F0PHK9      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1F0VZG6      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1E9G8X4      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PR------VYAASSSGYV-
A0A1E9IAW2      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PR------VYAASSSGYV-
A0A1E9ZBC9      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PR------VYAASSSGYV-
A0A1E9ZDP4      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PR------VYAASSSGYV-
A0A1F0R6B5      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PR------VYAASSSGYV-
A0A1F0Z7N5      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PR------VYAASSSGYV-
A0A1F1D897      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PR------VYAASSSGYV-
D2NP38          EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PR------VYAASSSGYV-
A0A1F1FV74      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1E9M791      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PR------VYAASSSGYV-
A0A291DEI8      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PR------VYAASSSGYV-
A0A1S1D5T1      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1E8TRD6      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1F0XT88      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1F1EVP5      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
C6R548          EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A0K2RXS2      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A1F0KX60      EFFRTTRANLWLLIIGIVVG---------AAAGFGYASLQ-PK------VYAASSSGYV-
A0A542I3V2      DYVRVARLYWRSIAVVTVIV---------TALVMLWAALQ-PR------TYAAESSALV-
A0A2T0UZ65      DFVRLSRANLLRIVLLVLIG---------AGLAFAYAQTL-PK------VYAADASGYV-
A0A0Q5M6Z7      DFVQLLRRYWVGELAIVMLT---------VGLVAALTAVQ-PR------VYESTASGLT-
A0A7G6YA19      DFVRMIRRYWLGEAIIVLAT---------IGLVAGFTALQ-PR------VYQSTATGLT-
A0A853CXS3      DFVRMIRRYWLGEAVIVLAT---------IGLVAGVTALQ-PR------VYQSTATGLT-
A0A7W8YB56      RIVRVALSNWKGALAIFLLS---------VLASVGLFFLS-PK------TYTATNTVMV-
A0A1L2ZMV4      RLAHVVLNNWKGAIAIFLLA---------VLASVGLFLIS-PK------TYAATNTVMV-
A0A7W8TSW5      RLARVVLNNWKGAIAIFLLA---------VLASVGLFLIS-SK------TYAATNTVMV-
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      TYWRIARTGWWMMLIGLVVG---------VLLAVGWVVLQ-KP------VYTADAGGFV-
A0A542XE74      DLIRLLRRSWLSVAVGLMIG---------LILAAAYTLTR-PT------TYVAESRGVV-
A0A0Q7QDF6      SGWTAVARRWPLVVLLGALG---------LGAAALVLSGQ-TT------RYDGSAEVLI-
A0A7X7XPM3      DVRDILCARWKTLLVCLLLV---------LGATAAVTANT-TP------DYEARARVF--
A0A5R8L819      VYLRVFRAHWVAIVVATIVG---------GALAYGWAVLQ-PK------TYTAEASGYV-
A0A7K0PFV4      PLLAALRTRWWLVVGLVVLA---------GVTAAFAVRAK-AP------SYTAEAQVLV-
A0A0G3V3F3      AHFRIIARAWKQILIAGVLV---------AVAMFFWSNRA-ER------VYEATALLAV-
A0A7K0MUQ7      AHFRIIARAWKQILIAGVLV---------AVAMFFWSNKA-DR------VYEATSLLAV-
A0A7K0U619      AHFRIIARAWKQILIAGVLV---------AVAMFFWSNKA-DR------VYEATSLLAV-
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      DILQMIKKHWIVGLAVLVVS---------LAVTVCVVQTT-VP------EYSASVTAVT-
A0A1Q2CJ92      -MWGLLRRGWLVIVASLAVG---------LALAFALSLTQ-PV------LYSATSAGYV-
A0A2T0S3C8      DYLRVLRKRWWMLLAGIGVA---------CGLAGILTSQM-TP------QYATSVTFFV-
A0A810MDE3      DYLRVLRKRWWMLLAGIGVA---------CGLAGILTSQM-TP------QYATSVTFFV-
A0A4Y8WZJ3      KAMSMLQRHWMILVAAPLIG---------VLLAGLWVLTQ-NP------RYASTANALV-
A0A7X0KT97      ---------------MTIVG---------LIAAAGWTAIQ-TP------VYRTTASGLI-
A0A853DGU7      DFLRLSRANWHVLLVAIVVC---------TLGAYAYVLSL-PV------TYASSSSAFV-
A0A7Z0A2Z7      -----------MILLLVVLG---------VAVGVGLSRIL-PK------SFASSVTFYV-
A0A285VUW0      DLFLAIARRWRGAVAILLLV---------VAATAFATSRQ-PQ------VFESRTTVYF-
A0A849PJI9      DFVRVLRASARVLLLGLLLG---------VLLGFGYSFTK-PK------LYQATAQGAV-
A0A2R7Z032      EFVRLTRAYWWFLVLLTALG---------AGVMIAKTSRE-PE------LYSAGASGIV-
A0A6J4MTQ2      ELWRLTRAYKWVLAGFVVLG---------VLVMIALTSQK-PV------LYSASSKGVV-
A0A1I0W453      DFVRLSRAYVWVLIGCTILG---------AALMLAKTTRD-PV------LYSATSSGLV-
A0A0Q6VV12      DFVRLTRAYVWVLIGCTVLG---------ALLMMAKTTRD-PV------LYSATSSGLV-
A0A495NTA9      DFVRLTRAYVWVLIGCTVLG---------ALLMMAKTTRD-PV------LYSATSSGLV-
A0A1H4LCS9      DFVRLSRAYVWLLIGCTILG---------ALLMVAKTTQD-PV------LYAANASGFV-
A0A4Q2RZP8      DFVRLSRAYVWLLIGCTILG---------SLLMIAKTSRE-PV------LYAANASGFV-
A0A0Q9QB08      DFVRLSRAYVWVLIGCTVLG---------AALMVAKTTQD-PV------LYSATANGLV-
A0A7Y9H290      DFVRLTRAYVWVLIGCTILG---------ALLMVAKTTRE-PV------LYSATSSGLV-
A0A4Q2SA86      DFVRLSRAYVWVLIGCTVLG---------AVLMAAWTTRE-PV------LYSATSSGLV-
A0A4Z1C3Z0      DFVRLTRAYVWVLVGCTVLG---------AAVMAAWTTRE-PV------LYSATSAGLV-
A0A6V8KDX4      ------------MALITGLA---------AGTMGLLTILA-VP------QYATSVTFFV-
A0A444BL03      DFVRLTRTHLLFLVVLTLAG---------GAAAYGLTLRM-PS------VYLADASGYV-
A0A7V9PCQ0      DVRLALRRYWLLALLVLVLC---------VGLGAAAAFLP-AK------TYEASATLTA-
A0A4Y8X357      DFLRVLRNNKLLLLGGIVLG---------VVAGLVYSLLQ-PT------LYTATSTGFV-
R4LD52          ----------------MLAA---------LVLGALVTVQT-AP------RYATSVTFFV-
A0A4T2CD79      ----------MTVVAITLLG---------AAAAFGWTFTQ-TR------VYTANSSGIV-
A0A6L6AM03      DFVRLSRAYVWVLIGCTILG---------ALLMIGKTTRD-PV------LYSATSSGLV-
A0A4Q2RU39      DFVRLSRAYVWVLIGCTILG---------ALLMIAKTTRD-PV------LYSATASGLV-
A0A4Q2SK58      DFVRLSRAYVWVLIGCTILG---------ALLMIAKTTRE-PV------LYSATSSGLV-
A0A2N3YJR1      DFVRLSRTHLLSLVLLTLLG---------GAAAFGLTTRL-PQ------VYQADASGYV-
A0A6G8FYB9      DFVRLTRAHLLSLVFLTLVG---------GAVAYGLTLRM-PE------VYLADASGYV-
A0A4Q4D742      QFFGTLQARWRFALVTFVLG---------AIATVVLVTSM-AP------QYGSTVKIFM-
A0A1C6T1J1      RQLRLVRRHWWIVLVTLMVA---------LGTTALVTIRS-EP------RYVASVTFFV-
A0A2W2CFC8      RQLRLVRRHWWIVLVTLMVS---------LGVTALVTVRA-QP------RYLATVTYFV-
A0A2W2A4B0      PLTRALVLRWYFAVGGALLG---------FVVAIALSSTV-TP------QFRATSKIWI-
A0A4Y9MDA5      VFLGTLRRRWSLLLAGVLVG---------LTVAGIGSLTA-ER------LYTAESRLFF-
A0A1H7N9P7      VFLGLIRRRSSWLVAGVVLA---------VAVAGVGSLTA-TR------LYTAEARLFF-
A0A1M7V0F8      AFLGVLRRRSSWLLVSVLVG---------LTVAGAGSAAA-TR------LYTAEASLFF-
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      -----------------------------------------ST-----------------
A0A538AM15      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      -----------------------------MAIGLVSGIVLGVMVALIKDLLDTRVRRDS-
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A4R1CW45      ---------------------------------------------------MAEAVSSS-
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A1I6GVG4      --------------------------------------------------------KPV-
A0A1I6IST1      --------------------------------------------------------KPV-
A0A412JBM5      ----------------------------------MMGMAMSHELKRESGHMRPAC-----
A0A6J4SUA1      -------------------------------------LDRLDRRFRYPEQVTDDLGLDI-
A0A1C2B334      -----------------------------------------------MGVVDSPV-----
R7Y679          ----------------------------------MFGRSRLGTRIRDEGDLDDAIGVHS-
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------RSAVVAFLLTCILVGELIVASRA-
A0A838JYQ6      ---------------------------------------------------MIFSRRTG-
A0A510HHA8      ---------------------------------------------------MVRLNLKR-
A0A6G8Q9J3      ---------------------------------------------------MARPKVKR-
A0A538BBM6      ------------------------------------------------------------
A0A5Q2F9A3      -----------------------------------MLRNSLDTRVRTASDVAQLTDSPL-
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      -----------------------------------------------------TIDAPV-
A0A7V8X3I0      ------------------------------------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------------------------------------------
A0A6G8QDQ0      --------------------------------------------------MQQPKTESK-
A0A023X491      ------------------------------------------------------MARSK-
A0A4R1BMZ2      ------------------------------------------------MIISRRK-----
A0A838JNW7      ------------------------------------------------MILSRKSTRRR-
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A7K0NRJ7      ------------------TPSDTGL-----------------------------------
K6WHS4          ------------------SASYQNS-----------------------------------
A0A7K0NTR2      ------------------FKATATL-----------------------------------
A0A1H6WL79      ------------------VAAGAEN-----------------------------------
A0A101LAM5      ------------------VAAGAEN-----------------------------------
A0A4Y3NEG0      ------------------VTAGAEN-----------------------------------
A0A1Q2CI19      ---G--------------SVGAPDA-----------------------------------
A0A512T3M3      ------------------ASSENPQ-----------------------------------
W6JTW4          ------------------DGGEERV-----------------------------------
A0A839J1M0      ---GYRADPVETPGRGTTAPQAPVE-----------------------------------
A0A8A4Z8K4      ---GYRADPVETPGRGTTAPQAPVE-----------------------------------
A0A0A0JTY0      AKAS--------------SAA-TAV-----------------------------------
A0A0A0JXF2      ---G--------------STD-PER-----------------------------------
E6S8H2          ---T--------------STE-TDS-----------------------------------
A0A0A0JGH0      ---S--------------AAT-ADE-----------------------------------
N0E4U7          ---G--------------SGG-PPE-----------------------------------
A0A0A0IYK2      ---G--------------STDPENP-----------------------------------
A0A0Q9L0H3      ---G--------------SNDPETG-----------------------------------
A3TMK0          ---G--------------SKDPEAT-----------------------------------
A0A543PXP1      ---G--------------TS--ADS-----------------------------------
A3TMH6          ---E--------------RT--EDV-----------------------------------
A0A6I2XCV4      ------------------EADGSGT-----------------------------------
A0A5R8VLL6      ------------------LAVGTDN-----------------------------------
A0A3L7ADK2      ------------------QAPRGND-----------------------------------
A0A538JQF8      ------------------RSANVQA-----------------------------------
A0A1H6YPK1      ------------------TPAGSLD-----------------------------------
A0A0Q9TBP0      ------------------EPSGADI-----------------------------------
A0A0G3V3M7      ------------------FRATTTL-----------------------------------
A0A6I3DD56      ------------------FRATTTL-----------------------------------
A0A5Q2FA83      ------------------SAEATAK-----------------------------------
A0A2R7MGI0      ------------------ATVSSDG-----------------------------------
A0A2T7WQY4      ------------------ATVSSDG-----------------------------------
A0A0Q5Q5L3      ------------------AAVASDG-----------------------------------
A0A0Q6DVM4      ------------------AAVASDG-----------------------------------
A0A1N7DLV3      ------------------ASVSSDG-----------------------------------
A0A1V2NSB5      ------------------ASVSSDG-----------------------------------
A0A1R3WWR6      ------------------AAVASDG-----------------------------------
A0A1G6GTN3      ------------------AAVASDG-----------------------------------
A0A7W5GFA5      ------------------AAVASDG-----------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      ------------------AAVASDG-----------------------------------
A0A2W6DK08      ------------------APDVKEA-----------------------------------
A0A346XTB0      ------------------ADPNLGD-----------------------------------
A0A542FTE6      ------------------QTTGGGD-----------------------------------
A0A7Y9QM02      ------------------QTTGGGD-----------------------------------
A0A6I1G2U1      ------------------ETPARSV-----------------------------------
A0A351ETF8      ------------------RSSENSFLFPFPATGPLALNREGEIETLYVTSPAFTEAALLK
A0A349B7N2      ------------------AETGTSA-----------------------------------
A0A4Q2JUT1      ------------------QSTGVGD-----------------------------------
A0A6L5R0V7      ------------------QSTGEGD-----------------------------------
A0A2S0LQ32      ------------------VIAGTDA-----------------------------------
A0A7T8DZN6      ------------------VIAGTDA-----------------------------------
A0A2N6V1R5      ------------------VVPGTDA-----------------------------------
G9PHS6          ------------------VVPGTDA-----------------------------------
U1PLM7          ------------------VVPGTDA-----------------------------------
A0A4V1VGV9      ------------------IAGNSID-----------------------------------
A0A2S5UYV0      ------------------MAGPAAE-----------------------------------
A0A7W4UQ09      ------------------VSGPTD------------------------------------
A0A2S5X9U6      ------------------VASGNAE-----------------------------------
A0A2S5ULV5      ------------------IAGSSGE-----------------------------------
A0A653YMF0      ------------------IAGGSAE-----------------------------------
A0A7V9H755      ------------------EGQLRET-----------------------------------
A0A3Q9IY80      ------------------APVRTE------------------------------------
A0A0F0LP73      ------------------AGTGG-------------------------------------
A0A346Y185      ------------------ADPRNTG-----------------------------------
A0A7W0HGW1      ------------------LNASSTSLLPEQSRVDPVREVEIQRLYANSASIQQEVTNRLG
A0A259S8H9      -------------------IAATGT-----------------------------------
A0A2W1Z497      ------------------RVAGNGD-----------------------------------
A0A0Q5L115      ------------------QVAAGGD-----------------------------------
A0A7G6YY64      ------------------QVAAGGD-----------------------------------
A0A7J5B4S5      ------------------TAGPSEG-----------------------------------
A0A852U976      ------------------TAGPSEG-----------------------------------
A0A1F1X071      ------------------SASAQSD-----------------------------------
A0A3R8RWC7      ------------------SASAQSD-----------------------------------
A0A4U0RJZ4      ------------------MAGASND-----------------------------------
A0A4R1FGL9      ------------------MAGASND-----------------------------------
E3B8H1          ------------------MAGASND-----------------------------------
A0A7D7WDT9      ------------------ATAGDA------------------------------------
A0A0Q5AWK6      ------------------IAATDGS-----------------------------------
A0A6P1F176      ------------------IAATDGS-----------------------------------
A0A3N1NLD3      ------------------IAATDGS-----------------------------------
A0A3N2FVI8      ------------------IAATDGS-----------------------------------
A0A2S5XDQ6      ------------------IAASDGS-----------------------------------
A0A2S5XNN6      ------------------IAASDGS-----------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      ------------------SG----A-----------------------------------
A0A7V9FXS6      ------------------SP----------------------------------------
A0A7W0PY69      ------------------SP----------------------------------------
A0A7W8YB99      ------------------------------------------------------------
A0A1L2ZMQ6      ------------------VT----------------------------------------
A0A7W8TR75      ------------------VT----------------------------------------
A0A151BT98      ------------------AGSNG-------------------------------------
A0A2Y8ZRF8      ------------------AGSNG-------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A3E2DN22      ------------------VA----------------------------------------
A0A3Q9ULZ9      ------------------VA----------------------------------------
A0A3S9JFL2      ------------------VA----------------------------------------
A0A3L8NYD3      ------------------AV----------------------------------------
A0A1M6K628      ------------------VV----------------------------------------
A0A561E8R3      ------------------SA----------------------------------------
A0A4Q5J5D7      ----------------------MSA-----------------------------------
A0A1Y4CKD6      ------------------TS----------------------------------------
A0A0Q7KBQ4      ------------------TS----------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A7I7UD03      ------------------------------------------------------------
A0A7I7MI62      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      ------------------------------------------------------------
A0A7I9ZLK4      ------------------------------------------------------------
A0A1F1IHY9      ------------------VV----------------------------------------
A0A7H2BCD6      ------------------TV----------------------------------------
A0A3S0V9U6      ------------------TLGKSED-----------------------------------
A0A7T4T4U7      ------------------TAGGG-------------------------------------
A0A1S2N0P2      ------------------TAGGG-------------------------------------
A0A0Q3BEY5      ------------------TAGGG-------------------------------------
A0A4R6Q3C6      ------------------TAGGG-------------------------------------
A0A7T3CHP7      ------------------TAGGG-------------------------------------
A0A7Y5U6C1      ------------------NR-QN-------------------------------------
A0A542HCT5      ------------------SA----------------------------------------
A0A537WNY9      ------------------TP----------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A2S8WHZ8      ------------------IA----------------------------------------
A0A1Y4CTD2      ------------------RV----------------------------------------
A0A3N3ZPU0      ------------------VT----------------------------------------
A0A359IQX7      ------------------VA----------------------------------------
A0A7W9IKV0      ------------------SG--H-------------------------------------
A0A1N7E3F1      ------------------SA--D-------------------------------------
A0A544ZKQ1      ------------------SA--D-------------------------------------
A0A5D0Q2X0      ------------------SA--D-------------------------------------
A0A5R8Z2E7      ------------------SA--D-------------------------------------
A0A0Q9LZR0      ------------------SA----------------------------------------
A0A1F1J417      ------------------TV----------------------------------------
A0A2A8D6P2      ------------------TV----------------------------------------
A0A1F0THV9      ------------------TV----------------------------------------
A0A5F0M6Y0      ------------------TV----------------------------------------
E3H5W1          ------------------TV----------------------------------------
A0A1F1QKB0      ------------------TV----------------------------------------
A0A509JY23      ------------------TV----------------------------------------
A0A448USF4      ------------------TV----------------------------------------
A0A7Z9A2N0      ------------------TI----------------------------------------
A0A433EDP2      ------------------TI----------------------------------------
A0A231VTW0      ------------------TI----------------------------------------
A0A433ECD0      ------------------TI----------------------------------------
A0A7T9UPU8      ------------------TI----------------------------------------
U7V3Z1          ------------------TI----------------------------------------
A0A6I3F378      ------------------DV----------------------------------------
A0A838H0S5      ------------------A---D-------------------------------------
A0A1S1CQC5      ------------------TV----------------------------------------
A0A1E9T6I0      ------------------TV----------------------------------------
A0A1F1GHA7      ------------------TV----------------------------------------
A0A1S1CAD0      ------------------TV----------------------------------------
G5ET14          ------------------TV----------------------------------------
A0A1E9DXX2      ------------------TV----------------------------------------
A0A1E8S156      ------------------TV----------------------------------------
A0A1E8S5S2      ------------------TV----------------------------------------
A0A1S1DFA8      ------------------TV----------------------------------------
A0A2I1Z490      ------------------TV----------------------------------------
A0A1F0DAA9      ------------------TV----------------------------------------
A0A1F0PHK9      ------------------TV----------------------------------------
A0A1F0VZG6      ------------------TV----------------------------------------
A0A1E9G8X4      ------------------TV----------------------------------------
A0A1E9IAW2      ------------------TV----------------------------------------
A0A1E9ZBC9      ------------------TV----------------------------------------
A0A1E9ZDP4      ------------------TV----------------------------------------
A0A1F0R6B5      ------------------TV----------------------------------------
A0A1F0Z7N5      ------------------TV----------------------------------------
A0A1F1D897      ------------------TV----------------------------------------
D2NP38          ------------------TV----------------------------------------
A0A1F1FV74      ------------------TV----------------------------------------
A0A1E9M791      ------------------TV----------------------------------------
A0A291DEI8      ------------------TV----------------------------------------
A0A1S1D5T1      ------------------TV----------------------------------------
A0A1E8TRD6      ------------------TV----------------------------------------
A0A1F0XT88      ------------------TV----------------------------------------
A0A1F1EVP5      ------------------TV----------------------------------------
C6R548          ------------------TV----------------------------------------
A0A0K2RXS2      ------------------TV----------------------------------------
A0A1F0KX60      ------------------TV----------------------------------------
A0A542I3V2      ------------------L---T-------------------------------------
A0A2T0UZ65      ------------------VT--G-------------------------------------
A0A0Q5M6Z7      ------------------QA--A-------------------------------------
A0A7G6YA19      ------------------QA--A-------------------------------------
A0A853CXS3      ------------------QA--A-------------------------------------
A0A7W8YB56      ------------------VA--G-------------------------------------
A0A1L2ZMV4      ------------------VA--G-------------------------------------
A0A7W8TSW5      ------------------VA--G-------------------------------------
A0A1R4JTI6      ------------------MVTAG-------------------------------------
A0A4R7TM52      ------------------SASAG-------------------------------------
A0A542XE74      ------------------VA--G-------------------------------------
A0A0Q7QDF6      ------------------QP----------------------------------------
A0A7X7XPM3      ------------------------------------------------------------
A0A5R8L819      ------------------AA--T-------------------------------------
A0A7K0PFV4      ------------------TPFAG-------------------------------------
A0A0G3V3F3      ------------------TPS---------------------------------------
A0A7K0MUQ7      ------------------TPS---------------------------------------
A0A7K0U619      ------------------TPS---------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      ------------------N-----------------------------------------
A0A1Q2CJ92      ------------------VA--G-------------------------------------
A0A2T0S3C8      ------------------T---T-------------------------------------
A0A810MDE3      ------------------T---T-------------------------------------
A0A4Y8WZJ3      ------------------VV--G-------------------------------------
A0A7X0KT97      ------------------ELVET-------------------------------------
A0A853DGU7      ------------------QV--G-------------------------------------
A0A7Z0A2Z7      ------------------S---T-------------------------------------
A0A285VUW0      ------------------AATDE-------------------------------------
A0A849PJI9      ------------------VA--G-------------------------------------
A0A2R7Z032      ------------------KV--G-------------------------------------
A0A6J4MTQ2      ------------------QV--G-------------------------------------
A0A1I0W453      ------------------RV--G-------------------------------------
A0A0Q6VV12      ------------------VV--G-------------------------------------
A0A495NTA9      ------------------VV--G-------------------------------------
A0A1H4LCS9      ------------------KV--G-------------------------------------
A0A4Q2RZP8      ------------------KV--G-------------------------------------
A0A0Q9QB08      ------------------KV--G-------------------------------------
A0A7Y9H290      ------------------RV--G-------------------------------------
A0A4Q2SA86      ------------------TV--G-------------------------------------
A0A4Z1C3Z0      ------------------QV--G-------------------------------------
A0A6V8KDX4      ------------------T---T-------------------------------------
A0A444BL03      ------------------RID-G-------------------------------------
A0A7V9PCQ0      ------------------LVPPR-------------------------------------
A0A4Y8X357      ------------------TVQGE-------------------------------------
R4LD52          ------------------T---T-------------------------------------
A0A4T2CD79      ------------------TL--M-------------------------------------
A0A6L6AM03      ------------------RVG-T-------------------------------------
A0A4Q2RU39      ------------------RVG---------------------------------------
A0A4Q2SK58      ------------------RVG---------------------------------------
A0A2N3YJR1      ------------------RVT-A-------------------------------------
A0A6G8FYB9      ------------------RVA-G-------------------------------------
A0A4Q4D742      ------------------S---T-------------------------------------
A0A1C6T1J1      ------------------T---T-------------------------------------
A0A2W2CFC8      ------------------T---T-------------------------------------
A0A2W2A4B0      ------------------SISGD-------------------------------------
A0A4Y9MDA5      ------------------AL--E-------------------------------------
A0A1H7N9P7      ------------------TL--E-------------------------------------
A0A1M7V0F8      ------------------AL--E-------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A838JYQ6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A7V8X3I0      ------------------------------------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A838JNW7      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      -----------------------------------------------TFFSAREQAE---
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      --------------------------------MSQIKSYP-------VLTTTQSVLQ---
A0A4Q5B0V3      --------------------------------MSQIKSYP-------VLTTTQSVLQ---
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      -----------------------------------------------------MLAQ---
A0A1H4I042      ----------------------MDTYQGNLLSQERVRSYT-------ILLTGEALAQ---
A0A4R7A6D9      ----------------------MDTYQGNLLSQERVRSYT-------ILLTGEALAQ---
A0A345NSU7      -----------------------------------------------MLQMSGSAVS---
A0A222TG79      ---------------------VQAAYQGSLASQQRIASYA-------QLASSDAVIS---
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ----------------------QPTSPATSLSGRAVESYA-------HVLGGTALEQ---
A0A1Q2CRV2      ------------------------MQAGSNYAANQVQSFA-------KVAKSGFVLT---
A0A261FE22      -------------------------TGASNGGSSPLASYA-------QLVQSDAVLE---
A0A7K0NRJ7      -------------------------GINADQATFLAKSYA-------LYAETPRVTA---
K6WHS4          -----------------------------LASAQRVASYA-------ELVDSDVIVS---
A0A7K0NTR2      -------------------------INNFGDTSVRGRDYDRLALLMTTGEVPQRVADAID
A0A1H6WL79      ---------------------LGLSLAGDSLAKSKAKGYQ-------SVGESILVAE---
A0A101LAM5      ---------------------LGMSLAGDSLAKSKAKGYQ-------SVGESILVAE---
A0A4Y3NEG0      ---------------------LGMSLAGDNLAKSKAKGYQ-------SVGESILIAE---
A0A1Q2CI19      --------------------------GAGYASLGRVALFI-------TTGEVPRNAA---
A0A512T3M3      --------------------------LPPSLPLGRIALYV-------TTGVVPVRVA---
W6JTW4          -----------------------------TVGLPRIAFFI-------TTGDIPQAAA---
A0A839J1M0      -----------------------------RASMARIALFI-------TTGEVPRRAA---
A0A8A4Z8K4      -----------------------------RASMARIALFI-------TTGEVPRRAA---
A0A0A0JTY0      -----------------------------APNLDRVALYL-------KTGEVPKRAA---
A0A0A0JXF2      -----------------------------TGNMGRIPLYM-------TTGEIPRRAA---
E6S8H2          -----------------------------ESPMGRIALYL-------TTGEIPQRAA---
A0A0A0JGH0      -----------------------------QVSVDRVVLYA-------KTGAIPTAAA---
N0E4U7          -----------------------------LVSIDRLALFI-------KTGEIPSRAA---
A0A0A0IYK2      -----------------------------NPNMGRIPLYM-------TTGEIPRRAA---
A0A0Q9L0H3      -----------------------------STNLGRIALYM-------TSGEVPKRAA---
A3TMK0          -----------------------------GSNLGRIALYL-------TTGEVPKRAA---
A0A543PXP1      -----------------------------TAQMGRIALYL-------TTGEIPRRAA---
A3TMH6          -----------------------------NSQLGRIALFL-------TTGDIPRGAA---
A0A6I2XCV4      ------------------------------------ANLS-------QVAFLLQSAE---
A0A5R8VLL6      ---------------------VSSLLAGDTLAKAKAKTYK-------SLAESRLVAD---
A0A3L7ADK2      ---------------------PSNAYSSEALSKSQAASYA-------TVATSLAVAE---
A0A538JQF8      ---RPNVEVGTLTITANDRDPKRAALIADTFADSLKTVLADQTTQRRQLQIDSQLKA---
A0A1H6YPK1      ------------------------EVGDAATVESRMAVYT-------RLATSDQVAA---
A0A0Q9TBP0      -----------------------SASSGTKIDADEVATQV-------QVVTSLPVSR---
A0A0G3V3M7      ------------------------ISSGSANTSVNGRDYDRLALLMITGEVPKRVAEAID
A0A6I3DD56      ------------------------ISNGSANTSVNGRDYDRLALLMTTGEVPKRVAEAID
A0A5Q2FA83      -------------------TGTNTGGGGYVLTTNDLGTYE-------QLVSSPVVMD---
A0A2R7MGI0      --------------------STGSALAGDQLALSKVKSFV-------DMGYWRSVAE---
A0A2T7WQY4      --------------------STGSALAGDQLALSKVKSFV-------DMGYWRSVAE---
A0A0Q5Q5L3      --------------------STGAALAGDQLALSKVKSFI-------DMGYWRSVAD---
A0A0Q6DVM4      --------------------STGAALAGDQLALSKVKSFI-------DMGYWRSVAD---
A0A1N7DLV3      --------------------STSSALAGGTLALSRVKSFI-------DMGYWKSVAE---
A0A1V2NSB5      --------------------STGSALAGGTLALARVKSFI-------DMGYWKSVAE---
A0A1R3WWR6      --------------------STGAALAGDQLALSKVKSFI-------DMGYWRSVAE---
A0A1G6GTN3      --------------------STGAALAGDQLALSKVKSFI-------DMGYWRSVAE---
A0A7W5GFA5      --------------------STGAALAGDQLALSKVKSFI-------DMGYWRSVAE---
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      --------------------STGAALAGDQLALSKVKSFI-------DMGYWRSVAE---
A0A2W6DK08      -----------------------------------VASTT-------LLVTAEPVAE---
A0A346XTB0      ----ELQGIVSARISAEEYVPRQAARIQSRAVLQEAADLIDNRISVGELGSNFDIESSAE
A0A542FTE6      ---------------------AGLALAAENLAKSKAKTYV-------ELAKSQAVAE---
A0A7Y9QM02      ---------------------AGLALAAENLAKSKAKTYV-------ELAKSQAVAE---
A0A6I1G2U1      ------------------------DEPAGAVSLDRVVLYM-------TTGEVPALAA---
A0A351ETF8      SPPEVKVAAAGTGSTLTFNARGAVPEDLAAAANVWAQTYV-------TARYAETLAQNVE
A0A349B7N2      -----------------------------------PPNLA-------QLSLLLRVGD---
A0A4Q2JUT1      ---------------------VSNVSLGDSVARSRVPSYL-------VMAGWTDVAQ---
A0A6L5R0V7      ---------------------VVNASLGDSVARSRVPSYL-------VMAGWTDVAQ---
A0A2S0LQ32      -------------------------WSANSVAQQKAGVFA-------KLAGSAAVAQ---
A0A7T8DZN6      -------------------------WSANSVAQQKAGVFA-------KLAGSAAVAQ---
A0A2N6V1R5      -------------------------FSQNSISGQKASVYA-------VLAGSQNVAN---
G9PHS6          -------------------------FSQNSISGQKASVYA-------VLAGSQNVAN---
U1PLM7          -------------------------FSQNSISGQKASVYA-------VLAGSQNVAN---
A0A4V1VGV9      ---------------------ANSAVLSQQLSTGRAGYYA-------QLASSSGVAN---
A0A2S5UYV0      ----------------------GGYIGGSEAAIAKAQSYI-------PLITSQPVYA---
A0A7W4UQ09      -----------------------GFFSGSEASIAKANSYL-------ALINSKPVYD---
A0A2S5X9U6      ----------------------LGYINGSEAAIAKANSYI-------PLITSQPVYA---
A0A2S5ULV5      ----------------------FSSIDGSEQAITKANSYL-------PLITSQPVYA---
A0A653YMF0      ----------------------LGYINGSEAAIAKANSYL-------PLITSQPVYN---
A0A7V9H755      -----DAMLERASRAYSGFRSGRQVFSSTQKAGAQEAGLVDIDMRRAELDAEKRTYE---
A0A3Q9IY80      ----------------LSGNDAGSALVAENLAKAKVGSYL-------DLGSWRAVAE---
A0A0F0LP73      -----------------------AVIAGTNIAIDRAGAYM-------PLVDTAQVRE---
A0A346Y185      ----LFGETGVNFLDPSRYVRNQAEFAQSNAVAERASVLLGGRLDSDQVREQSRIRPASD
A0A7W0HGW1      VAAKRIDSVEITGLPTADAVQFRITSENRQVAQNAAQAYA-------DVYVDSRRTEIAD
A0A259S8H9      ----------------AV-----IAGSDEAVAR--AGAYM-------PLINTSQVRD---
A0A2W1Z497      ----------------AN-----LDYAADQLSKSQAETYV-------ELGGSLAVAK---
A0A0Q5L115      ----------------AN-----LAFAADQLAKSQAQSYV-------ELGGSLAVAE---
A0A7G6YY64      ----------------AN-----LAFAADQLAKSQAQSYV-------ELGGSLAVAE---
A0A7J5B4S5      -----------------------GLIGGSEAAVAKAQSYL-------PLITSRPVYE---
A0A852U976      -----------------------GFIGGSEAAVAKAQSYL-------PLITSRPVYE---
A0A1F1X071      ----------------ENGDPIQQASGNMEFQYSKAQSYL-------PLFNTRAVGQ---
A0A3R8RWC7      ----------------ENGDPIQQASGNMAFQYQKAQSYL-------PLFNTRAVGQ---
A0A4U0RJZ4      ----------------AS-----AAMVNQQLANQRSGAYA-------QLASGSGVAD---
A0A4R1FGL9      ----------------AS-----AAMVNQQLANQRSGAYA-------QLASGSGVAD---
E3B8H1          ----------------AS-----AAMVNQQLANQRSGAYA-------QLASGSGVAD---
A0A7D7WDT9      ------------------------VIAGSDAAVARAGSYT-------PLIDSAQVRE---
A0A0Q5AWK6      ----------------SA-----DAISGAQTAVTRANAYL-------PLISSSAVYE---
A0A6P1F176      ----------------SA-----DAISGAQTAVTRANAYL-------PLISSSAVYE---
A0A3N1NLD3      ----------------SA-----DAISGAQTAVTRANAYL-------PLISSSAVYE---
A0A3N2FVI8      ----------------SA-----DAISGAQTAVTRANAYL-------PLISSSAVYE---
A0A2S5XDQ6      ----------------SA-----DAISGSQTAVTRANAYL-------PLISSSAVSE---
A0A2S5XNN6      ----------------SA-----DAISGSQTAVTRANAYL-------PLISSSAVSE---
A0A5C8C085      -------------------------------------------------------NE---
A0A4Y5YMQ6      -----------------------------------MLSFA-------SLATSGAVLE---
A0A1E4BP96      ----------------SLAAETGSPLVGDQLARSKVTSYL-------DIGSWRAVAE---
A0A7V9FXS6      --------------------RADVPAAGTDSVRVLSPKYA-------AYVTSAPTRE---
A0A7W0PY69      --------------------RPDAPSAGADTVRVGAPKFV-------SFVEAPKTAA---
A0A7W8YB99      ------------------------------------------------MANSQRTGE---
A0A1L2ZMQ6      ----------------PKSSTVGEAIAGNSLAQDRAGSYA-------VMASSQRTAE---
A0A7W8TR75      ----------------PKSSTIGEAIAGNSLAQDRAGSYA-------VMASSQRTGE---
A0A151BT98      --------------------------QGTPVQRDDLATYA-------QVVSAPAVQK---
A0A2Y8ZRF8      --------------------------QGTPVQRDDLATYA-------QVVSAPAVQE---
A0A2R9UAT1      -------------------------MLANNLALSKVVSYV-------DIGSWRSVAE---
A0A3E2DN22      ----------------GDSTSVGEAMSGNAIAQQRAATYT-------KLVETRTMAQ---
A0A3Q9ULZ9      ----------------GDSSSVGGAMSGNTIAQQRASAYS-------TLIGTEAVDN---
A0A3S9JFL2      ----------------GDSSSVGGAMSGNTIAQQRASAYS-------TLVGTAAVDN---
A0A3L8NYD3      ----------------DSGDSVSDVYSATSLAQQKLSVYV-------GLVSSTAVAQ---
A0A1M6K628      ----------------GNSSTENAGAR--NPAAEKAATYL-------PLAESRSVAE---
A0A561E8R3      ----------------GGADNTGSALNGVSLAQTKAQEYA-------ALASSAPVAE---
A0A4Q5J5D7      ----------------GNDTNPALGSVADTLAKSRAKSYV-------DIARSRATAE---
A0A1Y4CKD6      -------------------GDGSSLYSSVSSASQLSKTFP-------YVLDSS-------
A0A0Q7KBQ4      -----------------PVGQQVTDPTAAYFASQRLASYA-------DLAREPSLLQ---
A0A5Q5BFU2      ---------------------MADTYQGNRFSQERVISYA-------ELLMGETLAQ---
A0A439DNZ6      -----------------------------------MISYT-------ELLMGETLAQ---
A0A7I7UD03      -----------------------------------MVSYA-------ELIMGQTLAQ---
A0A7I7MI62      -----------------------------------MVSYA-------ELIEGETLAQ---
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      --------------------------------------------------MGQTLAQ---
A0A7I9ZLK4      --------------------------------------------------MGETLAQ---
A0A1F1IHY9      ----------------GNSESLGVALTADNLAKSKAQQYA-------LLGESRAVSD---
A0A7H2BCD6      ----------------AGSAGIGDVISGNSAAKDKATGYL-------ALTNSRAVAE---
A0A3S0V9U6      ----------------PTTGSAGEILSGDAAAQSKAKAYL-------PLITSAPVAQ---
A0A7T4T4U7      -------------------SAVGDILSGDSAAQAKASAYL-------PLVTSGPVAK---
A0A1S2N0P2      -------------------SAVGDILSGDSAAQAKASAYL-------PLVTSGPVAK---
A0A0Q3BEY5      -------------------SAVGDILSGDSAAQAKASAYL-------PLVTSGPVAK---
A0A4R6Q3C6      -------------------SAVGDILSGDSAAQAKASAYL-------PLVTSGPVAK---
A0A7T3CHP7      -------------------SAVGDILSGDSAAQAKASAYL-------PLVTSGPVAK---
A0A7Y5U6C1      ----------------IAQTLTGTIDPTASDATRVLATQV-------ALARLPDVAK---
A0A542HCT5      ----------------GGATNPGEASVLDSLAKSRATSYV-------DLAQGRATAQ---
A0A537WNY9      -----------------------KTLNDPNSAYVFFGTLD-------AIVPVYADAA---
A0A5B8M469      ------------------------------------------------------------
A0A2S8WHZ8      ----------------GDSENIGNALAGDNLAKSKAVGYK-------SIAGTRTIAD---
A0A1Y4CTD2      --------------------KGADAYSSLAQASQMTAVYS-------EVFQSSALRN---
A0A3N3ZPU0      ----------------GNSNTLGDYMTADSVSLSKADSYM-------QLGGSPEVAQ---
A0A359IQX7      ----------------GNSNSIGDATAGMVLAEQKAAAYT-------ILTGTRQVSQ---
A0A7W9IKV0      ----------------DREGSLSTAYQAGMLSAQRVHSYA-------NLLSSRRVVS---
A0A1N7E3F1      ----------------AGDGGLSTALQAGALSQQRVQSYA-------ALLTSRQVVG---
A0A544ZKQ1      ----------------TREGGLSTALQAGALSQQRVQSYA-------TLLTSRQVIG---
A0A5D0Q2X0      ----------------ARDGGLSTALQAGALSQQRVQSYA-------TLLTSRQVVG---
A0A5R8Z2E7      ----------------ARDGGLSTALQAGALSQQRVQSYA-------TLLTSRQVVG---
A0A0Q9LZR0      ----------------GASSNPGEASVGDSLAKSRATSYV-------DLAKSRATAQ---
A0A1F1J417      -----------------GQSGTIDVLSGSNAAKERARSYS-------AIVSSEAVAK---
A0A2A8D6P2      -----------------GQSGTIDVLSGSNAAKERARSYS-------AIVSSEAVAK---
A0A1F0THV9      -----------------GQSGTIDVLSGSNAAKERARSYS-------AIVSSEAVAK---
A0A5F0M6Y0      -----------------GQSGTIDVLSGSNAAKERARSYS-------AIVSSEAVAK---
E3H5W1          -----------------GQSGTIDVLSGSNAAKERARSYS-------AIVSSEAVAK---
A0A1F1QKB0      -----------------GQSGTIDVLSGSNAAKERARSYS-------AIVSSEAVAK---
A0A509JY23      -----------------GQSGTIDVLSGSNAAKERARSYS-------AIVSSEAVAK---
A0A448USF4      -----------------GQSGTIDVLSGSNAAKERARSYS-------AIVSSEAVAK---
A0A7Z9A2N0      -----------------GSGGTIDVLSGSSAAKDRARSYS-------AIVSSEAVAK---
A0A433EDP2      -----------------GSGGTIDVLSGSSAAKDRARSYS-------AIVSSEAVAK---
A0A231VTW0      -----------------GSGGTIDVLSGSSAAKDRARSYS-------AIVSSEAVAK---
A0A433ECD0      -----------------GSGGTIDVLSGSSAAKDRARSYS-------AIVSSEAVAK---
A0A7T9UPU8      -----------------GSGGTIDVLSGSSAAKDRARSYS-------AIVSSEAVAK---
U7V3Z1          -----------------GSGGTIDVLSGSSAAKDRARSYS-------AIVSSEAVAK---
A0A6I3F378      ----------------SRNTSLFGPVAGAGDARRRLLNEI-------AIVTGVEVRL---
A0A838H0S5      ----------------PRTSGVFQDTGQTFIDPTRYVRNQ-------AEFATSTPVL---
A0A1S1CQC5      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1E9T6I0      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1F1GHA7      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1S1CAD0      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
G5ET14          -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1E9DXX2      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1E8S156      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1E8S5S2      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1S1DFA8      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A2I1Z490      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1F0DAA9      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1F0PHK9      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1F0VZG6      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1E9G8X4      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1E9IAW2      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1E9ZBC9      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1E9ZDP4      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1F0R6B5      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1F0Z7N5      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1F1D897      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
D2NP38          -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1F1FV74      -----------------GESGTVDVLSGSSAAKERARSYA-------AIVSSEAVAQ---
A0A1E9M791      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A291DEI8      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1S1D5T1      -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A1E8TRD6      -----------------GESGTVDVLSGSSAAKERARSYA-------AIVSSEAVAQ---
A0A1F0XT88      -----------------GESGTVDVLSGSSAAKERARSYA-------AIVSSEAVAQ---
A0A1F1EVP5      -----------------GESGTVDVLSGSSAAKERARSYA-------AIVSSEAVAQ---
C6R548          -----------------GESGTVDVLSGSTAAKERARSYA-------AIVSSEAVAQ---
A0A0K2RXS2      -----------------GESGTVDVLSGSSAAKERARSYA-------AIVSSEAVAQ---
A0A1F0KX60      -----------------GESGTVDVLSGSSAAKERARSYA-------AIVSSEAVAQ---
A0A542I3V2      ----------------VGSDSVNTLLTGDALAKSKIKNYE-------SIAESRLIAD---
A0A2T0UZ65      ----------------GGQN-TGDVFAGSTLAGSKAESYL-------PLINSRAVGK---
A0A0Q5M6Z7      ----------------TGES-LSMAFAGESLAKSRAESYV-------RVANSDAVAD---
A0A7G6YA19      ----------------TGES-LSMAFAGESLAKSRAESYV-------RVAKSDAVAK---
A0A853CXS3      ----------------TGES-LSMAFAGESLAKSRAESYV-------RVATSDAVAK---
A0A7W8YB56      ----------------GGNN-LGSYLSSETLATTKAETYL-------ALGSAPEVAA---
A0A1L2ZMV4      ----------------GGNN-LGSYLSAETLANTKAETYL-------ALGNAPEVSQ---
A0A7W8TSW5      ----------------GGNN-LGSYLSAETLANTKAETYL-------ALGNAPEVSQ---
A0A1R4JTI6      ----------------VNEN-LGIALTADNLAKSKATQYQ-------ELATSRAVAE---
A0A4R7TM52      ----------------SGSD-TGGALIADNLAKSKVKSYL-------DVGTWRSVAD---
A0A542XE74      ----------------STIS-VGDTMSGDTVTVSRASMYA-------SLVNTSAVAQ---
A0A0Q7QDF6      ------------------------TSPATSLSGRAVESYA-------HVLGGTALEQ---
A0A7X7XPM3      ---------------------FTSDVKGYMLTQSDLGTFT-------ELLGTPLIVN---
A0A5R8L819      ----------------VGGSDAGSALIGENLAKAKVKSYI-------DLGSWRAVAQ---
A0A7K0PFV4      ----------------EDSTLSGVRLLRNSGDPTRDVETA-------ITLLRGAGTD---
A0A0G3V3F3      ---------------------DTGLGINADQATFLAKSYA-------LYAETPRVTA---
A0A7K0MUQ7      ---------------------DTGLGINADQATFLAKSYA-------LYAETPRVTA---
A0A7K0U619      ---------------------DTGLGINADQATFLAKSYA-------LYAETPRVTA---
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      ---------------------AQSAAADGSTSDSRMGVVS-------RVATSSAVLE---
A0A1Q2CJ92      ----------------NSAT-VGDAFAGSTLAAEKAGTYL-------PLVQSRSVAN---
A0A2T0S3C8      ----------------PNNG-VTDAYQGGLFSQQRVKSYA-------TLLTGDRLAK---
A0A810MDE3      ----------------PNNG-VTDAYQGGLFSQQRVKSYA-------TLLTGDRLAK---
A0A4Y8WZJ3      ----------------NSES-LGVALTADNLAKSKAQQYA-------LLGESRAVSD---
A0A7X0KT97      ----------------NSDDVAANAIMSDSMARGKVATYL-------EMATWEPTAS---
A0A853DGU7      ----------------GTGN-IADTINGSQVAQQKAQAYT-------TLVGTLPVAN---
A0A7Z0A2Z7      ----------------PVTA-GTNAQSAGQYAEGRVASYA-------LLLQSQMLAD---
A0A285VUW0      ----------------AGES-SGNLY---QMPAGERSTLA-------RIARSPLMLD---
A0A849PJI9      ----------------SSAS-TGDAFSSMSLATSKAQQYA-------ALASSGPVAQ---
A0A2R7Z032      ----------------FSSS-AGEEMSNQSLASDKAALYV-------ALANTTPVAE---
A0A6J4MTQ2      ----------------NATS-AGEEAGNLALARDKAELYV-------TLVPTTPVAE---
A0A1I0W453      ----------------NAAT-AGEEQGNAQLAEDKANLYA-------FLVSKTPVAA---
A0A0Q6VV12      ----------------NATT-AGEEQGNAALAEEKAGLYA-------FLVSSMPVAE---
A0A495NTA9      ----------------NATS-AGEEQGNSALAEEKAGLYA-------FLVNSEPVAE---
A0A1H4LCS9      ----------------NATT-AGEEQNNAQLAEDKANLYA-------FLVSKLPVAQ---
A0A4Q2RZP8      ----------------NATT-AGEEQGNAQLAEDKANLYA-------FLVSKLPVAQ---
A0A0Q9QB08      ----------------EAGS-AAEEQGNASLAEDKANLYA-------FLVPTTPVAE---
A0A7Y9H290      ----------------QATT-AGEEQGNSQLAEDKATLYA-------FLVSTTPVAE---
A0A4Q2SA86      ----------------NATT-AGEEQGNAQLAEDKAVLYA-------FLVSTTPVAE---
A0A4Z1C3Z0      ----------------NAAS-AAEEQGNAQLAEDKAVLYA-------YLVSTTPVAE---
A0A6V8KDX4      ----------------PSQG-LSDAYQGGLFSAQRVTSYA-------TLLEGDRLAQ---
A0A444BL03      ----------------AGAS-TGESIAANSLGGSKADSYL-------PLVTSRAVAQ---
A0A7V9PCQ0      ----------------EGFS-PNP----TSIIDAEMPVLE-------VRATSRSFRN---
A0A4Y8X357      ----------------AS-------ISGTETAQTRAQSYV-------PLINSRTVRE---
R4LD52          ----------------PNTG-VTDAYQGGLFSQQRVKSYA-------SLLVSDRLAQ---
A0A4T2CD79      ----------------SDGS-IGDTVASDALAKSKATTYV-------AVGESRAVAQ---
A0A6L6AM03      ----------------NVQS-AGEEQGNATLAEDKANLYA-------FLVSTTPVAE---
A0A4Q2RU39      ----------------NAES-AGEEQGNNQVAEDKANLYA-------FLVSKTPVAQ---
A0A4Q2SK58      ----------------AAST-AGEEQSNSQLAEDKANLYA-------FLVTKTPVAA---
A0A2N3YJR1      ----------------AGSS-TGEGIAANALSGSKADSYL-------PLVTSRAVAQ---
A0A6G8FYB9      ----------------SGTS-TGDSLAANSLGGSKADSYL-------PLVTSRAVAE---
A0A4Q4D742      ----------------PGGG-QTE-YVAAYTLQQRVASYA-------DLAVDPAVLQ---
A0A1C6T1J1      ----------------PSEG-VAAAYQGGLFLQQRIKSYA-------DLLVSDRLAQ---
A0A2W2CFC8      ----------------PSQG-VSDAYQGGLFLQQRVKSYE-------QLLTSDRLAR---
A0A2W2A4B0      ----------------AESS-ALDLAQGTNAAQQRIHSYL-------DLVPQPIVLQ---
A0A4Y9MDA5      ----------------SGNS-AGDLAQGSNYLQGQVTSFA-------LLAETPTVLG---
A0A1H7N9P7      ----------------YGDS-AGDLAQGSNYLQSQVASFA-------LLAETPTVLG---
A0A1M7V0F8      ----------------YGDS-AGDLAQGSNYLQSQVSSFA-------LLAGTPTVLG---
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A838JYQ6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A7V8X3I0      ------------------------------------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A838JNW7      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ---------------------R-----------------DRALRGQI-------------
A0A348NU28      ------------------------------------------MARSI----------EVT
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------------PVIEDLGLHTT----VAQLKEQV----------SVT
A0A4Q5B0V3      ------------------------PVIEDLGLHTT----VAQLKEQV----------SVT
A0A022KX11      ---------------------------------------MAGEFSTL-------------
A0A4Q5A868      ---------------------------------------MAQLKEQV----------SVT
A0A6N4VXX3      ------------------------RTVDALHLDMS----AQALRKEV----------TAR
A0A1H4I042      ------------------------RTIDALHLDMS----ARALRQEV----------SAR
A0A4R7A6D9      ------------------------RTIDALHLDMS----ARALRQEV----------SAR
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      ------------------------NAVSESRKSIS----SEDVRKKL----------STS
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ---------------------M-----------------------------------TTT
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ---------------------R--AVKALGLEDAG----DAEVRGEV-------------
A0A1Q2CRV2      ------------------------PVIEDLQLSVT----PEQLARRV----------AVT
A0A261FE22      ------------------------PVVNNLGLHTS----VAGLRGNV----------SAS
A0A7K0NRJ7      ------------------------AAAKSSGLNIT----ANDAASLI----------SAS
K6WHS4          ------------------------RALESTGVGLK----QDEAKDSL----------SVS
A0A7K0NTR2      KVRWPQIQAAESAACATTGERS--KSSNCPRSRRP----VKAGTSVVSLGYQGFIKASAV
A0A1H6WL79      ------------------------SVIRTLGLKES----APDITRSI----------SVS
A0A101LAM5      ------------------------SVIKSLGLKES----APDVTRSI----------SVS
A0A4Y3NEG0      ------------------------SVIESLGLKES----APDITRSV----------SVS
A0A1Q2CI19      ---------------------------AALGYEGD----PALLAKQI----------TVE
A0A512T3M3      ---------------------------KKVGFVGQ----PTELAGRI----------DVG
W6JTW4          ---------------------------DKLKYADG----PFALARRI----------VVA
A0A839J1M0      ---------------------------QRLNYTGD----PAVLASGI----------IVA
A0A8A4Z8K4      ---------------------------QRLNYTGD----PAVLASGI----------IVA
A0A0A0JTY0      ---------------------------KKVGYEGD----PAVLASGL----------TVV
A0A0A0JXF2      ---------------------------AVVGYEGD----PARLAAGL----------TVT
E6S8H2          ---------------------------AELGYTGD----PAVLASGL----------TVT
A0A0A0JGH0      ---------------------------KALEFEGD----PAILASQV----------TIT
N0E4U7          ---------------------------KVLSFDGD----PALLASQI----------TVT
A0A0A0IYK2      ---------------------------AAVGYDGD----PALLARGL----------TVT
A0A0Q9L0H3      ---------------------------ARVDFTGD----PALLASGL----------TVT
A3TMK0          ---------------------------AVVKFEGD----PALLARGL----------TVT
A0A543PXP1      ---------------------------AKLGYTGD----PAMLASGL----------TVT
A3TMH6          ---------------------------KRLGYPGD----PALLAAGL----------TVK
A0A6I2XCV4      ---------------------V--QGQIATAMNLP----VETLRGLI----------AAQ
A0A5R8VLL6      ------------------------KVSASTGVNMT----GESLLGAV----------TVT
A0A3L7ADK2      ------------------------RVEKAGVVKQS----AGVLLGRI----------TAL
A0A538JQF8      -------AEQIQGQINDINLQI--ARAPDAGTVAA----LQARRQPL----------QVR
A0A1H6YPK1      --------------------------VVAESIGGD----ADALRSRI----------SVS
A0A0Q9TBP0      ---------------------L--VQ--ERFSLAS----PPDLSELV----------SVQ
A0A0G3V3M7      EVRWPQIQNANANKCTETGADA--TSPDCKKSGRR----VSAGSGQVELGTGGFIKASAI
A0A6I3DD56      EVRWPQIQSATANKCAETGADS--SSPDCKKSGRP----VSAGSGQVQLGTGGFIKASAT
A0A5Q2FA83      -----------------------------------------PLRQQLKLAPSTPLNVTAK
A0A2R7MGI0      ------------------------AARQTLGVNDS----PESLVQRV----------RVS
A0A2T7WQY4      ------------------------AARESLGVEDS----PESLVQRV----------RVS
A0A0Q5Q5L3      ------------------------TARQQLGLSDS----PEALVERI----------RVS
A0A0Q6DVM4      ------------------------TARQQLGLSDS----PEALVERI----------RVS
A0A1N7DLV3      ------------------------TARDELGLTDS----PESLVQRI----------RVS
A0A1V2NSB5      ------------------------TARDELGLTDS----PESLVQRV----------HVS
A0A1R3WWR6      ------------------------TARTELGITDS----PEALVQRV----------HVS
A0A1G6GTN3      ------------------------TARQDLGLSDP----AESLVQRI----------RVS
A0A7W5GFA5      ------------------------TARGELGISDS----PESLVQRV----------RVS
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------TARGELGLSDS----PESLVQRV----------RVS
A0A2W6DK08      --R------------------V--SK--MLNTHHA----PQDLLLKV----------TAV
A0A346XTB0      TLE------------------I--VLVAEDETAEG----AAELVNAVAEAYRTQKRAQEV
A0A542FTE6      ---------------------S--VA--EAIGSSS----PGSLLAAT----------TPY
A0A7Y9QM02      ---------------------S--AA--EAIGSSS----PGALLGAT----------TPY
A0A6I1G2U1      --Q-------------------------QVGYTRE----PALLANQL----------TVT
A0A351ETF8      SIE------------------F--LQALIAEIAED----RDAIRVEVDFYDDLLAETTDP
A0A349B7N2      ---------------------V--PERVAAEFGVE----PDVLVSQV----------QVR
A0A4Q2JUT1      --G------------------V--ID--DLDLSTT----PEALIQRV----------TVE
A0A6L5R0V7      --G------------------V--ID--DLELTTT----PEALIQRV----------TVD
A0A2S0LQ32      --S------------------V--SQ------SLG----LQDLGGSL----------TGA
A0A7T8DZN6      --S------------------V--SQ------SLG----LQDLGGSL----------TGA
A0A2N6V1R5      --R------------------V--AK------TLK----TSNMEGTL----------SGS
G9PHS6          --R------------------V--AK------TLK----TSNMEGTL----------SGS
U1PLM7          --R------------------V--AK------TLK----TSNMEGTL----------SGS
A0A4V1VGV9      --R------------------I--AEESKGSLRAG----EFSVVGAS-------------
A0A2S5UYV0      --K------------------I--AENPALGLAEG-----QALTGRL----------SAS
A0A7W4UQ09      --K------------------I--AANPNSGLAEG-----ETLNGRL----------SAV
A0A2S5X9U6      --K------------------I--AENPDSGLAEG-----ETLNGRL----------SAT
A0A2S5ULV5      --K------------------I--AENPNSGLAAG-----ETLTGRL----------SAT
A0A653YMF0      --K------------------I--AENPNSGLAAG-----ETLNGRL----------SAT
A0A7V9H755      --RLLAQGRTSGEKVGSSLRVL--VSSPGIATNPV----VTQLYGQLTDYEKKRDDLISA
A0A3Q9IY80      --H------------------A--IA--ELGLTSS----PESLVNRV----------QVS
A0A0F0LP73      --E------------------I--AK----DAKVP----LSKLNGSL----------SAQ
A0A346Y185      LDQ------------------L--SISATDGTASG----AAQIANAIGEAYQAVVREEAE
A0A7W0HGW1      LTR------------------V--QTEKLDGDAAG----IKEEISGI----------DRR
A0A259S8H9      --E------------------I--AK--EAG--VS----AAELHGSL----------SAR
A0A2W1Z497      --R------------------V--VR--ATGTSAS----PQELLGRV----------QTR
A0A0Q5L115      --S------------------A--AA--ALGGAAS----PASLLGRV----------TTS
A0A7G6YY64      --S------------------A--AA--ALGGAAS----PASLLGRV----------TTS
A0A7J5B4S5      --K------------------I--AQNPDSGLAEG-----QTLTGRL----------TAS
A0A852U976      --K------------------I--AQNPDSGLAEG-----QTLTGRL----------TAS
A0A1F1X071      --R------------------I--VD--ELGLEAS----PDEVAGSL----------QTT
A0A3R8RWC7      --R------------------I--VD--ELGLEAS----PDAVAGSL----------QTT
A0A4U0RJZ4      --R------------------V--VALSNGALSPG----DFVLAG--------------A
A0A4R1FGL9      --R------------------V--VALSKGALSPG----DFVLAG--------------A
E3B8H1          --R------------------V--VALSKGALSPG----DFVLAG--------------A
A0A7D7WDT9      --A------------------I--AK--EAGVDVS----D--LSGAL----------SAD
A0A0Q5AWK6      --R------------------I--QS--DPEANPG----GEALNGRL----------TAS
A0A6P1F176      --R------------------I--EA--DPEANPG----GERLNGRL----------TAA
A0A3N1NLD3      --R------------------I--ES--DPEANPG----GEPLNGRL----------TAA
A0A3N2FVI8      --R------------------I--ES--DPEANPG----GEPLNGRL----------TAA
A0A2S5XDQ6      --R------------------I--EA--DPEANPG----GEALSGRL----------TAR
A0A2S5XNN6      --R------------------I--EA--DPEANPG----GEALSGRL----------TAR
A0A5C8C085      ---------------------S-----------------PASLIGRI----------SAE
A0A4Y5YMQ6      ---------------------P--VVEDLAEAGIDIS--LPQLRRAV----------AVT
A0A1E4BP96      ---------------------H--AIEDL-GLSAS----PESLVGNV----------TVS
A0A7V9FXS6      ---------------------L--VGSRIGES-------AGTLGSAI----------DAG
A0A7W0PY69      ---------------------Q--VSAEVGES-------RATLEESV----------NAT
A0A7W8YB99      ---------------------R--AVKKLTEQGLTNLPPAATLAGMI----------TAE
A0A1L2ZMQ6      ---------------------R--AVEKLEKQGVADVPDAGSLISSI----------TAA
A0A7W8TR75      ---------------------R--AVEKLTELGVADVPPAGALIGSI----------TAA
A0A151BT98      ---------------------V--IRQQA----KL----GPSVPVTV----------SAT
A0A2Y8ZRF8      ---------------------V--IRKQA----KV----GPTAAVNV----------NAT
A0A2R9UAT1      ---------------------Y--AIEKL-RLDSS----PEALVRRV----------DVT
A0A3E2DN22      ---------------------K--TSEIL-KKHGM----PEAANGQV----------SAS
A0A3Q9ULZ9      ---------------------R--VQKTL-GSKGL----SKAADGTL----------AAK
A0A3S9JFL2      ---------------------R--VRATL-NKQGL----SKATDGTL----------SAK
A0A3L8NYD3      ---------------------D--VIDSL-KLDET----PSDIASRF----------SAV
A0A1M6K628      ---------------------T--VAQEL-----G------VQSGEV----------SLD
A0A561E8R3      ---------------------R--AAQAL-----G----PNAPGGSI----------SAS
A0A4Q5J5D7      ---------------------G--VIDEL-GLDDS----PASLIGKI----------SVE
A0A1Y4CKD6      ------------------------YFRGVLEDALG----TDSLDGTI----------EAQ
A0A0Q7KBQ4      ---------------------D--VINRLNLTGVT----REELAGQV----------TAQ
A0A5Q5BFU2      ---------------------R--TIDKL-GLDMT----AQALQENV----------KAG
A0A439DNZ6      ---------------------R--TIDKL-DLEMS----AGELQNKV----------KAS
A0A7I7UD03      ---------------------R--TIDKL-GLDMS----AEDLQAHV----------KAS
A0A7I7MI62      ---------------------R--TIDKL-GLDAS----AKDLQANV----------KAS
A0A0J6YE86      ---------------------------------MS----ADELQARI----------TAT
A0A7I7K1R9      ---------------------R--TVDKL-GLNMS----AAELQENV----------TAS
A0A7I9ZLK4      ---------------------R--TIDKL-GLDMK----ADSLRQHV----------NAS
A0A1F1IHY9      ---------------------K--AVEEL-PFDLS----SGEALRNV----------EVA
A0A7H2BCD6      ---------------------R--IASENPDLGMS----AGEIAGNL----------TAS
A0A3S0V9U6      ---------------------K--IASSS-KTSLD----AAAIPSHL----------EPS
A0A7T4T4U7      ---------------------K--IAENN-SVGID----ESAIPSHL----------SAS
A0A1S2N0P2      ---------------------K--IAENN-SVGID----ESAIPSHL----------SAS
A0A0Q3BEY5      ---------------------K--IAENN-SVGID----ESAIPSHL----------SAS
A0A4R6Q3C6      ---------------------K--IAENN-SVGID----ESAIPSHL----------SAS
A0A7T3CHP7      ---------------------K--IAENN-SVGID----ESAIPSHL----------SAS
A0A7Y5U6C1      ---------------------RALALAGTDGSGLT----PPRFLRHT----------SVT
A0A542HCT5      ---------------------D--VIKTL-GLDAQ----PAGLIGRI----------TVK
A0A537WNY9      ---------------------A--ARSTKERASAL----LGRSVAAI----------SVE
A0A5B8M469      ------------------------------------------------------------
A0A2S8WHZ8      ---------------------L--VRKEL-KLDES----SDVLLGKV----------EVT
A0A1Y4CTD2      ---------------------E--ISASV----------GEPVEGSV----------SCS
A0A3N3ZPU0      ---------------------I--AAESL----------DGTPVHDV----------AFS
A0A359IQX7      ---------------------D--VADGL--RSKY----GKDVPFSL----------SPG
A0A7W9IKV0      ---------------------Q--ITHPG-----D----VGRVQANI----------TAE
A0A1N7E3F1      ---------------------R--IAGGE-----D----VADVQARI----------TAN
A0A544ZKQ1      ---------------------R--IARGE-----A----VDDLQARI----------TAG
A0A5D0Q2X0      ---------------------R--IARGE-----D----VTDLQARI----------TAD
A0A5R8Z2E7      ---------------------R--IARGE-----D----VTDLQARI----------TAD
A0A0Q9LZR0      ---------------------D--VINTL-GLGAQ----PAGLIGSI----------TVT
A0A1F1J417      ---------------------I--IQEQNSD--LS----IGTIRGSL----------SAT
A0A2A8D6P2      ---------------------I--IQEQNSD--LS----IGTIRGSL----------SAT
A0A1F0THV9      ---------------------I--IQEQNSD--LS----IGTIRGSL----------SAT
A0A5F0M6Y0      ---------------------I--IQEQNSD--LS----IGTIRGSL----------SAT
E3H5W1          ---------------------I--IQEQNSD--LS----IGTIRGSL----------SAT
A0A1F1QKB0      ---------------------I--IQEQNSN--LS----IGTIRGSL----------SAT
A0A509JY23      ---------------------I--IQEQNSD--LS----IGTIRGSL----------SAT
A0A448USF4      ---------------------I--IQEQNSD--LS----IGTIRGSL----------SAT
A0A7Z9A2N0      ---------------------I--IQEKNPNMGMT----VSGIRGSV----------TAS
A0A433EDP2      ---------------------I--IQEKNPNMGMT----VSGIRGSV----------TAS
A0A231VTW0      ---------------------I--IQEKNPNMGMT----VSGIRGSV----------TAS
A0A433ECD0      ---------------------I--IQEKNPNMGMT----VSGIRGSV----------TAS
A0A7T9UPU8      ---------------------I--IQEKNPNMGMT----VSGIRGSV----------TAS
U7V3Z1          ---------------------I--IQEKNPNMGMT----VSGIRGSV----------TAS
A0A6I3F378      ---------------------G--VQQ---QLHLS----SPPPRAKF----------NTS
A0A838H0S5      ---------------------D--VARAIVGSDLP----LDDLRERV----------TVQ
A0A1S1CQC5      ---------------------K--IKQNTPELSLT----TGQIRSSL----------TAT
A0A1E9T6I0      ---------------------K--IKQNTPELSLT----TGQIRSSL----------TAT
A0A1F1GHA7      ---------------------K--IKQNTPELSLT----TGQIRSSL----------TAT
A0A1S1CAD0      ---------------------K--IKQNTPELSLT----TGQIRSSI----------TAA
G5ET14          ---------------------K--IKQNTPELSLT----TGQIRSSI----------TAA
A0A1E9DXX2      ---------------------K--IKQNNPELSMT----TGQIRGSL----------TAT
A0A1E8S156      ---------------------K--IKQNNPELSMT----TGQIRGSL----------TAT
A0A1E8S5S2      ---------------------K--IKQNNPELSMT----TGQIRGSL----------TAT
A0A1S1DFA8      ---------------------K--IKQNNPELSMT----TGQIRGSL----------TAT
A0A2I1Z490      ---------------------K--IKQNTPELSLT----TGQIRSSL----------TAT
A0A1F0DAA9      ---------------------K--IKQNNPELSLS----TGQIRSSL----------TAT
A0A1F0PHK9      ---------------------K--IKQNNPELSLS----TGQIRSSL----------TAT
A0A1F0VZG6      ---------------------K--IKQNNPELSLS----TGQIRSSL----------TAT
A0A1E9G8X4      ---------------------K--IKQNNPELSMT----TGQIRASL----------TAT
A0A1E9IAW2      ---------------------K--IKQNNPELSMT----TGQIRASL----------TAT
A0A1E9ZBC9      ---------------------K--IKQNNPELSMT----TGQIRASL----------TAT
A0A1E9ZDP4      ---------------------K--IKQNNPELSMT----TGQIRASL----------TAT
A0A1F0R6B5      ---------------------K--IKQNNPELSMT----TGQIRASL----------TAT
A0A1F0Z7N5      ---------------------K--IKQNNPELSMT----TGQIRASL----------TAT
A0A1F1D897      ---------------------K--IKQNNPELSMT----TGQIRASL----------TAT
D2NP38          ---------------------K--IKQNNPELSMT----TGQIRASL----------TAT
A0A1F1FV74      ---------------------K--IKQNNPDLSLT----TGQIRASL----------TAT
A0A1E9M791      ---------------------K--IKQNNPELSMT----TGQIRASL----------TAT
A0A291DEI8      ---------------------K--IKQNNPELSMT----TGQIRASL----------TAT
A0A1S1D5T1      ---------------------K--IKQNTPELSLT----TGQIRSSL----------TAT
A0A1E8TRD6      ---------------------K--IKQNNPELSLT----TGQIRASL----------TAT
A0A1F0XT88      ---------------------K--IKQNTPELSLT----TGQIRASL----------TAT
A0A1F1EVP5      ---------------------K--IKQNNPELSLT----TGQIRASL----------TAT
C6R548          ---------------------K--IKQNTPELSLT----TGQIRSSL----------TAT
A0A0K2RXS2      ---------------------K--IKQNNPELSLS----TGQIRASL----------TAT
A0A1F0KX60      ---------------------K--IKQNNPELSLS----TGQIRASL----------TAT
A0A542I3V2      ---------------------Q--VIATV-GLNTT----ADALLPTV----------SVN
A0A2T0UZ65      ---------------------R--AGEII-GSDAP----PEVLAARV----------AGS
A0A0Q5M6Z7      ---------------------R--ARKIL-GTDRS----IGDLLGHI----------QAS
A0A7G6YA19      ---------------------R--AQDIL-NTDRS----ISDLLGHI----------TTT
A0A853CXS3      ---------------------R--AQEAL-GTDRS----ISDLLAHI----------TAT
A0A7W8YB56      ---------------------L--VSKHF--AEQG----KSVSWTSV----------AFA
A0A1L2ZMV4      ---------------------L--VSKHF--AEEG----QAVSWKGV----------TFT
A0A7W8TSW5      ---------------------L--VSKHF--AEEG----QAVSWKGV----------TFT
A0A1R4JTI6      ---------------------G--AVKQA-GLDIS----PEAASGAV----------TAT
A0A4R7TM52      ---------------------D--AISQL-GLNTQ----PEALVRQV----------KVT
A0A542XE74      ---------------------R--ADRTLASQGIT----RD---GTV----------TAT
A0A0Q7QDF6      ---------------------R--AVKAL-GLEDA----GDA---EV----------RGE
A0A7X7XPM3      ---------------------P--IREQL---ELA----PGTTLG-L----------RGS
A0A5R8L819      ---------------------H--AIDEL-GLKVT----PEYLVNRV----------AVT
A0A7K0PFV4      ---------------------D--TTARVLGRGTT----RKDVRERV----------ALE
A0A0G3V3F3      ---------------------A--AAKSS-GLDIT----ANDAASLI----------SAS
A0A7K0MUQ7      ---------------------E--AAKSS-GLNIT----ANDAASLI----------SAS
A0A7K0U619      ---------------------E--AAKSS-GLNIT----ANDAASLI----------SAS
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      --------------------------KSS-GLNIT----ANDAASLI----------SAS
A0A7K0V140      ------------------------AAKSS-GLNIT----ANDAASLI----------SAS
A0A261FQA1      ---------------------P--VIDEL-DLDTS----VDAMASSV----------SAS
A0A1Q2CJ92      ---------------------R--IAEEL-ALP-S----TGPVVGNL----------EGS
A0A2T0S3C8      ---------------------V--VAAKTPGLELT----PAEVRERI----------TAE
A0A810MDE3      ---------------------V--VAAKTPGLELT----PAEVRERI----------TAE
A0A4Y8WZJ3      ---------------------K--AVEEL-PFDLS----SGEALRNV----------EVA
A0A7X0KT97      ---------------------A--AVEIA-GLNMS----PTAANNRV----------TVA
A0A853DGU7      ---------------------E--VSKAT---GIP----VGRIAGHI----------TAS
A0A7Z0A2Z7      ---------------------R--VAADT---GIP----AESIYSTI----------TAT
A0A285VUW0      ---------------------P--VRETL-GLDAS----VPLSVEAV----------PGG
A0A849PJI9      ---------------------A--AAKTA-GVPVG--------AGSI----------SAA
A0A2R7Z032      ---------------------R--VVEKL-GLDVD----PGAIAGRF----------SAS
A0A6J4MTQ2      ---------------------R--VVEEL-SLDLP----PSAVASRF----------TAS
A0A1I0W453      ---------------------Q--VVEDL-DLDVP----PEAIAGRF----------SAS
A0A0Q6VV12      ---------------------K--VVDDL-GLDVP----PSEIAGRF----------SAT
A0A495NTA9      ---------------------K--VVEDL-GLSTP----PSEIAGRF----------TAT
A0A1H4LCS9      ---------------------L--VVDDL-GLDVP----PEAIAGNF----------SAS
A0A4Q2RZP8      ---------------------L--VVDDL-GLDVP----PEAIAGNF----------SAS
A0A0Q9QB08      ---------------------Q--VVKEL-GLDMP----PSAIASRF----------SAT
A0A7Y9H290      ---------------------Q--VVEDL-GLDVP----PSAIAGRF----------SGS
A0A4Q2SA86      ---------------------K--VVEDL-GLDVP----PSAIAGRF----------SAS
A0A4Z1C3Z0      ---------------------R--VVEDL-GLDVP----PSAIAGRF----------SAS
A0A6V8KDX4      ---------------------A--IAADA-SLGLS----PRQVQERI----------TAR
A0A444BL03      ---------------------R--AITAT-GIDAS----PEDVARRV----------TGT
A0A7V9PCQ0      ---------------------R--VRQDLAEAEPD----AAGIPVSI----------AVL
A0A4Y8X357      ---------------------R--ISQG------G----VDTAGASL----------SAA
R4LD52          ---------------------L--VAAEP-GVGLD----ARHIRERV----------AAQ
A0A4T2CD79      ---------------------L--VITAL-GLTAS----PETVAGEI----------TVT
A0A6L6AM03      ---------------------Q--VVEDL-DLAIP----PSAIAGRF----------SAS
A0A4Q2RU39      ---------------------E--VVDEL-GLDVP----PSAIAGRF----------SAT
A0A4Q2SK58      ---------------------E--VVDDL-GLDVP----PEAIAGRF----------SAS
A0A2N3YJR1      ---------------------R--AIEAT-GVKAS----PASVASRV----------TAS
A0A6G8FYB9      ---------------------R--AIAAT-GIDAS----PAEVAGRV----------GAS
A0A4Q4D742      ---------------------T--VVDRL-NLDES----PTQLAGQI----------SAT
A0A1C6T1J1      ---------------------S--VVAEG-QVGLT----AEQIQGRV----------STS
A0A2W2CFC8      ---------------------S--VVADN-QLGLT----AEQVRGRI----------STS
A0A2W2A4B0      ---------------------P--VIDEL-HLDVK----ASELARSV----------SAT
A0A4Y9MDA5      ---------------------P--AGEAP-DVAA-----TGSLAGQV----------TAT
A0A1H7N9P7      ---------------------P--AGEAP-DVAAG----SRSLAAQV----------SAS
A0A1M7V0F8      ---------------------P--AGERA-GVSAD----ARSLAGRV----------TAT
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ---------------------IEKVIDSNIATDTG----NMRVVCRL----------PDP
A0A538AM15      ---------------------MSKFFKALEQAERD----RALQQGRA----------PEA
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A838JYQ6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A7V8X3I0      ------------------------------------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A838JNW7      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ---------------------------------------------------------MAK
A0A538BYZ4      ---------------------------------------------------------ESS
A0A348NU28      IPLNTVILEIKS--------SSGDPESAAEIANGVADS-------------------LTA
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      NPTNTAFVNISV--------TDGNPAQAADIANAIAKS-------------------LSS
A0A4Q5B0V3      NPTNTAFVNISV--------TDGNPAQAADIANAIAKS-------------------LSS
A0A022KX11      ---------------------------------------------------------LKS
A0A4Q5A868      NPTNTAFVNISV--------TDGDPAQAADIANAIAKS-------------------LSS
A0A6N4VXX3      SKAGTVLIDVDV--------LDPSPVRARDIANTLSSE-------------------FVA
A0A1H4I042      SKMGTVLIDVDV--------LDPSPVRARDIANTLSDQ-------------------FVK
A0A4R7A6D9      SKMGTVLIDVDV--------LDPSPVRARDIANTLSDQ-------------------FVK
A0A345NSU7      ---------------------------------------------------------AET
A0A222TG79      WDPDTVLLNVTV--------EDSDRSVAVVLANSVAAS-------------------LQD
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      VPQKTVIVEVTV--------TDPDAASAARIANAIGDQ-------------------VAE
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      -VGNSSVVRVVV--------RTTDPERAAQLAGQVAEE-------------------LVS
A0A1Q2CRV2      IPAQTATMDLAV--------TADSPEEAARIAHAITER-------------------LIV
A0A261FE22      ASDGSAFVSMTV--------TYSDPNDTVTILNEVVKQ-------------------LNK
A0A7K0NRJ7      AVGDLGFLEVYA--------KGPSVSEAEQLSSAATVA-------------------LID
K6WHS4          TSPDTVLLVVTA--------ENANPDLAARLASGVSQA-------------------LIE
A0A7K0NTR2      PDPATGSLAITA--------QVGDAKLAAKVANLFAEK-------------------LIA
A0A1H6WL79      VPLDSVEIRITA--------RSSDAQTAQNVADAWVAA-------------------LAS
A0A101LAM5      VPLDSVEIRVSA--------RSSDPQTAQNVADAWVTA-------------------LAA
A0A4Y3NEG0      VPLDSVEIRISA--------RSSDPQTAQNVADAWVAA-------------------LAS
A0A1Q2CI19      TQGESASVTITT--------TASDGERAANVVNTFANE-------------------TIA
A0A512T3M3      QDSEAMALTITS--------SNTDSKRAGLIVNTFADE-------------------AVA
W6JTW4          PDPAASTISISA--------TDPHATTAESIAQTFAEA-------------------AKA
A0A839J1M0      TDPASESITIST--------TAADGNRAALVANTFAEE-------------------AAA
A0A8A4Z8K4      TDPASESITIST--------TAADGNRAALVANTFAEE-------------------AAA
A0A0A0JTY0      TDPAAQAITVAA--------TASDGKQAAAVANAFANE-------------------TIN
A0A0A0JXF2      PDNAAEALTVSA--------TASDGEEAAAVANAFATE-------------------TVK
E6S8H2          PDFSAGALTVAV--------TDAEGKRAASIANTFADE-------------------TVT
A0A0A0JGH0      SDPSGAALTIAA--------SDRDGAKAAETANAFAKQ-------------------TVA
N0E4U7          PDPAAAALTIAA--------SAPDGERAAATANAFADE-------------------TVA
A0A0A0IYK2      PDVVAAAITVSA--------TASDGSRAAAVANAFATE-------------------TVK
A0A0Q9L0H3      PDTVAQALTVSA--------TASDGKQAAAVANAFATE-------------------TVK
A3TMK0          PDTVSQALMVSA--------TASDGKQAAAVANAFANQ-------------------TVL
A0A543PXP1      PDFNAAALTVAA--------TAPDGQRAAAVANAFADE-------------------TVA
A3TMH6          PEFIATALTVSA--------TASDGARAAAVANAFADE-------------------AVS
A0A6I2XCV4      DQSNVSAIDVTA--------ISTDPQFAVTLADTSAKILMDSWSTDSKRRAAESSDAVIA
A0A5R8VLL6      VPRDTAEMRIKA--------ESPNPTTAQRVADAWIVE-------------------LAR
A0A3L7ADK2      QPQDTVLIEITA--------KGPTGDSARTLADAWITA-------------------MSE
A0A538JQF8      VDRAMNQVDIIQ--------NRPDPLPAL----------------------------LTL
A0A1H6YPK1      GSTETAIMLFTG--------TGSAPESAQELVNAWMDA-------------------TFL
A0A0Q9TBP0      AVGTSRILRVTA--------QDSSPDRAARTANIVATSYLQFREQDSVGRYEQARDRLAQ
A0A0G3V3M7      PDPATGSLAITA--------QVGDAELAAKVANLFAAK-------------------LVG
A0A6I3DD56      PDPATGSLAITA--------QVGDAVLAAKVANLFAAT-------------------LVG
A0A5Q2FA83      AATGSPMLDITA--------TSSSPRVAADAANAVGPQ-------------------LAS
A0A2R7MGI0      NPVDTVNVRVDA--------TGPTPESARDLAEAWIRG-------------------MTT
A0A2T7WQY4      NPVETVNVRVDA--------TGSTPESARDLAEAWIRG-------------------MTT
A0A0Q5Q5L3      NPVDTVNVRVDA--------TGATPESARDLAEAWIRA-------------------MTT
A0A0Q6DVM4      NPVDTVNVRVDA--------TGATPESARDLAEAWIRA-------------------MTT
A0A1N7DLV3      NPVDTVNVRVDA--------TGPTPEAARDLAQAWLQG-------------------MTV
A0A1V2NSB5      NPVDTVNVRVDA--------TGPTPEAARDLAQAWLHG-------------------MTV
A0A1R3WWR6      NPIDTVNVRVDA--------TGPTPESARDLAEAWIRG-------------------MTT
A0A1G6GTN3      NPVDTVNVRVEA--------TGPTPESARDLAEAWIRG-------------------MTV
A0A7W5GFA5      NPIETVNVRVDA--------TGPTPESARDLAEAWIRG-------------------MTE
A0A2S5WZJ5      ---------------------------------------------------------MAD
A0A0Q5JKD6      NPIETVNVRVDA--------TGPTPESARDLAEAWIRG-------------------MTE
A0A2W6DK08      ADKPSNAINITA--------SDVDPQNAVALANAFAAG-------------------TVD
A0A346XTB0      QRAEDAVAELRAQQVRLE--EERSGLQSSLEADSSNVA-------------------LPF
A0A542FTE6      LADDSSLIQISA--------SASTPEAARVLADAWIAA-------------------MSQ
A0A7Y9QM02      LADDSSLIQISA--------SASTPEAARVLADAWIAA-------------------MSQ
A0A6I1G2U1      PNPSAQSLTVEM--------SGADAEYVAAVANAFAEQ-------------------SVA
A0A351ETF8      DEYSRYLSQMVS--------IETLLQPQLAPLEAQISE-------------------YQR
A0A349B7N2      QNPQVATLDITS--------VGTDPDRAVRIADGFAGA-------------------LLA
A0A4Q2JUT1      NPTGTVILSVTA--------QAPTAEGARELAEAWLIS-------------------LGS
A0A6L5R0V7      NPSGTVILSVTA--------EASTAEDARRLAEAWLTS-------------------LGT
A0A2S0LQ32      AEPSSPIVTITA--------VSSDPSRARDLANAAIPA-------------------LGS
A0A7T8DZN6      AEPSSPIVTITA--------VSSDPSRARDLANAAIPA-------------------LGS
A0A2N6V1R5      ADAVPGLFTLTA--------TASTPERARDIANAGIKA-------------------VSD
G9PHS6          ADAVPGLFTLTA--------TASTPERARDIANAGIKA-------------------VSD
U1PLM7          ADAVPGLFTLTA--------TASTPERARDIANAGIKA-------------------VSD
A0A4V1VGV9      -SEGSATLTLTA--------SAATPAKAQRAADLARTA-------------------LAD
A0A2S5UYV0      VAPGSNLIQVQA--------SADSPSSAVALANGALQA-------------------LAD
A0A7W4UQ09      VAPNSELIQVNA--------TAGSPSSAVALANGALQA-------------------MAD
A0A2S5X9U6      VAPNSNLINVQA--------TASTPSSAVALANGALQA-------------------MAD
A0A2S5ULV5      VAPNSNLIQVSA--------SASTPSSAVALANGALQA-------------------MAD
A0A653YMF0      VAPSSNLIQVSA--------SASTPSSAVALANGALQA-------------------MAD
A0A7V9H755      GAPQSNPDVVVL--------NELIPETSVRILDAVRSQ-------------------IQS
A0A3Q9IY80      NPTDTVNIRVVA--------SASSPEGARDLAQAWIRA-------------------MAT
A0A0F0LP73      VVPGSTMVRVTA--------NAPDPQSALRLANGALHA-------------------LAN
A0A346Y185      RSTQASLSELQT--------QRAALEDAIAAAEARLAA-------------------SPT
A0A7W0HGW1      LGEIAPQVIIDVRGVPLLPPESEESKGLRANREALSSR-------------------LTE
A0A259S8H9      VVPGSTLVEVTA--------DAADPKSALKLANGALHA-------------------LAK
A0A2W1Z497      LPEGTAIIDVTA--------SGATPRESADLADAWIAG-------------------MGR
A0A0Q5L115      LPEDTAIITVTS--------RGSTPADAAALTDAWLAA-------------------MGE
A0A7G6YY64      LPEDTAIITVTS--------RGSTPADAAALTDAWLAA-------------------MGE
A0A7J5B4S5      VAPNSNLIEVQA--------SADSPAAAVALANGALQA-------------------MAD
A0A852U976      VAPNSNLIEVQA--------SADSPAAAVALANGALQA-------------------LAD
A0A1F1X071      LDPNAPIITVEA--------VAPTAEEASAIANAAVEA-------------------TAA
A0A3R8RWC7      LDPNAPIITVEA--------VAPTAEEASAIANAAVEA-------------------TAA
A0A4U0RJZ4      GSEGTSNLSLTA--------SSSSAAKAQQAANLAPAA-------------------LSQ
A0A4R1FGL9      GSEGTSNLSLTA--------SSSSAAKAQQAANLAPAA-------------------LSQ
E3B8H1          GSEGTSNLSLTA--------SSSSAAKAQQAANLAPAA-------------------LSQ
A0A7D7WDT9      VVPGSTMIRVTA--------TSSSPKAALELANGSLHA-------------------LAA
A0A0Q5AWK6      VAPGSTLIQVTA--------EASTPENAAALANGALAA-------------------LAA
A0A6P1F176      VAPGSTLIEVTA--------AASTPENAAALANGALAA-------------------LAE
A0A3N1NLD3      VAPGSTLIEVTA--------SASTPENAAALANGALAA-------------------LAD
A0A3N2FVI8      VAPGSTLIEVTA--------SAATPENAAALANGALAA-------------------LAD
A0A2S5XDQ6      VAPGSTLIEVTA--------AAGTAQNAAALANGALAA-------------------LAA
A0A2S5XNN6      VAPGSTLIEVTA--------EAGTAQNAAALANGALAA-------------------LAA
A0A5C8C085      QPTDTVLIKITA--------KADSPHAAQALADAWIVA-------------------LQD
A0A4Y5YMQ6      IPQNTVILDITA--------ASADPRDAAEIANSVADN-------------------LTE
A0A1E4BP96      NPLDTVVIHVAA--------TAATPESARDLAEAWIRG-------------------MTA
A0A7V9FXS6      VAAETGLLRIRI--------RLPSPERAARAANGFATA-------------------AVD
A0A7W0PY69      VPVDTGNVAITV--------RHPDPQRAAVIANVYARR-------------------VLE
A0A7W8YB99      VPANSSEMRLTA--------RASHPAFAQQLANVWVDA-------------------LAE
A0A1L2ZMQ6      VLEGSTELRVTA--------SASDPVFAQQLANVWIDA-------------------LAE
A0A7W8TR75      VVDGTTELRVTA--------RASDPAFAQQLANVWIQA-------------------LAE
A0A151BT98      LSDTANIMTATA--------SSGSAQEAAAIANATGPA-------------------LAA
A0A2Y8ZRF8      LSDTANIMTGTA--------SSGSAQEAAAIANATGPA-------------------LAA
A0A2R9UAT1      NATGTVTIKVQA--------SAPTPETARDLAEAWIQG-------------------MAT
A0A3E2DN22      VPGDTAFIDIKA--------TGGTAKNAQALANAGLEA-------------------LIS
A0A3Q9ULZ9      VVSGTSFIKITA--------TGSSALNAQSLANAALVG-------------------LQA
A0A3S9JFL2      VVTGTSFIRITA--------TGSSAQNAQALANAALVG-------------------VQA
A0A3L8NYD3      GDADNPQLTIYA--------TASSPSQARDLANAVIGA-------------------MST
A0A1M6K628      AKNDGVIFEITA--------QAPTAEGARLMADAGIRA-------------------TSV
A0A561E8R3      VSAVSSVINFTA--------ISSTPNGARELADAAVNA-------------------TRD
A0A4Q5J5D7      QPLDTVLIKVTA--------RDATPLGAQQLADAWVSA-------------------LAD
A0A1Y4CKD6      TIDNSNMVTMWV--------DSASPENARAILEKALEV-------------------YPE
A0A0Q7KBQ4      IIATTQTLQVDV--------TADSAELAQQIAEAEAEG-------------------IVS
A0A5Q5BFU2      AKPDTVLIDVAV--------LDQSPVRARDIANTLSDE-------------------FVA
A0A439DNZ6      SKLDTVLINVSV--------LDESPVRARDIADALSEE-------------------FVV
A0A7I7UD03      SKVDTVLINVDV--------LDESPVRARDIANTLSDE-------------------FVA
A0A7I7MI62      AKADTVLINVDV--------LDKSPVRARDIANTLSDE-------------------FVA
A0A0J6YE86      AKPDTVLIDVAV--------LDESAVRARDIANTLSDE-------------------FVG
A0A7I7K1R9      AKTDTVLIDVHV--------LDESPVRARDIANTLSDE-------------------FVA
A0A7I9ZLK4      SKPDTVLIDVNV--------LDESPVRARDIANTLSDE-------------------FVA
A0A1F1IHY9      STSGSAQIVVRA--------EDSSPERAQQLASAWLGA-------------------LEA
A0A7H2BCD6      MDNQSALIRVQA--------TANDPVKAQTLANSALES-------------------VAY
A0A3S0V9U6      VEDGSTLIRVRA--------TASSPEDAVALANASLKA-------------------TAD
A0A7T4T4U7      VEPNSTLIKVTA--------TASSPQDAATLANNALQA-------------------TAD
A0A1S2N0P2      VEPNSTLIKVTA--------TASSPQDAATLANNALQA-------------------TAD
A0A0Q3BEY5      VEPNSTLIKVTA--------TASSPQDAATLANNALQA-------------------TAD
A0A4R6Q3C6      VEPNSTLIKVTA--------TASSPQDAATLANNALQA-------------------TAD
A0A7T3CHP7      VEPNSTLIKVTA--------TASSPQDAATLANNALQA-------------------TAD
A0A7Y5U6C1      EKPEADVLVFTA--------KARTQRGAETLATSYARA-------------------FVD
A0A542HCT5      QPLDTVGIKISA--------RASTPRGAQQLADAWVAA-------------------LAR
A0A537WNY9      TFKGTGIIKITA--------RSTSRSLAQQSAQAATDA-------------------LVE
A0A5B8M469      ------------------------------------------------------------
A0A2S8WHZ8      VPTNTAEIRVTA--------SSQGAEEARNLADAWVVA-------------------LAA
A0A1Y4CTD2      QVSGTNLLTLSV--------TSPTPRQAYLFIQSALQN-------------------YER
A0A3N3ZPU0      VVPGTSQIKVEG--------RSDSPEGSAKVADAYAGA-------------------LTQ
A0A359IQX7      VTGGSVLFTVTA--------IAPTPSEAKDAADLGLTA-------------------TAD
A0A7W9IKV0      AVPGTVLLRATV--------TDPDPRRAADLANALGAR-------------------FAE
A0A1N7E3F1      AIPETTLLRATV--------ADSVPTRAAARANALGAA-------------------FAR
A0A544ZKQ1      AVPDTTLLRATV--------ADSVPARAAARANALGAA-------------------FAQ
A0A5D0Q2X0      AIPDTTLLRATV--------ADSVPVRAAARANTLGAT-------------------FAA
A0A5R8Z2E7      AIPDTTLLRATV--------ADSVPVRAAARANTLGAT-------------------FAA
A0A0Q9LZR0      QPVDTVLLKISA--------RAATPRGAQQLADAWVAA-------------------LAR
A0A1F1J417      TEENSSLIKVRA--------TASSPEQARVLANSALHA-------------------TAQ
A0A2A8D6P2      TEENSSLIKVRA--------TASSPEQARVLANSALHA-------------------TAQ
A0A1F0THV9      TEENSSLIKVRA--------TASSPEQARVLANSALHA-------------------TAQ
A0A5F0M6Y0      TEENSSLIKVRA--------TASSPEQARVLANSALHA-------------------TAQ
E3H5W1          TEENSSLIKVRA--------TASSPEQARVLANSALHA-------------------TAQ
A0A1F1QKB0      TEENSSLIKVRA--------TASSPEQARVLANSALHA-------------------TAQ
A0A509JY23      TEENSSLIKVRA--------TASSPEQARVLANSALHA-------------------TAQ
A0A448USF4      TEENSSLIKVRA--------TASSPEQARVLANSALHA-------------------TAQ
A0A7Z9A2N0      TDENSSLIKVSA--------HASTPEQAQVLANSALHA-------------------TAE
A0A433EDP2      TDENSSLIKVSA--------HASTPEQAQVLANSALHA-------------------TAE
A0A231VTW0      TDENSSLIKVSA--------HASTPEQAQVLANSALHA-------------------TAE
A0A433ECD0      TDENSSLIKVSA--------HASTPEQAQVLANSALHA-------------------TAE
A0A7T9UPU8      TDENSSLIKVSA--------HASTPEQAQVLANSALHA-------------------TAE
U7V3Z1          TDENSSLIKVSA--------HASTPEQAQVLANSALHA-------------------TAE
A0A6I3F378      TTSD--VVTFFV--------ESPDAQLAADVANAYIEQ-------------------YNI
A0A838H0S5      ASSELDLLTIAA--------LDPTAEGAAALTNAVGEA-------------------YQQ
A0A1S1CQC5      AGDNAALITVSA--------QASSPKNAQLLANSALQA-------------------TAD
A0A1E9T6I0      AGDNAALITVSA--------QASSPKNAQLLANSALQA-------------------TAD
A0A1F1GHA7      AGDNAALITVSA--------QASSPKNAQLLANSALQA-------------------TAD
A0A1S1CAD0      AGENAALITVSA--------KASSPKNAQLLANGALQA-------------------TAD
G5ET14          AGENAALITVSA--------KASSPKNAQLLANGALQA-------------------TAD
A0A1E9DXX2      AGENAALITVNA--------KASSPKNAQLLANSALQA-------------------TAD
A0A1E8S156      AGENAALITVSA--------KASSPKNAQLLANGALQA-------------------TAD
A0A1E8S5S2      AGENAALITVSA--------KASSPKNAQLLANGALQA-------------------TAD
A0A1S1DFA8      AGENAALITVSA--------KASSPKNAQLLANGALQA-------------------TAD
A0A2I1Z490      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1F0DAA9      AGDNAALITVNA--------KASSPKNAQVLANSALQA-------------------TAD
A0A1F0PHK9      AGDNAALITVNA--------KASSPKNAQVLANSALQA-------------------TAD
A0A1F0VZG6      AGDNAALITVNA--------KASSPKNAQVLANSALQA-------------------TAD
A0A1E9G8X4      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1E9IAW2      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1E9ZBC9      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1E9ZDP4      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1F0R6B5      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1F0Z7N5      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1F1D897      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
D2NP38          AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1F1FV74      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1E9M791      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A291DEI8      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1S1D5T1      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1E8TRD6      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1F0XT88      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1F1EVP5      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
C6R548          AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A0K2RXS2      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A1F0KX60      AGDNAALITVSA--------QASSPKNAQLLANGALQA-------------------TAD
A0A542I3V2      VPVETAEIRITA--------TSPDPVMAQRVADAWVAE-------------------LAK
A0A2T0UZ65      VAPGSVILKINA--------TGPTPTDARDLADATMEA-------------------VAA
A0A0Q5M6Z7      LPADTAVIEITA--------RASTPDGAAKLANAWIAG-------------------LTK
A0A7G6YA19      LPADTAIIEITA--------RAGTPDGAAKLANAWSTA-------------------LTD
A0A853CXS3      LPADTAIIEITA--------SAGTPEAAAKLANAWSTA-------------------LSE
A0A7W8YB56      KDPSNSQIRVSA--------QASTPENAKAAADAFAQA-------------------LSD
A0A1L2ZMV4      KDPSNSQIRVTA--------TAENPEHARASADAFASA-------------------LAE
A0A7W8TSW5      KDPSNSQIRVTA--------TAENPEHARASADAFASA-------------------LAE
A0A1R4JTI6      VPPDTAEVRLSV--------VQDSPDAARALADSWVSS-------------------LAE
A0A4R7TM52      NPTDTVNLVVQA--------SASTPEGARDLAQAWVKA-------------------MSN
A0A542XE74      ASEGSPFINVTA--------QAPTARDAQALANATLSA-------------------LRV
A0A0Q7QDF6      VVGNSSVVRVVV--------RTTDPERAAQLAGQVAEE-------------------LVS
A0A7X7XPM3      LSANGSFVDIIA--------HSTDPRVAADAANAAGPA-------------------VAA
A0A5R8L819      NPLDTVNINVRA--------QASTPEGARDLAQAWLAG-------------------MAV
A0A7K0PFV4      AIGGGSVVAVRG--------TAASEAEAVRLTQTYIDV-------------------ALG
A0A0G3V3F3      AVGDLGFLEVYA--------KGPSVSEAEQLSSAATVA-------------------LID
A0A7K0MUQ7      AVGDLGFLEVYA--------KGPSVSDAEQLASAATVA-------------------LID
A0A7K0U619      AVGDLGFLEVYA--------KGPSVSDAEQLASAATVA-------------------LID
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      AVGDLGFLEVYA--------KGPSVSDAEQLGSAATVA-------------------LID
A0A7K0V140      AVGDLGFLEVYA--------KGPSVSDAEQLASAATVA-------------------LID
A0A261FQA1      VDASG-LMTVTA--------TSSDSQQAADIANAVYDS-------------------LVQ
A0A1Q2CJ92      V--DGVIFRIRA--------TADSPELAASLADAAIRA-------------------TSV
A0A2T0S3C8      ALPETVLLQATV--------TDGSAERSRLIAGVLARE-------------------FTT
A0A810MDE3      ALPETVLLQAIV--------TDGSAERSRLIAGVLARE-------------------FTT
A0A4Y8WZJ3      STSGSAQIVVRA--------EDSSPERAQQLASAWLGA-------------------LEA
A0A7X0KT97      NPNGTAVLRVTA--------SGSTPEAAAALADAWIEA-------------------LAQ
A0A853DGU7      VGTAA-LITVSV--------TCDTPSDCPKIANAALVA-------------------TAN
A0A7Z0A2Z7      AQPSTVLVNATV--------TNSSADRVRAIARDVTTL-------------------FPK
A0A285VUW0      --DDTALFDFVV--------RSDSPDHASAVAEALPQQ-------------------LAT
A0A849PJI9      PGTGGTIINFTV--------TSRDPEVARKLADAAVTA-------------------TRD
A0A2R7Z032      VDTDINLLTVQA--------IGTTPEEARDLASIVVQA-------------------IAD
A0A6J4MTQ2      VDATGIVLTVQA--------TGTSPVEARDLANAVVAA-------------------VAE
A0A1I0W453      VDADVNALTVTA--------IGTTPEEARDLANAVVDA-------------------VVV
A0A0Q6VV12      VNADVNALTITA--------IGSTPEQARDLANGVVDA-------------------VVE
A0A495NTA9      VNADVNALTVTA--------IGSTPEEARDLATSVVDA-------------------VVE
A0A1H4LCS9      VDTTVNALTVTA--------TASTPQDAQDLANAVIKA-------------------VVV
A0A4Q2RZP8      VDTSVNALTVTA--------VSTSPTDARDLANAVIDA-------------------VVI
A0A0Q9QB08      VNSDVNAITISA--------VGTTPEEARDLANAVVDA-------------------VVV
A0A7Y9H290      VDASVNALTVSA--------TGTTPEEARDLANAVVGA-------------------VVV
A0A4Q2SA86      VDASVNALTVTA--------IGSTPEEARDLASAVVDA-------------------VVV
A0A4Z1C3Z0      VDASVNALTVTA--------IGSTPQEARDLATAVVDA-------------------VVV
A0A6V8KDX4      VVPDTVLLEATV--------TDSSKARSKALAEALAAD-------------------FRT
A0A444BL03      VAENSVIMQVTA--------TGPTPDESRRLADAVIKA-------------------TAQ
A0A7V9PCQ0      RDSGSPLLTIET--------SGNDAEGITTWANAMAAG-------------------IRD
A0A4Y8X357      LVPGSNLITVSA--------IAPDAQQAAALANTALVA-------------------TAD
R4LD52          AVPETVLLQATV--------TDTDRDRSARIATVLAGQ-------------------FKQ
A0A4T2CD79      NIKDTPTINVTA--------RASSGIEAKKLADAWIVG-------------------LTT
A0A6L6AM03      VDAEVNSLTVSA--------VGSTPEEARDLANAVVEA-------------------VVV
A0A4Q2RU39      VDASVNSITISA--------IGTTPVEARDLANAVVDA-------------------VVV
A0A4Q2SK58      VDAAVNSLTVSA--------VGTTPEEARDLANAVVDA-------------------VVV
A0A2N3YJR1      VAPDSVILKVTA--------TAPSPEEARVLADAVIKA-------------------TAE
A0A6G8FYB9      VAANSVILKVTA--------TGPTPEESRVLADAVIKA-------------------TAE
A0A4Q4D742      VVTGTINIQIDV--------TADTAEQAQLIAGAEADA-------------------IVA
A0A1C6T1J1      TETGTVLLRASV--------TDTDQTRALKLTELLSAK-------------------FVD
A0A2W2CFC8      TETGTVLLRASV--------VDTDQTRALRVTEAVSAK-------------------FVE
A0A2W2A4B0      SPTGSVVMQIAV--------TSPDRQRVAEITDSIVRS-------------------FSS
A0A4Y9MDA5      VVPDTVIVAITA--------TDPSADRAAAIANAVATQ-------------------LER
A0A1H7N9P7      VVPETVVVQISA--------TDPSPARAAAIANAVAAE-------------------LEL
A0A1M7V0F8      VVPETVVVRIAA--------TDPSPARAAAIADAVADQ-------------------LER
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      LRAERCANAFAK--------QAVVFSKKDRLLSAQLVA----------------------
A0A538AM15      PPPAPVVPEVHT--------ANEAAPRQEPLVAVDAAE----------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      --------------------DVTTVIDAPVLGSLSRNE----------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      -----------------------------------MAR----------------------
A0A419GS64      --------------------------------MAMKTK----------------------
A0A4R1CW45      --------------------MNIKSLQLETLRVVQPNR----------------------
A0A4R5Z7B0      -------------------------MVFKKNKKVRTT-----------------------
A0A542H054      -------------------------MGSKKSKKLKQVM----------------------
A0A6M8GFV5      -------------------------MSKQTAKE---------------------------
A0A7G8U6J2      -------------------------MGFLRRKD---------------------------
A0A2S8MDM2      -----------------------------------LDK----------------------
A0A357ZDL3      ------------------------------------------------------------
A0A1I6GVG4      --------------------VGTIPEEKSFTADNRLLP----------------------
A0A1I6IST1      --------------------VGTIPEEKSFTADNRLLP----------------------
A0A412JBM5      --------------------------------DRKLLT----------------------
A0A6J4SUA1      --------------------LGAVPMLRSP-RARDISP----------------------
A0A1C2B334      --------------------IGLVPGDSAL-DGEGFVD----------------------
R7Y679          --------------------LGVVASDGAF-ADRSLID----------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ----------------------MAARVDRGGDSAIRGL----------------------
A0A7K0LE65      --------------------IGDRIGRTGDADADVARI----------------------
A0A838JYQ6      --------------------EGREEGESRDLSGQLVTL----------------------
A0A510HHA8      --------------------RAREEQRNGDLSGRLITL----------------------
A0A6G8Q9J3      --------------------PARKGNAEGGPSASLVTV----------------------
A0A538BBM6      --------------------------MRTRSSRGGAEV----------------------
A0A5Q2F9A3      --------------------VGRIGYDAASERGLTLIS----------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ---------------------------MPHVERRNGSG----------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------MGEHLVSL----------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      --------------------LSSVAYDADVPKHPLLTE----------------------
A0A7V8X3I0      --------------------------MRKRNRPPATRI----------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      -------------------------HNNTADAGRAAES----------------------
A0A6G8QDQ0      --------------------MGKETGASAIAAENLITL----------------------
A0A023X491      --------------------PLKKHKKTENLTDRLVSL----------------------
A0A4R1BMZ2      ----------------------KRSEREEDLSGRLVTI----------------------
A0A838JNW7      --------------------QAKQEARSGDFSGRLVTS----------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      KNR---------------------------------------------------------
A0A538BYZ4      SLP---------------------------------------------------------
A0A348NU28      VVR----------------------------------------EISP-------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      VVE---------------------------------------------------------
A0A4Q5B0V3      VVE---------------------------------------------------------
A0A022KX11      SGQ----------------------------------------KVVS-------------
A0A4Q5A868      VVE---------------------------------------------------------
A0A6N4VXX3      MVK----------------------------------------QLET-------------
A0A1H4I042      MVR----------------------------------------ELET-------------
A0A4R7A6D9      MVR----------------------------------------ELET-------------
A0A345NSU7      VVP---------------------------------------------------------
A0A222TG79      YVE----------------------------------------SLET-------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      TVR---------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      WIA----------------------------------------SYQD-------------
A0A1Q2CRV2      AVD----------------------------------------ELSP-------------
A0A261FE22      QIT---------------------------------------------------------
A0A7K0NRJ7      AVR----------------------------------------AQQT-------------
K6WHS4          YVE----------------------------------------VLEV-------------
A0A7K0NTR2      YVD----------------------------------------ELGQ-------------
A0A1H6WL79      QVY----------------------------------------ELDK-------------
A0A101LAM5      QVY----------------------------------------ELDK-------------
A0A4Y3NEG0      QVY----------------------------------------ELDK-------------
A0A1Q2CI19      FFE----------------------------------------T-SP-------------
A0A512T3M3      FFS----------------------------------------G-TR-------------
W6JTW4          YFA----------------------------------------K-AS-------------
A0A839J1M0      FFA----------------------------------------E-AP-------------
A0A8A4Z8K4      FFA----------------------------------------E-AP-------------
A0A0A0JTY0      YIK----------------------------------------EKPR-------------
A0A0A0JXF2      FFK----------------------------------------ETSP-------------
E6S8H2          YFK----------------------------------------K-NR-------------
A0A0A0JGH0      FFA----------------------------------------K-PR-------------
N0E4U7          FFE----------------------------------------K-GA-------------
A0A0A0IYK2      FFR----------------------------------------ERSR-------------
A0A0Q9L0H3      FIE----------------------------------------ERKR-------------
A3TMK0          FIE----------------------------------------QARR-------------
A0A543PXP1      FFK----------------------------------------Q-SR-------------
A3TMH6          FFD----------------------------------------T-PR-------------
A0A6I2XCV4      RID----------------------------------------ELAA-------------
A0A5R8VLL6      QVE----------------------------------------ERER-------------
A0A3L7ADK2      QIE----------------------------------------AIQG-------------
A0A538JQF8      ESG----------------------------------------SIRG-------------
A0A1H6YPK1      VVS----------------------------------------DVER-------------
A0A0Q9TBP0      EQA----------------------------------------DIES-------------
A0A0G3V3M7      YVD----------------------------------------ELGQ-------------
A0A6I3DD56      YVD----------------------------------------ELGQ-------------
A0A5Q2FA83      IGK----------------------------------------EFAP-------------
A0A2R7MGI0      QVD----------------------------------------DLET-------------
A0A2T7WQY4      QVD----------------------------------------ELET-------------
A0A0Q5Q5L3      QVD----------------------------------------ELES-------------
A0A0Q6DVM4      QVD----------------------------------------ELES-------------
A0A1N7DLV3      QVD----------------------------------------QLES-------------
A0A1V2NSB5      QVD----------------------------------------QLES-------------
A0A1R3WWR6      EVD----------------------------------------QLQS-------------
A0A1G6GTN3      EVD----------------------------------------QLET-------------
A0A7W5GFA5      EVD----------------------------------------QLET-------------
A0A2S5WZJ5      VIT----------------------------------------DVET-------------
A0A0Q5JKD6      EVD----------------------------------------QLET-------------
A0A2W6DK08      EFR----------------------------------------ARHA-------------
A0A346XTB0      LIQ----------------------------------------SLDA-------------
A0A542FTE6      RVE----------------------------------------ELEV-------------
A0A7Y9QM02      RVE----------------------------------------ELEV-------------
A0A6I1G2U1      YFA----------------------------------------T----------------
A0A351ETF8      QIT----------------------------------------EFES-------------
A0A349B7N2      TLT----------------------------------------ETTQ-------------
A0A4Q2JUT1      VVE----------------------------------------EVEV-------------
A0A6L5R0V7      VVE----------------------------------------EVEI-------------
A0A2S0LQ32      YIA----------------------------------------SLEAIGSGQSPSPADAQ
A0A7T8DZN6      YIA----------------------------------------SLEAIGSGQSPSPADAQ
A0A2N6V1R5      EAN----------------------------------------AITTLNA----------
G9PHS6          EAN----------------------------------------AITTLNA----------
U1PLM7          EAN----------------------------------------AITTLNA----------
A0A4V1VGV9      EAK----------------------------------------YLET-------------
A0A2S5UYV0      VIT----------------------------------------DLES-------------
A0A7W4UQ09      VIT----------------------------------------DMET-------------
A0A2S5X9U6      VIT----------------------------------------EIET-------------
A0A2S5ULV5      VIT----------------------------------------EIET-------------
A0A653YMF0      VIT----------------------------------------EIET-------------
A0A7V9H755      LAS----------------------------------------RIEALDR----------
A0A3Q9IY80      EVE----------------------------------------NLET-------------
A0A0F0LP73      VVA----------------------------------------RIEDAAG----------
A0A346Y185      DAS----------------------------------------ARAERDA----------
A0A7W0HGW1      TEK----------------------------------------QAEQ-------------
A0A259S8H9      VVA----------------------------------------HIEQVAQ----------
A0A2W1Z497      QIA----------------------------------------AIQS-------------
A0A0Q5L115      QIA----------------------------------------AMQE-------------
A0A7G6YY64      QIA----------------------------------------AMQE-------------
A0A7J5B4S5      VIS----------------------------------------DLES-------------
A0A852U976      VII----------------------------------------ELES-------------
A0A1F1X071      EAR----------------------------------------ELET-------------
A0A3R8RWC7      EAR----------------------------------------ELET-------------
A0A4U0RJZ4      EIK----------------------------------------HIET-------------
A0A4R1FGL9      EIK----------------------------------------HIET-------------
E3B8H1          EIK----------------------------------------HIET-------------
A0A7D7WDT9      VVE----------------------------------------EIEK-------------
A0A0Q5AWK6      VIA----------------------------------------DIET-------------
A0A6P1F176      VIA----------------------------------------DIET-------------
A0A3N1NLD3      VIA----------------------------------------DIET-------------
A0A3N2FVI8      VIA----------------------------------------DIET-------------
A0A2S5XDQ6      VIT----------------------------------------DIET-------------
A0A2S5XNN6      VIT----------------------------------------DIET-------------
A0A5C8C085      QIE----------------------------------------AVEN-------------
A0A4Y5YMQ6      VVY----------------------------------------DIAP-------------
A0A1E4BP96      AID----------------------------------------DIEG-------------
A0A7V9FXS6      FSR------------------------------------------SD-------------
A0A7W0PY69      FAA------------------------------------------KD-------------
A0A7W8YB99      EAK----------------------------------------AIES-------------
A0A1L2ZMQ6      EAH----------------------------------------DIES-------------
A0A7W8TR75      EAH----------------------------------------NIES-------------
A0A151BT98      VAP----------------------------------------QFSQ-------------
A0A2Y8ZRF8      VAP----------------------------------------QFSQ-------------
A0A2R9UAT1      EID----------------------------------------GLES-------------
A0A3E2DN22      EAL----------------------------------------RMET-------------
A0A3Q9ULZ9      EAL----------------------------------------RMET-------------
A0A3S9JFL2      EAL----------------------------------------RMET-------------
A0A3L8NYD3      EAA----------------------------------------KLES-------------
A0A1M6K628      AAN----------------------------------------ELET-------------
A0A561E8R3      EAA----------------------------------------QIET-------------
A0A4Q5J5D7      QVA----------------------------------------EIEN-------------
A0A1Y4CKD6      VSR---------------------------------------------------------
A0A0Q7KBQ4      LVA----------------------------------------RLEK-------------
A0A5Q5BFU2      MVR----------------------------------------ELET-------------
A0A439DNZ6      MVR----------------------------------------ELET-------------
A0A7I7UD03      MVR----------------------------------------ELET-------------
A0A7I7MI62      MVR----------------------------------------ELET-------------
A0A0J6YE86      RVR----------------------------------------ELET-------------
A0A7I7K1R9      MVR----------------------------------------ELET-------------
A0A7I9ZLK4      MVR----------------------------------------DLET-------------
A0A1F1IHY9      QAT----------------------------------------EVEA-------------
A0A7H2BCD6      VAN----------------------------------------ELEG-------------
A0A3S0V9U6      TVN----------------------------------------EIDG-------------
A0A7T4T4U7      YVS----------------------------------------DLEG-------------
A0A1S2N0P2      YVS----------------------------------------DLEG-------------
A0A0Q3BEY5      YVS----------------------------------------DLEG-------------
A0A4R6Q3C6      YVS----------------------------------------DLEG-------------
A0A7T3CHP7      YVS----------------------------------------DLEG-------------
A0A7Y5U6C1      YRH----------------------------------------RLDT-------------
A0A542HCT5      QVQ----------------------------------------AVEN-------------
A0A537WNY9      RTR----------------------------------------SGEV-------------
A0A5B8M469      -------------------------------------------MITE-------------
A0A2S8WHZ8      QVE----------------------------------------ELES-------------
A0A1Y4CTD2      VSG---------------------------------------------------------
A0A3N3ZPU0      EVQ----------------------------------------RIES-------------
A0A359IQX7      AAA----------------------------------------RLES-------------
A0A7W9IKV0      LIN----------------------------------------QIER-------------
A0A1N7E3F1      LID----------------------------------------QIER-------------
A0A544ZKQ1      LID----------------------------------------KIER-------------
A0A5D0Q2X0      LID----------------------------------------RIER-------------
A0A5R8Z2E7      LID----------------------------------------RIER-------------
A0A0Q9LZR0      QVQ----------------------------------------AVEN-------------
A0A1F1J417      YIE----------------------------------------NIEK-------------
A0A2A8D6P2      YIE----------------------------------------NIEK-------------
A0A1F0THV9      YIE----------------------------------------NIEK-------------
A0A5F0M6Y0      YIE----------------------------------------NIEK-------------
E3H5W1          YIE----------------------------------------NIEK-------------
A0A1F1QKB0      YIE----------------------------------------NIEK-------------
A0A509JY23      YIE----------------------------------------NIEK-------------
A0A448USF4      YIE----------------------------------------NIEK-------------
A0A7Z9A2N0      YIK----------------------------------------NIEG-------------
A0A433EDP2      YIK----------------------------------------NIEG-------------
A0A231VTW0      YIK----------------------------------------NIEG-------------
A0A433ECD0      YIK----------------------------------------NIEG-------------
A0A7T9UPU8      YIK----------------------------------------NIEG-------------
U7V3Z1          YIK----------------------------------------NIEG-------------
A0A6I3F378      YTA----------------------------------------KISA-------------
A0A838H0S5      VAAGRVKRNAQAAVAELEQSIRELQTRIQ--------------QIEQ-------------
A0A1S1CQC5      YIK----------------------------------------EIEQ-------------
A0A1E9T6I0      YIK----------------------------------------EIEQ-------------
A0A1F1GHA7      YIK----------------------------------------EIEQ-------------
A0A1S1CAD0      YIK----------------------------------------EIEQ-------------
G5ET14          YIK----------------------------------------EIEQ-------------
A0A1E9DXX2      YIK----------------------------------------EIEQ-------------
A0A1E8S156      YIK----------------------------------------EIEQ-------------
A0A1E8S5S2      YIK----------------------------------------EIEQ-------------
A0A1S1DFA8      YIK----------------------------------------EIEQ-------------
A0A2I1Z490      YIK----------------------------------------EIEQ-------------
A0A1F0DAA9      YIK----------------------------------------EIEQ-------------
A0A1F0PHK9      YIK----------------------------------------EIEQ-------------
A0A1F0VZG6      YIK----------------------------------------EIEQ-------------
A0A1E9G8X4      YIK----------------------------------------EIEQ-------------
A0A1E9IAW2      YIK----------------------------------------EIEQ-------------
A0A1E9ZBC9      YIK----------------------------------------EIEQ-------------
A0A1E9ZDP4      YIK----------------------------------------EIEQ-------------
A0A1F0R6B5      YIK----------------------------------------EIEQ-------------
A0A1F0Z7N5      YIK----------------------------------------EIEQ-------------
A0A1F1D897      YIK----------------------------------------EIEQ-------------
D2NP38          YIK----------------------------------------EIEQ-------------
A0A1F1FV74      YIK----------------------------------------EIEQ-------------
A0A1E9M791      YIK----------------------------------------EIEQ-------------
A0A291DEI8      YIK----------------------------------------EIEQ-------------
A0A1S1D5T1      YIK----------------------------------------EIEQ-------------
A0A1E8TRD6      YIK----------------------------------------EIEQ-------------
A0A1F0XT88      YIK----------------------------------------EIEQ-------------
A0A1F1EVP5      YIK----------------------------------------EIEQ-------------
C6R548          YIK----------------------------------------EIEQ-------------
A0A0K2RXS2      YIK----------------------------------------EIEQ-------------
A0A1F0KX60      YIK----------------------------------------EIEQ-------------
A0A542I3V2      RVQ----------------------------------------LLES-------------
A0A2T0UZ65      EAN----------------------------------------RLE--------------
A0A0Q5M6Z7      QVR---------------------------------------------------------
A0A7G6YA19      QVK---------------------------------------------------------
A0A853CXS3      QVR---------------------------------------------------------
A0A7W8YB56      EAA----------------------------------------RVEK-------------
A0A1L2ZMV4      EAE----------------------------------------RVER-------------
A0A7W8TSW5      EAA----------------------------------------RVER-------------
A0A1R4JTI6      EVS----------------------------------------NIEN-------------
A0A4R7TM52      EVK----------------------------------------KLES-------------
A0A542XE74      EALRLETFG----------------------------------RTQG-------------
A0A0Q7QDF6      WIA----------------------------------------SYQD-------------
A0A7X7XPM3      VGS----------------------------------------KFAK-------------
A0A5R8L819      EVQ----------------------------------------NLEG-------------
A0A7K0PFV4      ARNALVEAGARRALTALDSRTDP--------------------GLPT-------------
A0A0G3V3F3      AVRAQQTASLAQDIAPIQAQRVILQKQLSNLPAFDPQAASIQANIDA-------------
A0A7K0MUQ7      AVRAQQAASLAQDIAPIQAQRVILQKQLSALPALDPQAASIQANIDA-------------
A0A7K0U619      AVRAQQTASLAQDIAPIQAQRVVLQKQLSDLPALDPQAASIQANIDA-------------
A0A6I3DFP2      ----------------MQAQRVVLQKQLSDLPALDPQAASIQANIDA-------------
A0A7K0SI36      AVRAQQAASLAQDIAPIQAQRVVLQKQLSDLPALDPQAASIQANIDA-------------
A0A7K0V140      AVRAQQTASLAQDIAPIQAQRVVLQKQLSDLPALDPQAASIQANIDA-------------
A0A261FQA1      QIE----------------------------------------DDSF-------------
A0A1Q2CJ92      EAN----------------------------------------ALE--------------
A0A2T0S3C8      MVE----------------------------------------ALET-------------
A0A810MDE3      MVE----------------------------------------ALET-------------
A0A4Y8WZJ3      QAT----------------------------------------EVEA-------------
A0A7X0KT97      TID----------------------------------------DFEG-------------
A0A853DGU7      TVK----------------------------------------NLES-------------
A0A7Z0A2Z7      MVD----------------------------------------ELDN-------------
A0A285VUW0      TAR----------------------------------------SYAP-------------
A0A849PJI9      EGR----------------------------------------KMD--------------
A0A2R7Z032      EAE----------------------------------------EIE--------------
A0A6J4MTQ2      EAA----------------------------------------AIQ--------------
A0A1I0W453      VAQ----------------------------------------EIE--------------
A0A0Q6VV12      YAQ----------------------------------------EVD--------------
A0A495NTA9      YAQ----------------------------------------EVD--------------
A0A1H4LCS9      YAA----------------------------------------QVD--------------
A0A4Q2RZP8      YAA----------------------------------------QVE--------------
A0A0Q9QB08      VAQ----------------------------------------QYE--------------
A0A7Y9H290      VAQ----------------------------------------QIE--------------
A0A4Q2SA86      YAQ----------------------------------------EVE--------------
A0A4Z1C3Z0      YAQ----------------------------------------EVE--------------
A0A6V8KDX4      LVQ----------------------------------------VLET-------------
A0A444BL03      EAN----------------------------------------RIET-------------
A0A7V9PCQ0      TLP----------------------------------------EES--------------
A0A4Y8X357      VAN----------------------------------------GLD--------------
R4LD52          LVE----------------------------------------SLE--------------
A0A4T2CD79      QIA----------------------------------------TLEN-------------
A0A6L6AM03      VAQ----------------------------------------QIE--------------
A0A4Q2RU39      VAE----------------------------------------DVD--------------
A0A4Q2SK58      VAR----------------------------------------DID--------------
A0A2N3YJR1      EAN----------------------------------------RIE--------------
A0A6G8FYB9      EAN----------------------------------------AIE--------------
A0A4Q4D742      LVK----------------------------------------RLER-------------
A0A1C6T1J1      LVQ----------------------------------------KVE--------------
A0A2W2CFC8      LVK----------------------------------------QVE--------------
A0A2W2A4B0      VVQ----------------------------------------DRL--------------
A0A4Y9MDA5      AVL----------------------------------------DLS--------------
A0A1H7N9P7      AVE----------------------------------------GLS--------------
A0A1M7V0F8      TVE----------------------------------------QLS--------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A838JYQ6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A7V8X3I0      ------------------------------------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A838JNW7      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A7K0NRJ7      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A7K0NTR2      --------------------------------------------------------NEYY
A0A1H6WL79      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A0A4Y3NEG0      ------------------------------------------------------------
A0A1Q2CI19      ------------------------------------------------------------
A0A512T3M3      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A839J1M0      ------------------------------------------------------------
A0A8A4Z8K4      ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A543PXP1      ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A6I2XCV4      ------------------------------------------------------------
A0A5R8VLL6      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A538JQF8      ------------------------------------------------------------
A0A1H6YPK1      ------------------------------------------------------------
A0A0Q9TBP0      ------------------------------------------------------------
A0A0G3V3M7      --------------------------------------------------------KQYD
A0A6I3DD56      --------------------------------------------------------KQFD
A0A5Q2FA83      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A7W5GFA5      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A346XTB0      ------------------------------------------------------------
A0A542FTE6      ------------------------------------------------------------
A0A7Y9QM02      ------------------------------------------------------------
A0A6I1G2U1      ------------------------------------------------------------
A0A351ETF8      ------------------------------------------------------------
A0A349B7N2      -----------------------------------------------QERAEAQTRLSAR
A0A4Q2JUT1      ------------------------------------------------------------
A0A6L5R0V7      ------------------------------------------------------------
A0A2S0LQ32      PPAAGSDQPSTPSPADEQPAAPEPATPEPRQEEPRGGNQDEGANPGTGERRSTPGRGNGT
A0A7T8DZN6      PPAAGSDQPSTPSPADEQPAAPEPATPEPRQEEPRGGNQDEGANPGTGERRSTPGRGNGT
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A4V1VGV9      ------------------------------------------------------------
A0A2S5UYV0      ------------------------------------------------------------
A0A7W4UQ09      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A653YMF0      ------------------------------------------------------------
A0A7V9H755      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A346Y185      ------------------------------------------------------------
A0A7W0HGW1      ------------------------------------------------------------
A0A259S8H9      ------------------------------------------------------------
A0A2W1Z497      ------------------------------------------------------------
A0A0Q5L115      ------------------------------------------------------------
A0A7G6YY64      ------------------------------------------------------------
A0A7J5B4S5      ------------------------------------------------------------
A0A852U976      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
A0A4U0RJZ4      ------------------------------------------------------------
A0A4R1FGL9      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A7D7WDT9      ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A6P1F176      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A7V9FXS6      ------------------------------------------------------------
A0A7W0PY69      ------------------------------------------------------------
A0A7W8YB99      ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A7W8TR75      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A7I7UD03      ------------------------------------------------------------
A0A7I7MI62      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      ------------------------------------------------------------
A0A7I9ZLK4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A7H2BCD6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A7T4T4U7      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A4R6Q3C6      ------------------------------------------------------------
A0A7T3CHP7      ------------------------------------------------------------
A0A7Y5U6C1      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A7W9IKV0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A7Z9A2N0      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
A0A7T9UPU8      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A838H0S5      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A7G6YA19      ------------------------------------------------------------
A0A853CXS3      ------------------------------------------------------------
A0A7W8YB56      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A7W8TSW5      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A7X7XPM3      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A7K0PFV4      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A7K0MUQ7      ------------------------------------------------------------
A0A7K0U619      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A810MDE3      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A7X0KT97      ------------------------------------------------------------
A0A853DGU7      ------------------------------------------------------------
A0A7Z0A2Z7      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A849PJI9      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A6J4MTQ2      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A7Y9H290      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A6V8KDX4      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A7V9PCQ0      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A6L6AM03      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A6G8FYB9      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A838JYQ6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A7V8X3I0      ------------------------------------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A838JNW7      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      -----------------------------------------------------------S
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      --------------------------------------------------------NTLY
A0A4Q5B0V3      --------------------------------------------------------NTLY
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      --------------------------------------------------------TTLY
A0A6N4VXX3      -----------------------------------------------------------S
A0A1H4I042      -----------------------------------------------------------P
A0A4R7A6D9      -----------------------------------------------------------P
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      -----------------------------------------------------------P
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A1Q2CRV2      ----------------------------------------------------------PG
A0A261FE22      ------------------------------------------------------------
A0A7K0NRJ7      --------------ASLAQDIAPIQAQRVILQKQLSNLPAFDPQAASIQANIDALNKVEA
K6WHS4          -----------------------------------------------------------P
A0A7K0NTR2      ERIFTLTVSRNNAETLLREIDLKMATPLLSASEYDSLGIRREATLRKLANSDYEISDIQE
A0A1H6WL79      ---------------------------------------------------------GNA
A0A101LAM5      ---------------------------------------------------------GNA
A0A4Y3NEG0      ---------------------------------------------------------GNA
A0A1Q2CI19      ------------------------------------------------------------
A0A512T3M3      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A839J1M0      ------------------------------------------------------------
A0A8A4Z8K4      ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A543PXP1      ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A6I2XCV4      --------------------KRDELESQIARNPSQATLLRAELDSVINQYRLAREQFQSI
A0A5R8VLL6      ---------------------------------------------AAAAAGQPAAPAGQP
A0A3L7ADK2      ----------------------------------------------------------ND
A0A538JQF8      ------------------------------------------------------------
A0A1H6YPK1      -------------------------------------------------------TSRGI
A0A0Q9TBP0      --------------------RLSEVNALLEKNPGGQALQGERRTLIASSAQVAAQIDALT
A0A0G3V3M7      EQIFGLTISRGNSETLISKIDSQLAAPGLSASEYDSLDIRREAVLRKLANADSDLSNLQE
A0A6I3DD56      EQIFGLTLSRSNSETLIRQIDSQLAAPGLSASEYDSLDIRREAVLRKLANADSGISNLED
A0A5Q2FA83      --------------------------------------------------------LLNS
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A7W5GFA5      ------------------------------------------------------------
A0A2S5WZJ5      -----------------------------------------------------------Q
A0A0Q5JKD6      ------------------------------------------------------------
A0A2W6DK08      -----------------------------------AAAAARFRSLEGQLTEVDNQLKQVT
A0A346XTB0      -----------------------------------------------RILDISGRIDATL
A0A542FTE6      ----------------------------------------------------------PE
A0A7Y9QM02      ----------------------------------------------------------PE
A0A6I1G2U1      ----------------------------------------------------------PR
A0A351ETF8      ----------------------------------------------------------VA
A0A349B7N2      LDELEARLADLDAQIEDGAGDLVQAQRDALVREYGIVYEDFQVLSREPEATVGLRTLQPA
A0A4Q2JUT1      ----------------------------------------------------------ES
A0A6L5R0V7      ----------------------------------------------------------ES
A0A2S0LQ32      GEEKEDAAADAQARVVPAVAGTGASLVPAVAGAPQAAVGQAGVGQAGQAAPAAPATAAPT
A0A7T8DZN6      GEEKEDAAADAQARVVPAVAGTGASLVPAVAGAPQAAVGQAGIGQAGQAAPAAPATAAPT
A0A2N6V1R5      ---------------------------PTVQPTTKTTTNPDGTQVTTTTQSVDGTTNVTT
G9PHS6          ---------------------------PTVQPTTKTTTNPDGTQVTTTTQSVDGTTNVTT
U1PLM7          ---------------------------PTVQPTTKTTTNPDGTQVTTTTQSVDGTTNVTT
A0A4V1VGV9      ----------------------------------------------------------VG
A0A2S5UYV0      -----------------------------------------------------------Q
A0A7W4UQ09      -----------------------------------------------------------Q
A0A2S5X9U6      -----------------------------------------------------------Q
A0A2S5ULV5      -----------------------------------------------------------Q
A0A653YMF0      -----------------------------------------------------------Q
A0A7V9H755      --------------------------------------------LRSSGASQIAAAPAAE
A0A3Q9IY80      -----------------------------------------------------------S
A0A0F0LP73      --------------------------------------------AGATPPP-------GS
A0A346Y185      --------------------------------------------AVSQLIMIDSRADQIA
A0A7W0HGW1      ----------------------------------------------------------LE
A0A259S8H9      --------------------------------------------SAAPVDPSLPPEPKSA
A0A2W1Z497      ----------------------------------------------------------SG
A0A0Q5L115      ----------------------------------------------------------ES
A0A7G6YY64      ----------------------------------------------------------ES
A0A7J5B4S5      ----------------------------------------------------------QA
A0A852U976      ----------------------------------------------------------QA
A0A1F1X071      ----------------------------------------------------------GG
A0A3R8RWC7      ----------------------------------------------------------GG
A0A4U0RJZ4      ----------------------------------------------------------LN
A0A4R1FGL9      ----------------------------------------------------------LN
E3B8H1          ----------------------------------------------------------LN
A0A7D7WDT9      ----------------------------------------------------------AA
A0A0Q5AWK6      ----------------------------------------------------------QS
A0A6P1F176      ----------------------------------------------------------QS
A0A3N1NLD3      ----------------------------------------------------------QS
A0A3N2FVI8      ----------------------------------------------------------QS
A0A2S5XDQ6      ----------------------------------------------------------QS
A0A2S5XNN6      ----------------------------------------------------------QS
A0A5C8C085      ---------------------------------PNGKNE-------API-----------
A0A4Y5YMQ6      ---------------------------------KDDRGE---------------------
A0A1E4BP96      ---------------------------------TGVAGS-------APV-----------
A0A7V9FXS6      ---------------------------------DLLKSQ---------------------
A0A7W0PY69      ---------------------------------PLLSAQ---------------------
A0A7W8YB99      ---------------------------------TSIDGE---------------------
A0A1L2ZMQ6      ---------------------------------TGVDGV---------------------
A0A7W8TR75      ---------------------------------TGVNGV---------------------
A0A151BT98      ---------------------------------LLSGAG-------SVT-----------
A0A2Y8ZRF8      ---------------------------------LLSGAG-------SVT-----------
A0A2R9UAT1      ---------------------------------DGGKVQ-------AAV-----------
A0A3E2DN22      ---------------------------------YGQIAA-------SDH-----------
A0A3Q9ULZ9      ---------------------------------YTQAQA-------NPG-----------
A0A3S9JFL2      ---------------------------------YSQAQA-------NPG-----------
A0A3L8NYD3      ---------------------------------AARPSG---------------------
A0A1M6K628      ---------------------------------MTVTGE---------------------
A0A561E8R3      ------------------------------------TGE---------------------
A0A4Q5J5D7      ---------------------------------PRGEAG---------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ---------------------------------PTSGNG-------SPAFVA--------
A0A5Q5BFU2      ---------------------------------PEDGSS-------PDA-----------
A0A439DNZ6      ---------------------------------PPDGTR-------PDA-----------
A0A7I7UD03      ---------------------------------PEDGST-------PDS-----------
A0A7I7MI62      ---------------------------------PENGAR-------PDA-----------
A0A0J6YE86      ---------------------------------PENSTR-------ADS-----------
A0A7I7K1R9      ---------------------------------PDSGAR-------PDS-----------
A0A7I9ZLK4      ---------------------------------PGDGAR-------PDA-----------
A0A1F1IHY9      ---------------------------------GGIAGQ---------------------
A0A7H2BCD6      -----------------------------------GNTV---------------------
A0A3S0V9U6      ---------------------------------SRS-VR---------------------
A0A7T4T4U7      ---------------------------------RESAVK---------------------
A0A1S2N0P2      ---------------------------------RESAVK---------------------
A0A0Q3BEY5      ---------------------------------RESAVK---------------------
A0A4R6Q3C6      ---------------------------------RESAVK---------------------
A0A7T3CHP7      ---------------------------------RESAVK---------------------
A0A7Y5U6C1      ---------------------------------SALKQALHDADAQLQKLRDAGQIQSPL
A0A542HCT5      ---------------------------------PTGKSE-------QAL-----------
A0A537WNY9      ---------------------------------GVPTLE---------------------
A0A5B8M469      ---------------------------------IQKAGG---------------------
A0A2S8WHZ8      ---------------------------------VSVGGS---------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      ---------------------------------IATEGNNYEPPSPSPSEDGGEEASPES
A0A359IQX7      ---------------------------------LTTTG----------------------
A0A7W9IKV0      ---------------------------------PTPASR-------PTV-----------
A0A1N7E3F1      ---------------------------------PTPKSP-------PTI-----------
A0A544ZKQ1      ---------------------------------PTPKSP-------PTI-----------
A0A5D0Q2X0      ---------------------------------PTPKSP-------PTI-----------
A0A5R8Z2E7      ---------------------------------PTPKSP-------PTI-----------
A0A0Q9LZR0      ---------------------------------PTGKAA-------QAL-----------
A0A1F1J417      ---------------------------------NGSGNN-------STATP------TPA
A0A2A8D6P2      ---------------------------------NGSGNN-------STATP------TPA
A0A1F0THV9      ---------------------------------NGSGNN-------STATP------TPA
A0A5F0M6Y0      ---------------------------------NGSGNN-------STATP------TPA
E3H5W1          ---------------------------------NGSGNN-------STATP------TPA
A0A1F1QKB0      ---------------------------------NGSGNN-------NTATP------APA
A0A509JY23      ---------------------------------NGSGNN-------STATP------TPA
A0A448USF4      ---------------------------------NGSGNN-------STATP------TPA
A0A7Z9A2N0      ---------------------------------NNGGSG-------NAASSNGGNNATPN
A0A433EDP2      ---------------------------------NNGGSG-------NAANSNGGNNATPN
A0A231VTW0      ---------------------------------NNGGSG-------NAANSNGGNNATPN
A0A433ECD0      ---------------------------------NNGGSG-------NAANSNGGNNATPN
A0A7T9UPU8      ---------------------------------NNGGSG-------NAANSNGGNNATPN
U7V3Z1          ---------------------------------NNGGSG-------NAANSNGGNNATPN
A0A6I3F378      ---------------------------------DTLAGA-------VDSLQQQIDDLQKQ
A0A838H0S5      ---------------------------------DMRGGD-------DPALQAERDAAVAQ
A0A1S1CQC5      -----------------------------------NPGN-------AQALVNGDSNAAAT
A0A1E9T6I0      -----------------------------------NPGN-------AQALVNGDSNAAAT
A0A1F1GHA7      -----------------------------------NPGN-------AQALVNGDSNAAAT
A0A1S1CAD0      -----------------------------------NPGN-------AQALVNGDSTAAS-
G5ET14          -----------------------------------NPGN-------AQALVNGDSTAAS-
A0A1E9DXX2      -----------------------------------NPGN-------AQALVNGDNAVVS-
A0A1E8S156      -----------------------------------NPGN-------AQALVNGENTGAT-
A0A1E8S5S2      -----------------------------------NPGN-------AQALVNGENTGAT-
A0A1S1DFA8      -----------------------------------NPGN-------AQALVNGENTGAT-
A0A2I1Z490      -----------------------------------NPSN-------AQALVNGENTGAT-
A0A1F0DAA9      -----------------------------------NPGN-------AQALVNGENTGAS-
A0A1F0PHK9      -----------------------------------NPGN-------AQALVNGENTGAS-
A0A1F0VZG6      -----------------------------------NPGN-------AQALVNGENTGAS-
A0A1E9G8X4      -----------------------------------NPGN-------AQALVNGENTGAS-
A0A1E9IAW2      -----------------------------------NPGN-------AQALVNGENTGAS-
A0A1E9ZBC9      -----------------------------------NPGN-------AQALVNGENTGAS-
A0A1E9ZDP4      -----------------------------------NPGN-------AQALVNGENTGAS-
A0A1F0R6B5      -----------------------------------NPGN-------AQALVNGENTGAS-
A0A1F0Z7N5      -----------------------------------NPGN-------AQALVNGENTGAS-
A0A1F1D897      -----------------------------------NPGN-------AQALVNGENTGAS-
D2NP38          -----------------------------------NPGN-------AQALVNGENTGAS-
A0A1F1FV74      -----------------------------------NPGN-------AQALVNGENTAAS-
A0A1E9M791      -----------------------------------NPGN-------AQALVNGENTAAS-
A0A291DEI8      -----------------------------------NPGN-------AQALVNGENTAAS-
A0A1S1D5T1      -----------------------------------NPSN-------AQALVNGENTGAT-
A0A1E8TRD6      -----------------------------------NPGN-------AQALVNGENTGAS-
A0A1F0XT88      -----------------------------------NPGN-------AQALVNGENTGAS-
A0A1F1EVP5      -----------------------------------NPGN-------AQALVNGENTGAS-
C6R548          -----------------------------------NPGN-------AQALVNGENTGAS-
A0A0K2RXS2      -----------------------------------NPGN-------AQALVNGENTAAS-
A0A1F0KX60      -----------------------------------NPGN-------AQALVNGENAAAS-
A0A542I3V2      -----------------------------------FVTA-------GQP-----------
A0A2T0UZ65      -----------------------------------LGGG-------EVK-----------
A0A0Q5M6Z7      -----------------------------------ALEA-------PEG-----------
A0A7G6YA19      -----------------------------------ALES-------PEG-----------
A0A853CXS3      -----------------------------------ALES-------PEG-----------
A0A7W8YB56      ---------------------------------VMASGG-------TDT-----------
A0A1L2ZMV4      ---------------------------------VMATGG-------TDS-----------
A0A7W8TSW5      ---------------------------------VMATGG-------TDS-----------
A0A1R4JTI6      -----------------------------------QTLP-------GVE-----------
A0A4R7TM52      -----------------------------------ASGG-------EA------------
A0A542XE74      -----------------------------------RETS-------EEQ-----------
A0A0Q7QDF6      -----------------------------------RAAE-------RAG-----------
A0A7X7XPM3      -----------------------------------SLGG-------G-------------
A0A5R8L819      -----------------------------------GSSG-------GGE-----------
A0A7K0PFV4      -----------------------------------IRRQ-------LRV-----------
A0A0G3V3F3      -----------------------------------LNKV-------EAE-----------
A0A7K0MUQ7      -----------------------------------LNQV-------EAE-----------
A0A7K0U619      -----------------------------------LNQV-------EAE-----------
A0A6I3DFP2      -----------------------------------LNQV-------EAE-----------
A0A7K0SI36      -----------------------------------LNQV-------EAE-----------
A0A7K0V140      -----------------------------------LNQV-------EAE-----------
A0A261FQA1      -----------------------------------ASNE-------TGL-----------
A0A1Q2CJ92      -----------------------------------TLTI-------TGE-----------
A0A2T0S3C8      -----------------------------------PRDR-------TAS-----------
A0A810MDE3      -----------------------------------PRDR-------TAS-----------
A0A4Y8WZJ3      -----------------------------------GGIA-------GQS-----------
A0A7X0KT97      -----------------------------------DGTA-------GSA-----------
A0A853DGU7      -----------------------------------DGGQ-------T-------------
A0A7Z0A2Z7      -----------------------------------KGST-------AQ------------
A0A285VUW0      -----------------------------------TLAQ-------SGA-----------
A0A849PJI9      -----------------------------------TLTA-------TGG-----------
A0A2R7Z032      -----------------------------------NTGR-------PAG-----------
A0A6J4MTQ2      -----------------------------------STGQ-------PAG-----------
A0A1I0W453      -----------------------------------TGEE-------NPK-----------
A0A0Q6VV12      -----------------------------------TGES-------NPR-----------
A0A495NTA9      -----------------------------------TGEA-------NPK-----------
A0A1H4LCS9      -----------------------------------NGGT-------TPK-----------
A0A4Q2RZP8      -----------------------------------NGGT-------TPK-----------
A0A0Q9QB08      -----------------------------------TGEE-------NPR-----------
A0A7Y9H290      -----------------------------------TGEE-------NPK-----------
A0A4Q2SA86      -----------------------------------TGEE-------SPR-----------
A0A4Z1C3Z0      -----------------------------------TGEE-------NPR-----------
A0A6V8KDX4      -----------------------------------PPGQ-------STA-----------
A0A444BL03      -----------------------------------TGSN-------AK------------
A0A7V9PCQ0      ------------------------------------------------------------
A0A4Y8X357      -----------------------------------PAS----------------------
R4LD52          -----------------------------------TPPG-------KQV-----------
A0A4T2CD79      -----------------------------------KAVT-------QQA-----------
A0A6L6AM03      -----------------------------------TGEE-------NPR-----------
A0A4Q2RU39      -----------------------------------GAN----------------------
A0A4Q2SK58      -----------------------------------GGT----------------------
A0A2N3YJR1      -----------------------------------TAGS-------GRG-----------
A0A6G8FYB9      -----------------------------------TAAD-------PSA-----------
A0A4Q4D742      -----------------------------------PATS-------GQA-----------
A0A1C6T1J1      -----------------------------------TPPS-------GEP-----------
A0A2W2CFC8      -----------------------------------TRPD-------GSA-----------
A0A2W2A4B0      -----------------------------------DANA-------SGV-----------
A0A4Y9MDA5      -----------------------------------PVGE-------DGS-----------
A0A1H7N9P7      -----------------------------------PAGE-------DGS-----------
A0A1M7V0F8      -----------------------------------PAGE-------DGS-----------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A838JYQ6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A7V8X3I0      ------------------------------------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A838JNW7      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      SANGSSRI-------------------------S------------AN----LVDE----
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ASGSHSSV-------------------------K------------LS----VVQP----
A0A4Q5B0V3      ASGSHSSV-------------------------K------------LS----VVQP----
A0A022KX11      ---------------------------------T------------------PIQP----
A0A4Q5A868      ASGSHSSV-------------------------K------------LS----VVQP----
A0A6N4VXX3      GDGNLPDT-------------------------R------------VV----VEQP----
A0A1H4I042      GDGSLPDT-------------------------R------------VV----VEQP----
A0A4R7A6D9      GDGSLPDT-------------------------R------------VV----VEQP----
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      AGGGSPMA-------------------------K------------LT----TVTP----
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ---------------------------------ELSPKRDGQDTVKAT----TISP----
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ---------------------------------RAAERAGEDAPDLPTLSPIVIQE----
A0A1Q2CRV2      ADGQKPVV--------------------------------------AT----VIRQ----
A0A261FE22      -SDGSSGI-------------------------Q------------LS----FIQK----
A0A7K0NRJ7      ERRAQPAN-------------------------R------------VN----VAAS----
K6WHS4          SAGGDPLA-------------------------K------------LT----VVSP----
A0A7K0NTR2      AGPQTSGL-------------------------V------------TL----ESASREST
A0A1H6WL79      SPGTEPVT-------------------------K------------IV----PLAK----
A0A101LAM5      SPGTEPVT-------------------------K------------IV----PLAK----
A0A4Y3NEG0      SPGTEPVT-------------------------K------------IV----PLTK----
A0A1Q2CI19      PGAETTRL-------------------------S------------VL----QEA-----
A0A512T3M3      PEAAGTRL-------------------------S------------IL----QRG-----
W6JTW4          P-SGGTRL-------------------------T------------IV----QDA-----
A0A839J1M0      PGAGSAEL-------------------------T------------ML----QEA-----
A0A8A4Z8K4      PGAGSAEL-------------------------T------------ML----QEA-----
A0A0A0JTY0      AGVENARL-------------------------E------------VL----QTA-----
A0A0A0JXF2      PGAENTTL-------------------------T------------IL----QPA-----
E6S8H2          PGVGRANV-------------------------S------------IL----QRA-----
A0A0A0JGH0      PGVGRAVV-------------------------T------------IL----QEA-----
N0E4U7          PGTGGAAV-------------------------S------------VL----QVA-----
A0A0A0IYK2      PGAENVAV-------------------------S------------IL----QAA-----
A0A0Q9L0H3      PGAETTTL-------------------------S------------LL----QPA-----
A3TMK0          PGAENATL-------------------------S------------VL----QPA-----
A0A543PXP1      PGTGNATV-------------------------T------------IL----QRA-----
A3TMH6          PGTGTVGI-------------------------T------------VL----QSA-----
A0A6I2XCV4      AVSDQTVA-------------------------A------------FT----VFQPAIAV
A0A5R8VLL6      APVVTPPI-------------------------S------------LV----PLDP----
A0A3L7ADK2      GVIGAQNT-------------------------K------------FV----SVSK----
A0A538JQF8      ---GRTDL-------------------------S------------RF----LAQR----
A0A1H6YPK1      SNPERTVI-------------------------N------------VM----VLQQ----
A0A0Q9TBP0      DSLTTAAA-------------------------G------------GE----LLHS----
A0A0G3V3M7      IGPQTSGL-------------------------T------------TL----EAATKGRA
A0A6I3DD56      AGPQTSGL-------------------------T------------TL----EAATKARA
A0A5Q2FA83      AGQGVKAT-------------------------T------------IT----P-------
A0A2R7MGI0      GGTGQGAV-------------------------R------------LI----AGDS----
A0A2T7WQY4      GGSGQGAV-------------------------R------------LI----AGDS----
A0A0Q5Q5L3      GGSGQGAV-------------------------R------------LV----AGDS----
A0A0Q6DVM4      GGSGQGAV-------------------------R------------LV----AGDS----
A0A1N7DLV3      TGGGHGAV-------------------------K------------LV----AGDS----
A0A1V2NSB5      TGGAHSAV-------------------------K------------LV----AGDS----
A0A1R3WWR6      GGNGESAV-------------------------R------------LI----AGDS----
A0A1G6GTN3      GAGGRSAV-------------------------R------------LV----AGDS----
A0A7W5GFA5      GGGGQSAV-------------------------R------------LV----AGDS----
A0A2S5WZJ5      VGGGVSNV-------------------------T------------VI----PLED----
A0A0Q5JKD6      GGGGQSAV-------------------------R------------LV----AGDS----
A0A2W6DK08      GFTGAVST-------------------------P------------VN----PVLQARAA
A0A346XTB0      LAVRLRGD-------------------------G------------VE----DFQD----
A0A542FTE6      GTIRTQAT-------------------------S------------FV----PLAA----
A0A7Y9QM02      GTIRTQAT-------------------------S------------FV----PLAA----
A0A6I1G2U1      DGTGEAEL-------------------------S------------IL------------
A0A351ETF8      RFLDSPDV-------------------------S------------AQ----VSQL----
A0A349B7N2      VAVPISGD-------------------------A------------FV----AALQETLG
A0A4Q2JUT1      SPTGAAPV-------------------------Q------------VV----TRES----
A0A6L5R0V7      SPTGAAPV-------------------------Q------------VV----TRES----
A0A2S0LQ32      DETYNSQT-------------------------R------------LV----ALEP----
A0A7T8DZN6      DETYNSQT-------------------------R------------LV----ALEP----
A0A2N6V1R5      TDNSYRET-------------------------R------------VT----QTLQ----
G9PHS6          TDNSYRET-------------------------R------------VT----QTLQ----
U1PLM7          TDNSYRET-------------------------R------------VT----QTLQ----
A0A4V1VGV9      TEAKTSVY-------------------------R------------VF----PLTA----
A0A2S5UYV0      AGGGVSSV-------------------------T------------VL----PLQD----
A0A7W4UQ09      MGGGVSNV-------------------------T------------VF----PLED----
A0A2S5X9U6      VGGGASGV-------------------------T------------VV----ELQN----
A0A2S5ULV5      VGGGTSGV-------------------------T------------VV----PLQN----
A0A653YMF0      VGGGASGV-------------------------T------------VV----PLQN----
A0A7V9H755      SEELQLAQ-------------------------Q------------VQ----TVQKRVDQ
A0A3Q9IY80      GGVSLATV-------------------------Q------------LV----PGDT----
A0A0F0LP73      TVVPTEGI-------------------------V------------IV----PLDQ----
A0A346Y185      VDSTLFGS-------------------------G------------VE----LFER----
A0A7W0HGW1      VDASVRQG-------------------------A------------IT----VVAP----
A0A259S8H9      TNAAPGGI-------------------------A------------IV----PMDE----
A0A2W1Z497      EALASATT-------------------------K------------LV----PLAS----
A0A0Q5L115      TDTGGSAT-------------------------S------------FV----ALSS----
A0A7G6YY64      TDTGGSAT-------------------------S------------FV----ALSS----
A0A7J5B4S5      GG-GVSSV-------------------------T------------VL----PLQD----
A0A852U976      GG-GVSSV-------------------------T------------VL----PLQD----
A0A1F1X071      NENAAVGV-------------------------Q------------LT----NYQN----
A0A3R8RWC7      NENAAVGV-------------------------Q------------LT----NYQN----
A0A4U0RJZ4      GA-KSTVY-------------------------D------------AY----PLSR----
A0A4R1FGL9      GA-KSTVY-------------------------D------------AY----PLSR----
E3B8H1          GA-KSTVY-------------------------D------------AY----PLSR----
A0A7D7WDT9      GAVNAGGF-------------------------T------------IV----PMDN----
A0A0Q5AWK6      TADRTPQI-------------------------T------------VV----PLEN----
A0A6P1F176      TADRTPGI-------------------------T------------VV----PLEN----
A0A3N1NLD3      TADRTPQI-------------------------T------------VV----PLEN----
A0A3N2FVI8      TADRTPQI-------------------------T------------VV----PLEN----
A0A2S5XDQ6      TADRTPQI-------------------------T------------VV----PLEN----
A0A2S5XNN6      TADRTPQI-------------------------T------------VV----PLEN----
A0A5C8C085      ---------------------------------R------------LL----PVES----
A0A4Y5YMQ6      ----------------------------------------------STVGARVIDP----
A0A1E4BP96      ---------------------------------T------------LI----PGDS----
A0A7V9FXS6      ----------------------------------------------------IIAR----
A0A7W0PY69      ----------------------------------------------------LVAQ----
A0A7W8YB99      DPDFQPAV-------------------------Q------------LL----PMTK----
A0A1L2ZMQ6      DKDFQPAV-------------------------E------------LM----PMTE----
A0A7W8TR75      DEDFQPAV-------------------------E------------LM----PMTE----
A0A151BT98      ----------------------------------------------ST----AVQP----
A0A2Y8ZRF8      ----------------------------------------------ST----AVQP----
A0A2R9UAT1      ---------------------------------R------------LV----PADT----
A0A3E2DN22      ---------------------------------KSDAQLAKMTSVHVL----GYES----
A0A3Q9ULZ9      ---------------------------------YTQAQLEKLTAIHVL----SYEP----
A0A3S9JFL2      ---------------------------------YSQAQLEKLTAIHVL----SYEP----
A0A3L8NYD3      -APVSTLV-------------------------K------------LV----ATQQ----
A0A1M6K628      PTD-QLVV-------------------------K------------IA----PVEP----
A0A561E8R3      PAGTQPSV-------------------------R------------IY----PFDN----
A0A4Q5J5D7      ------AL-------------------------K------------VV----PIEA----
A0A1Y4CKD6      ----------------------------------------------FVLGNIAFNL----
A0A0Q7KBQ4      ---------------------------------R------------------IVGP----
A0A5Q5BFU2      ---------------------------------R------------VV----VEQR----
A0A439DNZ6      ---------------------------------R------------VI----VEQR----
A0A7I7UD03      ---------------------------------R------------VV----VEQR----
A0A7I7MI62      ---------------------------------R------------VV----VEQR----
A0A0J6YE86      ---------------------------------R------------VV----VEQR----
A0A7I7K1R9      ---------------------------------R------------VV----VEQR----
A0A7I9ZLK4      ---------------------------------R------------VV----VEQR----
A0A1F1IHY9      ----------------------------------------------SIISLETLSD----
A0A7H2BCD6      ---------------------------------R------------VV----PLED----
A0A3S0V9U6      ----------------------------------------------VI----PLDD----
A0A7T4T4U7      ----------------------------------------------VT----PLDD----
A0A1S2N0P2      ----------------------------------------------VT----PLDD----
A0A0Q3BEY5      ----------------------------------------------VT----PLDD----
A0A4R6Q3C6      ----------------------------------------------VT----PLDD----
A0A7T3CHP7      ----------------------------------------------VT----PLDD----
A0A7Y5U6C1      YSKISASA-------------------------QQLQTIQT-----LQGANASVIK----
A0A542HCT5      ---------------------------------R------------IV----PIES----
A0A537WNY9      ----------------------------------------------LK----ELDR----
A0A5B8M469      -ASDTPHL-------------------------K------------VI----PLDN----
A0A2S8WHZ8      --DRATAV-------------------------K------------LQ----PLGQ----
A0A1Y4CTD2      ----------------------------------------------YVFSNATLQL----
A0A3N3ZPU0      SEDGTGLV-------------------------Q------------VV----PVSS----
A0A359IQX7      -TPGQSVV-------------------------K------------LQ----PYIS----
A0A7W9IKV0      ---------------------------------K------------VT----VVDQ----
A0A1N7E3F1      ---------------------------------R------------VT----VVDD----
A0A544ZKQ1      ---------------------------------R------------VT----VVDE----
A0A5D0Q2X0      ---------------------------------R------------VT----VIDE----
A0A5R8Z2E7      ---------------------------------R------------VT----VIDE----
A0A0Q9LZR0      ---------------------------------R------------VV----PIES----
A0A1F1J417      GEENQESAQNKVSSTNPSDTTNTLI--------R------------VI----PLDN----
A0A2A8D6P2      GEENQESAQNKVSSTNPSDTTNTLI--------R------------VI----PLDN----
A0A1F0THV9      GEENQESAQNKVSSTNPSDTTNTLI--------R------------VI----PLDN----
A0A5F0M6Y0      GEENQESAQNKVSSTNPSDTTNTLI--------R------------VI----PLDN----
E3H5W1          GEENQESAQNKVSSTNPSDTTNTLI--------R------------VI----PLDN----
A0A1F1QKB0      GEENQESAQNKVSSTNPSDTTNTLI--------R------------VI----PLDN----
A0A509JY23      GEENQESAQNKVSSTNPSDTTNTLI--------R------------VI----PLDN----
A0A448USF4      GEENQESAQNKVSSTNPSDTTNTLI--------R------------VI----PLDN----
A0A7Z9A2N0      AENGNAAG--ASANTAVSGNAANNI--------R------------VI----PLDN----
A0A433EDP2      AENGNTAGANASANTAVSGNAANNI--------R------------VI----PLDN----
A0A231VTW0      TENGNTAGASASANTAVSGNAANNI--------R------------VI----PLDN----
A0A433ECD0      TENGNTAGASASANTAVSGNAANNI--------R------------VI----PLDN----
A0A7T9UPU8      AENGNTAGASASANTAVSGNAANNI--------R------------VI----PLDN----
U7V3Z1          TENGNTAGASASANTAVSGNAANNI--------R------------VI----PLDN----
A0A6I3F378      IETLDHSIAASGNDDDSTREAQRRELLAQQADFRHTLEQQQIDARLDTPGAKVVHP----
A0A838H0S5      LVSLESRA-------------------------RQLAVDASLYGSGVT----LFER----
A0A1S1CQC5      PSASSNTV-------------------------R------------VI----PLNN----
A0A1E9T6I0      PPANSNTV-------------------------R------------VI----PLNN----
A0A1F1GHA7      PPANSNTV-------------------------R------------VI----PLNN----
A0A1S1CAD0      -PTGGNTV-------------------------R------------VI----PLNN----
G5ET14          -PTGGNTV-------------------------R------------VI----PLNN----
A0A1E9DXX2      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1E8S156      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1E8S5S2      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1S1DFA8      -PTGGNTV-------------------------R------------VI----PLNN----
A0A2I1Z490      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1F0DAA9      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1F0PHK9      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1F0VZG6      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1E9G8X4      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1E9IAW2      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1E9ZBC9      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1E9ZDP4      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1F0R6B5      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1F0Z7N5      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1F1D897      -PTGGNTV-------------------------R------------VI----PLNN----
D2NP38          -PTGGNTV-------------------------R------------VI----PLNN----
A0A1F1FV74      -PTTNNTV-------------------------R------------VI----PLNN----
A0A1E9M791      -PTTNNTV-------------------------R------------VI----PLNN----
A0A291DEI8      -PTTNNTV-------------------------R------------VI----PLNN----
A0A1S1D5T1      -PTGGNTV-------------------------R------------VI----PLNN----
A0A1E8TRD6      -PTTSNTV-------------------------R------------VI----PLNN----
A0A1F0XT88      -PTTSNTV-------------------------R------------VI----PLNN----
A0A1F1EVP5      -PTTSNTV-------------------------R------------VI----PLNN----
C6R548          -PTTNNTV-------------------------R------------VI----PLNN----
A0A0K2RXS2      -PTTNNTV-------------------------R------------VI----PLNN----
A0A1F0KX60      -PTTNNTV-------------------------R------------VI----PLNN----
A0A542I3V2      -TPPALPV-------------------------G------------LV----PLDK----
A0A2T0UZ65      -PGTQALV-------------------------R------------II----PIET----
A0A0Q5M6Z7      -AIAEPAI-------------------------S------------FV----ALAS----
A0A7G6YA19      -SVGDPAI-------------------------S------------FV----PLAN----
A0A853CXS3      -SVGDPAI-------------------------S------------FV----PLAN----
A0A7W8YB56      -TSTIPVV-------------------------Q------------II----PISS----
A0A1L2ZMV4      -TSSVPVV-------------------------Q------------II----PISS----
A0A7W8TSW5      -TSSVPVV-------------------------Q------------II----PISS----
A0A1R4JTI6      -QSEESSA-------------------------Q------------SIVKVLPLVQ----
A0A4R7TM52      ------LV-------------------------Q------------LV----PGDS----
A0A542XE74      -MRGMTSI-------------------------N------------VL----AYEP----
A0A0Q7QDF6      -EDAPDLP-------------------------T------------LSPI--VIQE----
A0A7X7XPM3      ------TV-------------------------S------------VT----TVMP----
A0A5R8L819      ------VV-------------------------R------------LV----EGDS----
A0A7K0PFV4      -WRDQGDP-------------------------T------------FS----IAQR----
A0A0G3V3F3      -RRAQPAN-------------------------R------------VN----VAAS----
A0A7K0MUQ7      -RRAQPAN-------------------------R------------VN----VAAG----
A0A7K0U619      -RRAQPAN-------------------------R------------VN----VAAG----
A0A6I3DFP2      -RRAQPAN-------------------------R------------VN----VAAG----
A0A7K0SI36      -RRAQPAN-------------------------R------------VN----VAAG----
A0A7K0V140      -RRAQPAN-------------------------R------------VN----VAAG----
A0A261FQA1      -FN---GL-------------------------Q------------FS----VIER----
A0A1Q2CJ92      -SSGQTVV-------------------------R------------IV----PVEL----
A0A2T0S3C8      ------PI-------------------------K------------VE----VVAG----
A0A810MDE3      ------PI-------------------------K------------VE----VVAG----
A0A4Y8WZJ3      ------II-------------------------S------------LE----TLSD----
A0A7X0KT97      ------PL-------------------------T------------VR----IASP----
A0A853DGU7      ------VI-------------------------R------------VV----PLQN----
A0A7Z0A2Z7      ------AV-------------------------R------------VT----PVTG----
A0A285VUW0      ------SV-------------------------A------------AQ----FVDQ----
A0A849PJI9      -NAGNSVV-------------------------S------------IF----PFDN----
A0A2R7Z032      -NKAETLV-------------------------Q------------VV----PLEQ----
A0A6J4MTQ2      -GQAVSLV-------------------------R------------VV----PYEQ----
A0A1I0W453      -EP--ALT-------------------------R------------II----PLEE----
A0A0Q6VV12      -RD--PLT-------------------------R------------VV----PVQP----
A0A495NTA9      -TD--PLT-------------------------R------------IV----PVTP----
A0A1H4LCS9      -GD--SLA-------------------------T------------IV----PLEE----
A0A4Q2RZP8      -GD--PLA-------------------------R------------IV----PLEE----
A0A0Q9QB08      -GP--SLT-------------------------R------------II----PVTP----
A0A7Y9H290      -EA--PLT-------------------------R------------II----PLEP----
A0A4Q2SA86      -EA--PLT-------------------------R------------IV----PVEQ----
A0A4Z1C3Z0      -GD--PLT-------------------------R------------IV----AVEP----
A0A6V8KDX4      ------TV-------------------------K------------VD----VVAG----
A0A444BL03      ------NI-------------------------V------------TI----VPIE----
A0A7V9PCQ0      ------AI-------------------------L------------LE----LDDP----
A0A4Y8X357      ------NV-------------------------K------------VT----AMED----
R4LD52          -S----SV-------------------------K------------VE----VVAG----
A0A4T2CD79      -GN--TVV-------------------------A------------AVTFLEPVES----
A0A6L6AM03      -EE--PLT-------------------------R------------II----PLEQ----
A0A4Q2RU39      ------LA-------------------------R------------II----PLEE----
A0A4Q2SK58      ------LT-------------------------R------------II----PLEE----
A0A2N3YJR1      -A----AS-------------------------V------------TI----VPIE----
A0A6G8FYB9      -K----PI-------------------------V------------SI----VPIE----
A0A4Q4D742      -A----AV-------------------------T------------AR----IAAD----
A0A1C6T1J1      -G----PI-------------------------K------------IE----IVSG----
A0A2W2CFC8      -G----PI-------------------------K------------IE----VISG----
A0A2W2A4B0      ------GV-------------------------T------------VT----QTSP----
A0A4Y9MDA5      -P----SV-------------------------R------------AD----TVAP----
A0A1H7N9P7      -P----AV-------------------------R------------AT----TVAP----
A0A1M7V0F8      -R----AV-------------------------R------------AT----TVAS----
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ---------------------------------P--------------------------
A0A538AM15      ---------------------------------P--------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A838JYQ6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A7V8X3I0      ------------------------------------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A838JNW7      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------AVVEPSPAA-----------------------PVRE
A0A348NU28      ------------------------AVVPNVQAL-----------------------PNKP
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------------AAVPSSPSS-----------------------PKWK
A0A4Q5B0V3      ------------------------AAVPSSPSS-----------------------PKWK
A0A022KX11      ------------------------ASAPAQPVS-----------------------PNPT
A0A4Q5A868      ------------------------AAVPSSPSS-----------------------PKWK
A0A6N4VXX3      ------------------------ASVSSSPAI-----------------------PNLF
A0A1H4I042      ------------------------AAIASSPAV-----------------------PNLM
A0A4R7A6D9      ------------------------AAIASSPAV-----------------------PNLM
A0A345NSU7      ------------------------AAVPGRPVE-----------------------PDPE
A0A222TG79      ------------------------AVEPSVPVS-----------------------PGIE
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------ALPPPSPSS-----------------------PKVA
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------GTASSQPVE-----------------------PDAR
A0A1Q2CRV2      ------------------------PLVPTAPTS-----------------------PKPL
A0A261FE22      ------------------------PYVPSSPSS-----------------------PNVK
A0A7K0NRJ7      ------------------------AHASSTPIS-----------------------PHPT
K6WHS4          ------------------------ATVDDAPVS-----------------------PRYG
A0A7K0NTR2      T-----------------------VLVTQAKGS-----------------------SSES
A0A1H6WL79      ------------------------ATLPSAPVS-----------------------PLLT
A0A101LAM5      ------------------------ASLPSAPVS-----------------------PLLT
A0A4Y3NEG0      ------------------------ASLPSAPIS-----------------------PLLT
A0A1Q2CI19      ------------------------TPIPNE-ST-----------------ANFVIPPDRW
A0A512T3M3      ------------------------IPVAEA--H-----------------KGTLIPPGRP
W6JTW4          ------------------------VAVPDA--N-----------------PGSILPPGRP
A0A839J1M0      ------------------------TPIPNQ-ST-----------------AGFVIPPDRN
A0A8A4Z8K4      ------------------------TPIPNQ-ST-----------------AGFVIPPDRN
A0A0A0JTY0      ------------------------TPIPTAGSD-----------------GGFVIPPGRG
A0A0A0JXF2      ------------------------TPIPSTAND-----------------GGFVVPPGRG
E6S8H2          ------------------------TPIPNV-TG-----------------GGFVIPPDRT
A0A0A0JGH0      ------------------------TPIPDE-IG-----------------GGFVVPPSRP
N0E4U7          ------------------------TPIPDQ-IG-----------------GGFVVPPSRP
A0A0A0IYK2      ------------------------SPVPVANSD-----------------GGFVVPPGRG
A0A0Q9L0H3      ------------------------TPIPSAATD-----------------GGFVIPPGRG
A3TMK0          ------------------------TPIPSATTD-----------------GGFVVPPGRG
A0A543PXP1      ------------------------TPIPNV-TG-----------------GGFVVPPGRA
A3TMH6          ------------------------SPIPNA-DG-----------------GGFVVPPSRP
A0A6I2XCV4      QINGRAFAIRYDANLNSRGSISATQSVPKLTFS--------------ETDLTVVSGSSRA
A0A5R8VLL6      ------------------------ATVPTHPVS-----------------------PGMG
A0A3L7ADK2      ------------------------AATPNSPVS-----------------------PNVI
A0A538JQF8      ------------------------AAATFHPKP-------------------------RR
A0A1H6YPK1      ------------------------ARLPSVPAS-----------------------PAIK
A0A0Q9TBP0      ------------------------AEPADNPVS-----------------------PQIV
A0A0G3V3M7      T-----------------------IIVSRAQGS-----------------------TSES
A0A6I3DD56      T-----------------------ILVTSAKGS-----------------------TSES
A0A5Q2FA83      ------------------------ATVPSQPVS-----------------------PNLL
A0A2R7MGI0      ------------------------ARLPTSPSS-----------------------PNIK
A0A2T7WQY4      ------------------------ARLPTSPSS-----------------------PNVK
A0A0Q5Q5L3      ------------------------ARLPTSPSS-----------------------PNVR
A0A0Q6DVM4      ------------------------ARLPTSPSS-----------------------PNVR
A0A1N7DLV3      ------------------------ARLPTAPSS-----------------------PNEK
A0A1V2NSB5      ------------------------ARLPTSPSS-----------------------PNEK
A0A1R3WWR6      ------------------------ARLPTSPSS-----------------------PNVR
A0A1G6GTN3      ------------------------ARLPTAPSS-----------------------PNVR
A0A7W5GFA5      ------------------------ARLPTAPSS-----------------------PNVR
A0A2S5WZJ5      ------------------------AVPPTTPVT-----------------------PNLQ
A0A0Q5JKD6      ------------------------ARLPTAPSS-----------------------PNVR
A0A2W6DK08      ALSARYAAIYGLLQETANQANNPTGLDTLSPAA------------GATFNAGAFSLSSTT
A0A346XTB0      ------------------------AIPPDFPSR-----------------------PRPR
A0A542FTE6      ------------------------ATTPTAPSS-----------------------PNIF
A0A7Y9QM02      ------------------------ATTPTAPSS-----------------------PNIL
A0A6I1G2U1      ------------------------AEATPIPII---------------ASGGFSIPPSRT
A0A351ETF8      ------------------------AEVPTIPVS-----------------------PNVT
A0A349B7N2      ------------------------ATDPSEPTAIEDGDPDEEDPLLEAFDAGPSEPPSPA
A0A4Q2JUT1      ------------------------ASLPTSPAF-----------------------PDVQ
A0A6L5R0V7      ------------------------ASLPSSPAF-----------------------PDVQ
A0A2S0LQ32      ------------------------AQLPGAPFS-----------------------PDTT
A0A7T8DZN6      ------------------------AQLPGAPFS-----------------------PDTT
A0A2N6V1R5      ------------------------AVAPSAPSS-----------------------PDFY
G9PHS6          ------------------------AVAPSAPSS-----------------------PDFY
U1PLM7          ------------------------AVAPSAPSS-----------------------PDFY
A0A4V1VGV9      ------------------------AARPSAPSS-----------------------PNWM
A0A2S5UYV0      ------------------------AVEPTSPES-----------------------PNLR
A0A7W4UQ09      ------------------------ATEPTTPVS-----------------------PNLR
A0A2S5X9U6      ------------------------AVEPTSPVS-----------------------PNLR
A0A2S5ULV5      ------------------------AVEPTSPVS-----------------------PNLR
A0A653YMF0      ------------------------AVEPTSPVS-----------------------PNLR
A0A7V9H755      LQEELQKAKMAEAVEAGQIEIVDLVEKPGNEIP-----------------------NGSS
A0A3Q9IY80      ------------------------ARLPSSPSS-----------------------PNVR
A0A0F0LP73      ------------------------AVAPRTPSA-----------------------PDKR
A0A346Y185      ------------------------ADVPESPSA-----------------------PTPV
A0A7W0HGW1      ------------------------AERPKEPVQ-----------------------PRPF
A0A259S8H9      ------------------------AVAPTRPSA-----------------------PNKP
A0A2W1Z497      ------------------------ATVPTSPSS-----------------------PDVR
A0A0Q5L115      ------------------------ASVPTSPAS-----------------------PNVE
A0A7G6YY64      ------------------------ASVPTSPAS-----------------------PNVE
A0A7J5B4S5      ------------------------AVAPTSPES-----------------------PNLR
A0A852U976      ------------------------AVAPTSPES-----------------------PNLR
A0A1F1X071      ------------------------AVVPGAPVS-----------------------PDRE
A0A3R8RWC7      ------------------------AVVPGAPVS-----------------------PDRE
A0A4U0RJZ4      ------------------------AGLPASQTS-----------------------PKWP
A0A4R1FGL9      ------------------------AGLPASQTS-----------------------PKWP
E3B8H1          ------------------------AGLPASQTS-----------------------PKWP
A0A7D7WDT9      ------------------------AAQPTSPVS-----------------------PNLR
A0A0Q5AWK6      ------------------------AEPASTPTS-----------------------PNWL
A0A6P1F176      ------------------------AEPASAPTS-----------------------PDWL
A0A3N1NLD3      ------------------------AEPAAAPTS-----------------------PNWL
A0A3N2FVI8      ------------------------AEPAAAPTS-----------------------PNWL
A0A2S5XDQ6      ------------------------AEPPAAPTS-----------------------PDWV
A0A2S5XNN6      ------------------------AEPPAAPTS-----------------------PDWV
A0A5C8C085      ------------------------AALPSAPVS-----------------------PNIT
A0A4Y5YMQ6      ------------------------GAPAQFQSS-----------------------PNKS
A0A1E4BP96      ------------------------ARLPTAPSS-----------------------PNTT
A0A7V9FXS6      ------------------------ALPQSSPTA-----------------------PPRR
A0A7W0PY69      ------------------------AIPPTQPAA-----------------------PPRR
A0A7W8YB99      ------------------------GALPTAPYA-----------------------PDVE
A0A1L2ZMQ6      ------------------------GTLPTSPYA-----------------------PNVN
A0A7W8TR75      ------------------------GTLPTSPYA-----------------------PNVN
A0A151BT98      ------------------------AEVPASPAS-----------------------PDLK
A0A2Y8ZRF8      ------------------------ATVPSSPAS-----------------------PDIK
A0A2R9UAT1      ------------------------ARLPTAPSS-----------------------PNVR
A0A3E2DN22      ------------------------AGLPSGDRG-----------------------KSVA
A0A3Q9ULZ9      ------------------------AGLPATPKQ-----------------------DNLL
A0A3S9JFL2      ------------------------AGLPATPKT-----------------------ANLP
A0A3L8NYD3      ------------------------AGAPSAPSS-----------------------PDYR
A0A1M6K628      ------------------------ALTPSRPTS-----------------------PNWA
A0A561E8R3      ------------------------ATTPSLPFS-----------------------PDFK
A0A4Q5J5D7      ------------------------AALPSAPVS-----------------------PRVE
A0A1Y4CKD6      ------------------------IDEISTPAT-----------------------PVNE
A0A0Q7KBQ4      ------------------------PSISQTPVA-----------------------PNVP
A0A5Q5BFU2      ------------------------ASIANKPVI-----------------------PKTA
A0A439DNZ6      ------------------------ASIPKSPVI-----------------------PKTA
A0A7I7UD03      ------------------------ASIPDSPVV-----------------------PKTA
A0A7I7MI62      ------------------------ATIPDHAVV-----------------------PKTA
A0A0J6YE86      ------------------------ASIPSSPVV-----------------------PKRA
A0A7I7K1R9      ------------------------ASIPGDPVV-----------------------PKTL
A0A7I9ZLK4      ------------------------ASIPDDPVV-----------------------PKTG
A0A1F1IHY9      ------------------------ASLPSAPSS-----------------------PNLP
A0A7H2BCD6      ------------------------ALPNNSPIS-----------------------PNTW
A0A3S0V9U6      ------------------------AQKPGSPVG-----------------------PNVK
A0A7T4T4U7      ------------------------AQAPDGPVS-----------------------PSYR
A0A1S2N0P2      ------------------------AQAPDGPVS-----------------------PSYR
A0A0Q3BEY5      ------------------------AQAPDGPVS-----------------------PSYR
A0A4R6Q3C6      ------------------------AQAPDGPVS-----------------------PSYR
A0A7T3CHP7      ------------------------AQAPDGPVS-----------------------PSYR
A0A7Y5U6C1      ------------------------TAETAPQIS-----------------------PRPR
A0A542HCT5      ------------------------AALPASPVS-----------------------PNTQ
A0A537WNY9      ------------------------PALPQAPVF-----------------------PRKR
A0A5B8M469      ------------------------ATAPSTPVS-----------------------PKPK
A0A2S8WHZ8      ------------------------AVLPSSPVS-----------------------PNTK
A0A1Y4CTD2      ------------------------VQEPSVPES-----------------------PSNT
A0A3N3ZPU0      ------------------------ASVPESPVS-----------------------PDLR
A0A359IQX7      ------------------------AAESPNPVS-----------------------PNWK
A0A7W9IKV0      ------------------------ASVPGAPIS-----------------------PRPV
A0A1N7E3F1      ------------------------AEVPEDPVA-----------------------PQPL
A0A544ZKQ1      ------------------------AEVPKEPVA-----------------------PQPL
A0A5D0Q2X0      ------------------------AEVPREPVA-----------------------PQPL
A0A5R8Z2E7      ------------------------AEVPREPVA-----------------------PQPL
A0A0Q9LZR0      ------------------------AALPASPVS-----------------------PNTR
A0A1F1J417      ------------------------ASVNPPLVS-----------------------PNYM
A0A2A8D6P2      ------------------------ASVNPPLVS-----------------------PNYM
A0A1F0THV9      ------------------------ASVNPPLVS-----------------------PNYM
A0A5F0M6Y0      ------------------------ASVNPPLVS-----------------------PNYM
E3H5W1          ------------------------ASVNPPLVS-----------------------PNYM
A0A1F1QKB0      ------------------------ASVNPPLVS-----------------------PNYM
A0A509JY23      ------------------------ASVNPPLVS-----------------------PNYM
A0A448USF4      ------------------------ASVNPPLVS-----------------------PNYM
A0A7Z9A2N0      ------------------------ASINPPLVS-----------------------PNYT
A0A433EDP2      ------------------------ASINPPLVS-----------------------PNYT
A0A231VTW0      ------------------------ASINPPLVS-----------------------PNYT
A0A433ECD0      ------------------------ASINPPLVS-----------------------PNYT
A0A7T9UPU8      ------------------------ASINPPLVS-----------------------PNYT
U7V3Z1          ------------------------ASINPPLVS-----------------------PNYT
A0A6I3F378      ------------------------AETPGTPVR-----------------------PTPI
A0A838H0S5      ------------------------AQLPESPAT-----------------------PKPL
A0A1S1CQC5      ------------------------ASVNPPLVS-----------------------PNYQ
A0A1E9T6I0      ------------------------ASVNPPLVS-----------------------PNYQ
A0A1F1GHA7      ------------------------ASVNPPLVS-----------------------PNYQ
A0A1S1CAD0      ------------------------ASVNPPLVA-----------------------PNYE
G5ET14          ------------------------ASVNPPLVA-----------------------PNYE
A0A1E9DXX2      ------------------------ASVNPPLVA-----------------------PNYK
A0A1E8S156      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1E8S5S2      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1S1DFA8      ------------------------ASVNPPLVA-----------------------PNYQ
A0A2I1Z490      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1F0DAA9      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1F0PHK9      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1F0VZG6      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1E9G8X4      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1E9IAW2      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1E9ZBC9      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1E9ZDP4      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1F0R6B5      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1F0Z7N5      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1F1D897      ------------------------ASVNPPLVA-----------------------PNYQ
D2NP38          ------------------------ASVNPPLVA-----------------------PNYQ
A0A1F1FV74      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1E9M791      ------------------------ASVNPPLVA-----------------------PNYQ
A0A291DEI8      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1S1D5T1      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1E8TRD6      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1F0XT88      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1F1EVP5      ------------------------ASVNPPLVA-----------------------PNYQ
C6R548          ------------------------ASVNPPLVA-----------------------PNYQ
A0A0K2RXS2      ------------------------ASVNPPLVA-----------------------PNYQ
A0A1F0KX60      ------------------------ASVNPPLVA-----------------------PNYQ
A0A542I3V2      ------------------------AALPTTPIS-----------------------PNIK
A0A2T0UZ65      ------------------------ALLPGAPIG-----------------------PNVT
A0A0Q5M6Z7      ------------------------ARPPYFPSS-----------------------PNVQ
A0A7G6YA19      ------------------------ARAPYFPSS-----------------------PDIQ
A0A853CXS3      ------------------------ARAPYFPSS-----------------------PNIQ
A0A7W8YB56      ------------------------ALLPTAPSA-----------------------PSLR
A0A1L2ZMV4      ------------------------ALLPSAPSA-----------------------PVLR
A0A7W8TSW5      ------------------------ALLPSAPSA-----------------------PVLR
A0A1R4JTI6      ------------------------ATQPQTPHT-----------------------PNVR
A0A4R7TM52      ------------------------AQLPTSPSS-----------------------PNWR
A0A542XE74      ------------------------AALPSSPVR-----------------------PGVI
A0A0Q7QDF6      ------------------------GTASSQPVE-----------------------PDAR
A0A7X7XPM3      ------------------------ASPPATPTT-----------------------PDVT
A0A5R8L819      ------------------------ARLPSSPSY-----------------------PNDR
A0A7K0PFV4      ------------------------ATAPDGPDG-----------------------PADW
A0A0G3V3F3      ------------------------AHASSTPIS-----------------------PHPT
A0A7K0MUQ7      ------------------------AHAHSTPIS-----------------------PHPT
A0A7K0U619      ------------------------AHAHSTPIS-----------------------PHPT
A0A6I3DFP2      ------------------------AHAHSTPIS-----------------------PHPT
A0A7K0SI36      ------------------------AHAHSTPIS-----------------------PHPT
A0A7K0V140      ------------------------AHAHSTPIS-----------------------PHPT
A0A261FQA1      ------------------------AVAPSSPVS-----------------------PNKP
A0A1Q2CJ92      ------------------------AQTPTTPVS-----------------------PNYV
A0A2T0S3C8      ------------------------PTGGDTPVS-----------------------PKPL
A0A810MDE3      ------------------------PTGGDTPVS-----------------------PKPL
A0A4Y8WZJ3      ------------------------ASLPSAPSS-----------------------PNLP
A0A7X0KT97      ------------------------AVVPSTPVY-----------------------PDPQ
A0A853DGU7      ------------------------ATGDGGRIS-----------------------PNVK
A0A7Z0A2Z7      ------------------------PT-DVVQVA-----------------------PSAK
A0A285VUW0      ------------------------PTQSSEPVS-----------------------PNPT
A0A849PJI9      ------------------------ATQPSKPFS-----------------------PNIP
A0A2R7Z032      ------------------------AQLPGAPFT-----------------------PNYR
A0A6J4MTQ2      ------------------------AQLPTEPFT-----------------------PDYR
A0A1I0W453      ------------------------AQLPGAPFT-----------------------PNYE
A0A0Q6VV12      ------------------------AELPQAPFT-----------------------PDYA
A0A495NTA9      ------------------------AQLPGAPFT-----------------------PDYR
A0A1H4LCS9      ------------------------AQLPGAPFT-----------------------PNYQ
A0A4Q2RZP8      ------------------------AALPGAPFT-----------------------PNYK
A0A0Q9QB08      ------------------------AELPGAPFT-----------------------PDYR
A0A7Y9H290      ------------------------AELPGAPFT-----------------------PNYR
A0A4Q2SA86      ------------------------AQLPTAPFS-----------------------PDYP
A0A4Z1C3Z0      ------------------------AQLPSAPFS-----------------------PDYR
A0A6V8KDX4      ------------------------PTPDDAPVS-----------------------PKPV
A0A444BL03      ------------------------SALPGRRIA-----------------------PDPP
A0A7V9PCQ0      ------------------------AFTPRSAAA-----------------------PQPT
A0A4Y8X357      ------------------------ALPPQAPSS-----------------------PDHL
R4LD52          ------------------------PELADAPVS-----------------------PRPV
A0A4T2CD79      ------------------------AVAPTQPIF-----------------------PNVR
A0A6L6AM03      ------------------------AQLPGAPFT-----------------------PDYR
A0A4Q2RU39      ------------------------AQLPGAPFT-----------------------PDYE
A0A4Q2SK58      ------------------------AQLPGAPFT-----------------------PNYE
A0A2N3YJR1      ------------------------SALPGTKIA-----------------------PDPR
A0A6G8FYB9      ------------------------SALPGGKIA-----------------------PNPK
A0A4Q4D742      ------------------------PSFRSSPVA-----------------------PNVP
A0A1C6T1J1      ------------------------PRVSASPVS-----------------------PQPL
A0A2W2CFC8      ------------------------PGVTPSPVS-----------------------PQPV
A0A2W2A4B0      ------------------------AARPTTPVA-----------------------PRTR
A0A4Y9MDA5      ------------------------ASVPSAPVS-----------------------PRTS
A0A1H7N9P7      ------------------------AGVPGAPVS-----------------------PRTS
A0A1M7V0F8      ------------------------ADVPTAPVS-----------------------PRTS
A0A1M3LEY6      --------------------------MPQEPIS-----------------------PNTR
A0A538AJI7      ------------------------AVKPTTPAA-----------------------PPRR
A0A538AM15      ------------------------LTLQQSPA----------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------AYVGTSPVI---------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------HRKVGREQE---------------------------
A0A419GS64      ------------------------SRGSKYLYT---------------------------
A0A4R1CW45      ------------------------DAVASNNVV---------------------------
A0A4R5Z7B0      -------------------------DPARKLIA---------------------------
A0A542H054      ------------------------MSTRRKLVA---------------------------
A0A6M8GFV5      -------------------------TLKRFLIT---------------------------
A0A7G8U6J2      -------------------------EKQVNLIA---------------------------
A0A2S8MDM2      ------------------------ERRKQPAIS---------------------------
A0A357ZDL3      --------------------------MSKKNNK---------------------------
A0A1I6GVG4      ------------------------FDGGTSRSS---------------------------
A0A1I6IST1      ------------------------FDGGTSRSS---------------------------
A0A412JBM5      ------------------------Y-DSPFA-----------------------------
A0A6J4SUA1      --------------------------EEASQ-----------------------------
A0A1C2B334      ------------------------FGAGGSV-----------------------------
R7Y679          ------------------------FRAGGSS-----------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------V-----------------------------------
A0A7K0LE65      ------------------------TGLPVLGRI---------------------------
A0A838JYQ6      ------------------------L-----------------------------------
A0A510HHA8      ------------------------H-----------------------------------
A0A6G8Q9J3      ------------------------T-----------------------------------
A0A538BBM6      ------------------------R-----------------------------------
A0A5Q2F9A3      ------------------------D-----------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------E-----------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------L-----------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------V-----------------------------------
A0A7V8X3I0      ------------------------G-----------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------D-----------------------------------
A0A6G8QDQ0      ------------------------A-----------------------------------
A0A023X491      ------------------------S-----------------------------------
A0A4R1BMZ2      ------------------------L-----------------------------------
A0A838JNW7      ------------------------L-----------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      ------------------------------------KRP----SQFQNPL----------
A0A538BYZ4      PGPT--------------------------------PAT----GAVDGADEHLVSLLTPT
A0A348NU28      RDAL----LGAVVGLLLGVLAALLWTLLDTRV----PNE----TVLSQVV--PAPVLGSI
A0A2N4T4Q5      ---------------------------MDRRI----RSV----EEVRETF--GTPVLGII
A0A4Q5APW3      LNIL----VGIVGGLILGVFAALLKDALSKRI----QND----DEISEYI--DAPIIGRI
A0A4Q5B0V3      LNIL----VGIVGGLILGVFAALLKDVLSKRI----QND----DEISEYI--DAPIIGRI
A0A022KX11      RNLA----LGLLAGLVLGLGLAFIRHALDTKV----RGE----EDIRAHS--DAPMLAGL
A0A4Q5A868      LNIL----VGIVGGLILGVFAALLKDVLSKRI----QDD----DEISEYI--DAPIIGRI
A0A6N4VXX3      RNLA----LGLVAGVLLGIALAFGLDVVDSTV----KKR----EDLESIT--GASVVGEI
A0A1H4I042      RNLA----LGLFAGILFGVACALGREMIDNTV----KKH----EDLESIT--GVAVVGDI
A0A4R7A6D9      RNLA----LGLFAGVLLGVACALGREVIDNTV----KKH----EDLESIT--GVAVVGDI
A0A345NSU7      RNLA----LGALAGLLLGVAFALARQALDQRV----RGT----ADVEAIS--DRPVLSTI
A0A222TG79      KNTL----IGVAVGLLFGLLAVMFASRLTNRI----QTP----ADVVEVT--ESPVLAVV
A0A0W8I9Y2      ----------------MGLLYAFARFKMDRRI----KSV----EEIRDGF--GVAVLGVI
A0A7C6LSF9      ------------------FGIALVLHQVDSRL----RTR----DEVYEAL--RMPVVAEI
A0A255G8R8      QNLA----LGLLLGLALGFAAALVRERLDTRV----RNE----ADVAAVT--TASQVGSI
A0A6G7Y423      ------------MGAAVGVGQALARHALDTRI----RTA----RDLQQTT--TLPLLASI
A0A4Q4D4T1      RTYV----LFGLAGLLLGLLLAALRNLATATV----TSS----DALTEQV--KAPVIGAV
A0A1Q2CRV2      QNLA----IGGLVGLLLGAGQALLRDVLNTVV----RSR----RDIEQVS--DQAILGAI
A0A261FE22      GNMM----MGAFAALIIAAAGAVIREMSDNSI----HTK----AEIQSIV--PAPILAAV
A0A7K0NRJ7      RSAV----VAFLLTCILVGELIVASRAIGDRIGRTGDDD----ADVARIT--GLPVLGRI
K6WHS4          RTVL----IALTLGICMGIGIVVLVERADTRI----RSE----DSVLEVT--ELPILGDL
A0A7K0NTR2      TGLL----YGAAFGFIIGLGILLLLEILSARI----RDV----PGTEGAA--RMPVIAEI
A0A1H6WL79      ATIG----IGLAGGLLVGLGYALARNHFDRRI----RAA----SEIERLF--GLAVVGTL
A0A101LAM5      ATLG----IGLAAGLLIGLGYALARNHLDRRI----RGA----SEIERLF--GLAVVGTL
A0A4Y3NEG0      ATLG----IGLAAGLLIGLGYAIARNHFDRRI----RGA----SEIERLF--GLAVVGTL
A0A1Q2CI19      FRTL----LAAVLGLLFGIALALVLERLDSRL----RTR----EEIAEAL--DMPIVGVV
A0A512T3M3      QRTG----LAAGLGLLLGLAIALVLNRLDSRM----RSR----EEIQEAL--GLPIIAEV
W6JTW4          TRTA----LAALIGLLFGMALAVFVDRIDSRL----RSR----TEIQAAL--GLPIIAEV
A0A839J1M0      IRTA----LAALVGLLVGLAIALVLDRLDSRL----RTR----AEVSDAL--RMPVIAEV
A0A8A4Z8K4      IRTA----LAALVGLLVGLAIALVLDRLDSRL----RTR----AEVSDAL--RMPVIAEV
A0A0A0JTY0      PRTA----IATLLGVLVGLGLALLLDRLDSRL----RTR----SEIHNAL--QMPIIAEV
A0A0A0JXF2      PRTA----IATLLGLLVGMGLALLLDRLDSRL----RSR----SEIGDAL--SMPIIAEV
E6S8H2          TRTA----LAAGLGLLLGLGLALVLDRVDSRL----RTR----SEIAAAL--RLPIIAEV
A0A0A0JGH0      LRAA----LAALVGLLLGFALALVLQRVDSRL----RTR----DEVHAGL--RLPIIAEV
N0E4U7          LRTA----MAAFIGLLLGFALALVIQRVDSRL----RTR----DEVHAAL--RLPIIAEV
A0A0A0IYK2      PRTA----IATVLGLLAGLALALLLDRLDSRL----RTR----QEIHGAL--RMPIIAEI
A0A0Q9L0H3      PRTA----IATLLGLLVGLGLALLLDRLDSRL----RTR----GEIASAL--RMPIIAEI
A3TMK0          PRTA----MATLLGLLVGLGAALVMDRLDSRL----RTR----ADIHSAL--RMPIIAEV
A0A543PXP1      FRTA----LAAMLGLLAGLALALVLDRLDSRL----RTR----EEIAAAL--RLPIIAEV
A3TMH6          VRAA----LSAVLGLLLGLALALVLDRLDSRL----RTR----EEIAAAL--ALPIVAEV
A0A6I2XCV4      VRIL----IGGLVGLILGIATAFVLEVWDDRI----RRR----DGLEAVT--GLPVIVEV
A0A5R8VLL6      LTAL----YGAAVGLLLAYASALLRDRLDRRL----RTA----AEVENLF--SVPVVGTL
A0A3L7ADK2      IALV----LATITGTLLAIAYAVIRQHLDRRI----RSA----DVLEQRY--GTSVLGTI
A0A538JQF8      IRAV----IGLLIGLLVGAGVSFAIDFFDPRL----RTR----AKVEDLL--GLPVVAEI
A0A1H6YPK1      QNTA----VGLMLGLALGVAYAFVRATLDRRL----RSR----NDVEIQF--GVPVVGTV
A0A0Q9TBP0      LNLI----LGALVGLVLGVGAALLRDRLDDVV----HDE----EAVRQAL--DAVVLARV
A0A0G3V3M7      QRLL----FGAAIGFIVGLGILLLLEILSARI----RDV----PGTEGAA--RMPVIAEI
A0A6I3DD56      QRLL----FGAAIGFIIGLGILLLLEILSARI----RDV----PGTEGAA--RMPVIAEI
A0A5Q2FA83      QNIA----LGVLAGLALGIGLALLRHFLDTRV----RSE----LDLRAVS--DRPILGAL
A0A2R7MGI0      IDVA----VGGIAGGVLGVVFALVRRTFDRRV----RTV----QDITDTV--DASVVGVL
A0A2T7WQY4      VDVA----VGAIAGGVLGVVFALVRRTFDRRV----RTV----EDITAAV--GASVVGVL
A0A0Q5Q5L3      LDVM----IGALLGLVAGVVFALVRRTFDRRL----RSA----SDITDAV--DASVVGVL
A0A0Q6DVM4      LDVM----IGALLGLVAGVVFALVRRTFDRRL----RSA----SDITDAV--DASVVGVL
A0A1N7DLV3      LAIA----VGALAGAVAGVLFALVRRAFDRRV----RSA----HDISDSV--DVSVVGIL
A0A1V2NSB5      LAIA----VGALGGAVVGVLFALVRRTFDRRV----RST----QDISDSV--DVSVVGIL
A0A1R3WWR6      LDIA----IGALVGAMAGTVFALVRRAFDRRI----RSA----ADITDTI--AASVVGIL
A0A1G6GTN3      LDVT----LGALAGGVAGIIFALVRRAFDRRV----RST----HDITDAV--DASVVGVL
A0A7W5GFA5      LAVT----LGALAGGVAGLVFALVRRAFDRRV----RSA----RDITDAV--DASVVGVL
A0A2S5WZJ5      TNLL----LGAGIGIVLAYVFVFLRKALDVKV----RTS----KDLATAT--RSGSLGRI
A0A0Q5JKD6      LDVT----LGALAGGVAGLIFAFVRRAFDRRV----RSA----HDITDAV--DASVVGVL
A0A2W6DK08      ARTV----VGLVLGVVLGCALALALEHFDTRP----RDR----AAAGRAY--RLPVLAEI
A0A346XTB0      LTAL----SFAFLGGVASAMWAYWYAFKSQRV----TSR----TDPEIVL--GVPPLGEI
A0A542FTE6      SALV----VGGVVGLVAAGIFMLVRNTLDRRV----RSV----ETVEKTA--GVAVIGTL
A0A7Y9QM02      SALV----VGGVVGLVAAGIFMLVRNTLDRRV----RSV----ETVEKTA--GVPVIGTL
A0A6I1G2U1      FRTT----MAALLGLLIGFGLALVLHQVDSRL----RTR----DEVYQAL--RMPVIAEI
A0A351ETF8      RNLV----VAAAFGMALGIALTYLREVINDKI----EGA----RSVEQAT--GLAILGTI
A0A349B7N2      RRGM----LGGGLGLVLSVGAVVLFDRFDDRL----RTK----EDAEEAF--GLPVVAEI
A0A4Q2JUT1      TALI----VGGVLGLGFGIAFAMIRTAADRRI----RNA----EDTESKT--GVAVVGTI
A0A6L5R0V7      TALI----VGGVLGLGFGVAFAMIRTAADRRI----RSA----EDTESKT--GVAVVGTI
A0A2S0LQ32      KLAG----MGGAGGLALGLAVAFLRRALDNKI----RHN----SDIEDIL--QSSVLAVV
A0A7T8DZN6      KLAG----MGGAGGLALGLAVAFLRRALDNKI----RHN----SDIEDIL--QSSVLAVV
A0A2N6V1R5      KLSG----MGALAGLVIGYLVVFMRRLMDNRV----RHN----SDVEELL--GSSVLAVV
G9PHS6          KLSG----MGALAGLVIGYLVVFMRRLMDNRV----RHN----SDVEELL--GSSVLAVV
U1PLM7          KLSG----MGALAGLVIGYLVVFMRRLMDNRV----RHN----SDVEELL--GSSVLAVV
A0A4V1VGV9      RNLM----AGAAIGLLAGIVLVVLRKQLDSRI----RHT----SEVEKLT--GSGVLGVI
A0A2S5UYV0      NNLL----IGAGLGLVLAYVFVFLRKALDVKV----RNS----KDLASAA--GVGSLGRI
A0A7W4UQ09      NNLI----IGGGIGLILAYAFVFLRKALDVKV----RSS----KDLAAAA--RVGALGRI
A0A2S5X9U6      NNLI----IGGAIGLLLAYAFALLRRSLDVKV----RDS----KDLAAAS--GAGTLGRI
A0A2S5ULV5      NNLI----IGGAIGLVLAYAFALLRRSLDVKV----RDS----KDLATAS--GAGTLGRI
A0A653YMF0      NNLI----IGGAIGLVLAYAFALLRRSLDVKV----RDS----KDLATAS--GAGTLGRI
A0A7V9H755      RRLA----LGVLIGTILGIAATMVLESMNDSI----RRR----SDIEKIL--KVPGLAVI
A0A3Q9IY80      IALA----LGALAGLVLGIAYAVLRYTLDRRI----RSA----DAVEKET--GLSVVGTI
A0A0F0LP73      AMII----AGALIGLGVGLLLVLLRRALDVRV----RAH----TDVAAIV--GAGVLGRV
A0A346Y185      RNAV----LACFLGALAAAALAWWRADETATA----DGR----NDPSRML--KAPLLGTV
A0A7W0HGW1      RDGV----VATALGLFVGLALALARSRFDDRI----REA----SEIEDTVASGVAAVSIP
A0A259S8H9      LIAG----IGGGAGLVLGLIALLLRRAMDVRV----RAH----TDVAALV--GAGVLGRV
A0A2W1Z497      AAVT----LGVLVGLLLASVYVLVRQALDRRI----RSA----AAIEAAF--GVPVLGTI
A0A0Q5L115      VALL----LGGLSGLMLAGVYLLVRNTLDRRI----RSA----AEVESRF--GVGVIGTI
A0A7G6YY64      VALL----LGGLSGLMLAGVYLLVRNTLDRRI----RSA----AEVESRF--GVGVIGTI
A0A7J5B4S5      NNLL----IGAGIGLVLAYVFVFLRKALDVKV----RNS----KDLASAA--GVGSLGRI
A0A852U976      NNLL----IGAGIGLILAYVFVFLRKALDVKV----RNS----KDLASAA--GVGSLGRI
A0A1F1X071      KFLL----AGAAFGLLVALGLAWLRDRNDSRL----RTA----DDVTDVV--GLPTLGAL
A0A3R8RWC7      KFLL----AGAAFGLLVALGLAWLRDRNDSRL----RTA----DDVTDVV--GLPTLGAL
A0A4U0RJZ4      VNLL----IGAFLGLVAGTILVVLRKQLDSRI----RHT----SDLEKVT--GVGTLGVI
A0A4R1FGL9      VNLL----IGAFLGLVAGTVLVVLRKQLDSRI----RHT----SDLEKVT--GVGTLGVI
E3B8H1          VNLL----IGAFLGLVAGTVLVVLRKQLDSRI----RHT----SDLEKVT--GVGTLGVI
A0A7D7WDT9      LAVI----AGAAAGLVLAYLVLFLRRALDVRV----RAD----TDTRELM--GAGVLARV
A0A0Q5AWK6      RNLL----LGAAGGLVLGFVVAFLRRALDIRV----RTV----DQLTELF--GVGVLGRI
A0A6P1F176      RNLL----LGAAGGLVLGFAVAILRRALDIRV----RTV----DDLTALF--GVGVLGRI
A0A3N1NLD3      RNLL----LGAAGGLVLGFVLAILRRALDIRV----RTV----DDLTQLF--GVGVLGRI
A0A3N2FVI8      RNLL----LGAAGGLVLGFVLAILRRALDIRV----RTV----DDLTQLF--GVGVLGRI
A0A2S5XDQ6      RNIL----LGALGGLVLGFGLAFLRRALDIRV----RTV----DDLTELF--GVGVLGRI
A0A2S5XNN6      RNIL----LGALGGLVLGFGLAFLRRALDIRV----RTV----DDLTELF--GVGVLGRI
A0A5C8C085      RNLA----IGFGAGLLLGFAYALVRSQLDRRL----RTA----SAVEKKF--GLSVVGSI
A0A4Y5YMQ6      QDAV----LGVVLGAFGALFALSAWALLDRRV----RSV----AALEGVT--DLPVLGLV
A0A1E4BP96      LNLA----LGGLVGLALGIAYAVMRSVLDSRI----REP----QDVERNT--GASVVGVL
A0A7V9FXS6      LIEA----AALLIGGIFGVALSLLLEKGQPRV----RSW----RDVANLT--GQPILGRV
A0A7W0PY69      LLQA----ASLIVAVLVGIAVSLLLERGRPRL----RSW----RDIARAT--GYPILGRI
A0A7W8YB99      RALM----IGAAAGLFLGLVWAAIKHLLDRRV----RSV-----EAIQKV--GLSAIGTL
A0A1L2ZMQ6      QAVL----IGAVVGLVLGLIWAAIKHLLDRRV----RSV-----EAIQKV--GMSAVGTL
A0A7W8TR75      QAVL----MGAVVGLVLGLIWAAIKHLLDRRV----RSV-----EAIQKV--GMSAVGTL
A0A151BT98      KALE----LALAVGLLLGVAMALLRHFMDNRV----RTV----EDLETLV--QRPVLSIV
A0A2Y8ZRF8      RTLE----LAFAVGLLLGVAMALLRHFMDNRV----RTV----EDLEALV--QRPVLSIV
A0A2R9UAT1      LALA----IGGVAGLVVGLMIALLRFTLDRRI----RSA----ELVERET--GVAVVGTV
A0A3E2DN22      LYVV----AGLAAGFLIGAVVAVVRKQFDVKV----RDQ----ATIEELT--GSGILSVI
A0A3Q9ULZ9      LYLA----LGLVAGLVVGSVIAVIRRMFDVKI----RSQ----NDVEELT--GRGVLAII
A0A3S9JFL2      LYLA----LGLLAGLVLGGVISVIKRMFDVKI----RSQ----KDVEDLT--GHGVMAVI
A0A3L8NYD3      INLL----AGGIAGIVAGYLLALVRRQLDSRI----RTV----DDMESLV--GTSVLTIL
A0A1M6K628      RNLA----LGLALGLLCGFGAVVLRRSLDRRV----RQA----DEVEELT--SATALGVV
A0A561E8R3      KATA----EGLLAGLVAGYLWAAFRRQLDSRV----RHQ----DDVERHL--EAPVVGVI
A0A4Q5J5D7      LNLL----IGGVVGVLLGLAYALLRNQLDRRL----RSS----QAVERQF--GVTVVGAI
A0A1Y4CKD6      PSQSRIWGFGVMGGICTAALVVGLIALFNNTI----KTA----EDLESVS--SMVCLGAL
A0A0Q7KBQ4      LNIA----VGLLLSLFVAIAGAVLRDLLDRTV----KTR----QEAEELS--GGAVLATL
A0A5Q5BFU2      RNIV----FGLGLGLLLGVGLAVLRDTLDNTV----KDR----QALEDVT--GAGVVGNI
A0A439DNZ6      RNIA----LGLALGLALGIGLAILRDLLDNTV----KDR----QNLEEIT--GVGVVGSI
A0A7I7UD03      RNIG----IGLVLGLAFGVALAVVRDLLDNTV----KDR----ETLESIT--GTGLVGSI
A0A7I7MI62      RNIG----MGLVLGVVLGVGLALIRDLLDNTV----KSR----ETLEQLT--GAGIVGSI
A0A0J6YE86      RNIA----VGLVLGLVLGVGFALIRDLLDNTV----KDR----TTLEQIA--NVGLVGTV
A0A7I7K1R9      RNIA----VGLALGIVFGIGLAVFRDLMDNTV----KDS----GTLEEIT--GTGVVGSI
A0A7I9ZLK4      RNLA----TGLLLGLLLGIGLAVLRDLLDNTV----KDR----EALEEIT--GAGIVGSI
A0A1F1IHY9      LALS----IGGALGLLAGLGVAVVRHVLDNKI----RSA----AALESRF--GLTILGTV
A0A7H2BCD6      RNVL----LGALVGFVAVYALVFARRAIDTKV----RTR----EDAIKST--ELGVLGML
A0A3S0V9U6      KYVL----FGAAAGLIIVYLVVFIRRFMDVRV----RTT----KDMEEST--GLGVLGVL
A0A7T4T4U7      NYLL----IGAAVGLVLAYLIAFLRKFADVRV----RTT----DDLENAT--EAGTLGIL
A0A1S2N0P2      NYLL----IGAAVGLVLAYLIAFLRKFADVRV----RTT----DDLENAT--EAGTLGIL
A0A0Q3BEY5      NYLL----IGAAVGLVLAYLIAFLRKFADVRV----RTT----DDLENAT--EAGTLGIL
A0A4R6Q3C6      NYLL----IGAAVGLVLAYLIAFLRKFADVRV----RTT----DDLENAT--EAGTLGIL
A0A7T3CHP7      NYLL----IGAAVGLVLAYLIAFLRKFADVRV----RTT----DDLENAT--EAGTLGIL
A0A7Y5U6C1      RNAF----IGLGLGIILGIVLAFVVEALDTRI----RST----DAILRQL--NLPLLARI
A0A542HCT5      RNLA----LGFVLGLILGMGYALLRSQLDRRV----REP----EVIERDF--GVTVAGAI
A0A537WNY9      LTLI----VASLIAVLLGVAAALVRENLGTRI----ETA----EDLARIA--GVPSYGEV
A0A5B8M469      LVLP----IGALAGLVLGYIVILLRRALDVRV----RAG----TDMIELL--GTGVLGRV
A0A2S8WHZ8      LSLA----LGGVIGLALGLGYALTRNHLDRRI----RSV-----EAIERL--GVSVVGTI
A0A1Y4CTD2      SPLIAYRYLGAAIAALGAVALIALIYLLRNTV----KTA----EQASDLL--DGRVLGTV
A0A3N3ZPU0      LNLL----VGVGVGLLLAALYVLARSLFDRKV----RSS----EAVANAT--GLAILGTI
A0A359IQX7      ANLP----IGAIAGLVIGYGIAFIRRSIDGRV----RTQ----AEVEELT--GAGVIGVI
A0A7W9IKV0      VNLL----MGVLIALLSAMAAIVVRDRLDTTV----KSS----ETLHHAS--GSSTLGII
A0A1N7E3F1      TNMA----LGVLIALFAAVTGLVLRDRLDTTI----KTA----ETLRQVA--KSSVLGLI
A0A544ZKQ1      TNMA----LGALIALLAAVTVLVLRDRLDTTV----KTA----EALQQVA--RSSILGVI
A0A5D0Q2X0      TNMA----LGALIALFAAVSGLVLRDRLDTTV----KTA----ETLQKVA--RSSILGVI
A0A5R8Z2E7      TNMA----LGALIALFAAVSGLVLRDRLDTTV----KTA----ETLQKVA--RSSILGVI
A0A0Q9LZR0      RNLA----LGFVLGLMLGLGYALLRSQLDRRV----REP----EVVERDF--GVTVAGAI
A0A1F1J417      QNGL----IGAGAGLVLVYLAIFLRRSVDQRI----RTR----DDAIKAT--NSNILGVL
A0A2A8D6P2      QNGL----IGAGAGLVLVYLAIFLRRSVDQRI----RTR----DDAIKAT--NSNILGVL
A0A1F0THV9      QNGL----IGAGAGLVLVYLAIFLRRSVDQRI----RTR----DDAIKAT--NSNILGVL
A0A5F0M6Y0      QNGL----IGAGAGLVLVYLAIFLRRSVDQRI----RTR----DDAIKAT--NSNILGVL
E3H5W1          QNGL----IGAGAGLVLVYLAIFLRRSVDQRI----RTR----DDAIKAT--NSNILGVL
A0A1F1QKB0      QNGL----IGAGAGLVLVYLAIFLRRSVDQRI----RTR----DDAIKAT--NSNILGVL
A0A509JY23      QNGL----IGAGAGLVLVYLAIFLRRSVDQRI----RTR----DDAIKAT--NSNILGVL
A0A448USF4      QNGL----IGAGAGLVLVYLAIFLRRSVDQRI----RTR----DDAIKAT--NSNILGVL
A0A7Z9A2N0      RNTL----IGAVAGLVLVYVVIFLRRSVDQRI----RTR----DDAVKAT--GSSILGVL
A0A433EDP2      RNTL----IGAVAGLVLVYVVIFLRRSVDQRI----RTR----DDAVKAT--GSSILGVL
A0A231VTW0      RNTL----IGAVAGLVLVYVVIFLRRSVDQRI----RTR----DDAVKAT--GSSILGVL
A0A433ECD0      RNTL----IGAVAGLVLVYVVIFLRRSVDQRI----RTR----DDAVKAT--GSSILGVL
A0A7T9UPU8      RNTL----IGAVAGLVLVYVVIFLRRSVDQRI----RTR----DDAVKAT--GSSILGVL
U7V3Z1          RNTL----IGAVAGLVLVYVVIFLRRSVDQRI----RTR----DDAVKAT--GSSILGVL
A0A6I3F378      ATTG----LGLAIGALLGVALALIRQRLATTV----DRP---EDLVTLGI--AAPLLTVV
A0A838H0S5      RAAL----VAMVLGLMAASAWAWWRAEHTQSA----DDR----QDAAPVL--GAPLLGEV
A0A1S1CQC5      QNTL----IGAVIGLVVVYTAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1E9T6I0      QNTL----IGAVIGLVVVYTAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1F1GHA7      QNTL----IGAVIGLVVVYTAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1S1CAD0      QNTL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
G5ET14          QNTL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1E9DXX2      QNVL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1E8S156      QNVL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASVLGVL
A0A1E8S5S2      QNVL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASVLGVL
A0A1S1DFA8      QNVL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASVLGVL
A0A2I1Z490      QNVL----VGAATGLALVYLAIFLRRALDQRI----RTR----DDATKAT--GASVLGVL
A0A1F0DAA9      QNVL----VGAAAGLALVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1F0PHK9      QNVL----VGAAAGLALVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1F0VZG6      QNVL----VGAAAGLALVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1E9G8X4      QNTL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1E9IAW2      QNTL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1E9ZBC9      QNTL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1E9ZDP4      QNTL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1F0R6B5      QNTL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1F0Z7N5      QNTL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1F1D897      QNTL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
D2NP38          QNTL----IGAGTGLVLVYAAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1F1FV74      QNVL----IGAVAGLGLVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1E9M791      QNVL----IGAVAGLGLVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A291DEI8      QNVL----IGAVAGLGLVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1S1D5T1      QNVL----VGAATGLALVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1E8TRD6      QNVL----VGAAAGLALVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1F0XT88      QNVL----VGAAAGLALVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1F1EVP5      QNVL----VGAAAGLALVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
C6R548          QNVL----VGAVAGLALVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A0K2RXS2      QNVL----IGAVAGLGLVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A1F0KX60      QNVL----IGAVAGLGLVYLAIFLRRALDQRI----RTR----DDATKAT--GASILGVL
A0A542I3V2      LALL----FGAIGGLLLAYAAALLRHHLDRRL----RSS----SEIERLF--DVPVIGTL
A0A2T0UZ65      KYVL----AGAVAGAALAYAWIFIRRLSDTRI----RTS----KDVEDLT--GSSSLGVI
A0A0Q5M6Z7      TALV----LAILAGIALAVVYGLLRQHFDRRI----RSV----EQIERLL--GAPVIGTI
A0A7G6YA19      TALV----LALLAGCALALVYALLRQYFDRRI----RSV----DQIERLL--DAPVIGTV
A0A853CXS3      TALV----LAVLAGCALALVYALLRQQFDRRI----RSV----EQIERLL--DAPVIGTV
A0A7W8YB56      KNLM----NGAIAGLILAALYIFIKHLFDVRI----RST----EQVEEVT--GHAVLGTI
A0A1L2ZMV4      TNLM----YGAIAGLILAALFVFIKHLFDVRI----RST----EQVETTT--GHPVLGTV
A0A7W8TSW5      TNLM----YGAVAGLILAALFVFIKHLFDVRI----RST----EQVETTT--GHPVLGTV
A0A1R4JTI6      MALA----LGALVGLVVGLGVAALRSLNDRRI----RGV----KVLEETF--GLTVLGTI
A0A4R7TM52      IAVV----IGAVIGLAAGIGAAAIRYVVDRRI----RSA----DIVERET--GHAVVGTI
A0A542XE74      RNLI----LGGLAGAILGGLIAFGRRALDARI----RSQ----EQVELLT--GKAVLGVV
A0A0Q7QDF6      RTYV----LFGLAGLLLGLLLAALRNLATATV----TSS----DALTEQV--KAPVIGAV
A0A7X7XPM3      RNAL----VGVLAGLGLGVGVVLLRHFLDSKV----RTD----ADLRAVS--PRPILAHL
A0A5R8L819      LFAA----LGVVAGLALGIIYAVARHTLDRRV----RSA----ETVEKET--GRAVVGIL
A0A7K0PFV4      LVVL----GAMVAGGLLAVIGTIVLQRTDHRV----ASR----AALLENI--PAPVLAGV
A0A0G3V3F3      RSAV----VAFLLTCILVGELIVASRAIGDRI----GRTGDDDADVARIT--GLPVLGRI
A0A7K0MUQ7      RSAV----VAFLLTCILVGELIVASRAIGDRI----GRTGDDDADVARIT--GLPVLGRI
A0A7K0U619      RSAV----VAFLLTCILVGELIVASRAIGDRI----GRTGDDDADVARIT--GLPVLGRI
A0A6I3DFP2      RSAV----VAFLLTCILVGELIVASRAIGDRI----GRTGDDDADVARIT--GLPVLGRI
A0A7K0SI36      RSAV----VAFLLTCILVGELIVASRAIGDRI----GRTGDDDADVARIT--GLPVLGRI
A0A7K0V140      RSAV----VAFLLTCILVGELIVASRAIGDRI----GRTGDDDADVARIT--GLPVLGRI
A0A261FQA1      RLIF----MGTLAGLVLALVVIVVIDVSDKRV----RDT----ADIQRIL--YSPVISSV
A0A1Q2CJ92      RNLA----LGAALGLLLGLGIVVGRQSFDRRI----RRA----HEAEEVA--ETSSLGIV
A0A2T0S3C8      RNLA----LAALLGLLAGGVAAVLRETLDTTV----KTA----DALHELA--GAPVLAGV
A0A810MDE3      RNLA----LAALLGLLAGGVAAVLRETLDTTV----KTA----DALHELA--GAPVLAGV
A0A4Y8WZJ3      LALS----IGGALGLLAGLGVAVVRHVLDNKI----RSA----AALESRF--GLTILGTV
A0A7X0KT97      TALI----VGGVLGLGFGITFALIRTVSDRRI----RST----ADVETHT--QIPVVGTI
A0A853DGU7      KHVE----AGFAAGVVLGYLLAVLRLMLDQRL----RTV----QDVETIT--GAGTLGIL
A0A7Z0A2Z7      KLVA----IGFAGGLLIGVVIALLRELLDVTV----RSA----DTATALV--GAPVIGTI
A0A285VUW0      RNLA----IATLAGLMLGLAYALGMQALDTRL----RST----ADVEALT--GRPVLSTV
A0A849PJI9      LYLT----LGGILGALAAFAYVLVRRKLDRRV----NHV----AEIEKIV--HASVLGVI
A0A2R7Z032      NGAI----KGAGGGLVLAYVILIARRLIDRRI----RSV----KDVETAT--GSAVIGII
A0A6J4MTQ2      LAAL----QGAAGGLALAYALILLRRAVDRKI----RSV----NDVEDAT--GGSVIGII
A0A1I0W453      SAAM----KGALGGLGLAYAFLIGRRLIDRRI----RTT----KHVEEAT--GASVLGII
A0A0Q6VV12      KAAM----KGAAGGLALAYAFLIARRLIDRRI----RSV----KHVEDAT--GAAVLGII
A0A495NTA9      KAAM----KGAAGGLGLAYAFLIARRLIDRRV----RSV----KHVEDAT--GASVLGII
A0A1H4LCS9      KAAM----YGAAGGLGLCYAFLVGRRLIDRRI----RSA----KHVEEAT--GASVLGII
A0A4Q2RZP8      KGAM----QGAAAGLGLCYAVLVGRRLIDRRI----RSA----KHVEEAT--GSSVLGII
A0A0Q9QB08      AAAI----KGALGGLALAYAFLIARRLIDRRV----RSA----KHVEDAT--GAAVLGVI
A0A7Y9H290      SAAM----KGAIGGLGLAYAVLVARRLIDRRI----RSA----KAVEEAT--GAAVLGII
A0A4Q2SA86      SAAL----KGALGGLALAYAVLIGRRLIDRRI----RSA----KHVEEAT--GAAVLGII
A0A4Z1C3Z0      SAAL----KGALGGLALAYAVLIARRLLDRRI----RSA----AHVEEAT--GAAVLGVI
A0A6V8KDX4      RNLG----LATLLGLLLGAGAAVLREKLDSTV----KSA----EELRDAT--DAPTLAVV
A0A444BL03      RNVL----IGIGLGLLVAYLLVFVRRQLDTRL----RSA----QDVEAAT--GASVLGVV
A0A7V9PCQ0      PILI----GAFVLGAFLALLATVGAARVRQAL----DLA----EEVRKRF--DAPVLGQI
A0A4Y8X357      RNAL----IGGSIGLLAALAAAFLRRLLDVNV----RTT----TDATQAS--GAGLLGAI
R4LD52          RNLV----LAALLGLLTGAAGAVLREVLDTTV----KTV----EGLQALA--AAPVLAAV
A0A4T2CD79      LSVI----IGALIGLVLAIVYAMVRNVLDRRI----RTA----ATIQQQF--KLAVIGVL
A0A6L6AM03      NAAM----KGAIGGLALAYAFLVGRRLIDRRI----RSA----KHVEDAT--GASVLGII
A0A4Q2RU39      RAAM----KGAIGGLGLAYAFLIARRLIDRRV----RSA----KHVEEAT--GAAVLGVI
A0A4Q2SK58      RAAM----KGAIGGLGIAYAFLIARRLIDRRV----RSA----KHVEEAT--GASVLGII
A0A2N3YJR1      RNTL----VGLVGGLFLAYALIFVRRQLDTRV----RSA----EDVEKET--GASVLGVV
A0A6G8FYB9      RSGL----IGLVVGLGVAYALVFVRRQLDTRL----RTV----GDVEELT--AASVLGVV
A0A4Q4D742      LNLA----AGLLLSLFLAIAGALVRDLLDRTV----KSR----RDVETIT--SSAVLATL
A0A1C6T1J1      RNFT----IGGLLGLVAGVALAVLRGMADVRL----RDA----AGLQRVT--GSPLLGEI
A0A2W2CFC8      RNVL----IGTLIGLLAGVGLAILRGIADLRV----RDG----ASLRRVT--DSPLLGEI
A0A2W2A4B0      ANAA----LGGAAGAGLGVLAAFLRWALDTKV----RGR----DEVQELW--DLPVLGDI
A0A4Y9MDA5      LNLA----VGQLAGLLAGCVAALLRDRLDNRV----RDT----GVVAELT--SLPVVGSI
A0A1H7N9P7      LNLA----VGVLAGLLLGCGLALARDRLDTRV----RDA----AVVAQLT--GLPVVGSI
A0A1M7V0F8      LNLA----VGVLAGLLAGCAAALVRDLLDNRV----RDA----GVVAELT--GVPVVGAI
A0A1M3LEY6      LYLS----LGLLIGLIVGLAVAILIEVLDTRI----RGE----ANVRQIT--DAPILGGI
A0A538AJI7      LLEL----ASLFIGSLLGIVASLLLERGRPRL----RSW----RDLARAS--GYPVVGRI
A0A538AM15      --------DSAVDDHLVSLVAPAAFE----------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      -------------------------------------------ISRPASR----------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      -------------------------------------------SPGSRSE----------
A0A419GS64      -------------------------------------------KDFPASV----------
A0A4R1CW45      -------------------------------------------GFDSRDK----------
A0A4R5Z7B0      -------------------------------------------NLDPKSP----------
A0A542H054      -------------------------------------------HDNPQSP----------
A0A6M8GFV5      -------------------------------------------LTNPKSP----------
A0A7G8U6J2      -------------------------------------------QTNPKSP----------
A0A2S8MDM2      -------------------------------------------FETDNAA----------
A0A357ZDL3      -------------------------------------------SFSNNHE----------
A0A1I6GVG4      -------------------------------------------ESAHLFG----------
A0A1I6IST1      -------------------------------------------ESAHLFG----------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ---------------------------------------------DVRSP----------
A0A7K0LE65      -------------------------------------------PKGEGFE----------
A0A838JYQ6      ---------------------------------------------DPSNV----------
A0A510HHA8      ---------------------------------------------DPSNP----------
A0A6G8Q9J3      ---------------------------------------------DPTGA----------
A0A538BBM6      ---------------------------------------------SPEEI----------
A0A5Q2F9A3      ---------------------------------------------AITSP----------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ---------------------------------------------EGAAG----------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ---------------------------------------------NPASF----------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ---------------------------------------------GSHST----------
A0A7V8X3I0      ---------------------------------------------SADVE----------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ---------------------------------------------GIQWA----------
A0A6G8QDQ0      ---------------------------------------------EPGGM----------
A0A023X491      ---------------------------------------------DPGGQ----------
A0A4R1BMZ2      ---------------------------------------------DPEGP----------
A0A838JNW7      ---------------------------------------------DTQSP----------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      -----------------------------------------------------------L
A0A538BYZ4      SF---------------------------------------------------------A
A0A348NU28      SR----------------VRGNGERGLYVAREPLGH-----------------------T
A0A2N4T4Q5      PE----------------DDRLADHREIIETGTSGGRGHHA------------------F
A0A4Q5APW3      PE----------------EELLNSTKPVIVSEPGSP-----------------------V
A0A4Q5B0V3      PE----------------EELLNSTKPVIVSEPGSP-----------------------V
A0A022KX11      PL----------------ESRGSKRGLISVEEDPHGR----------------------H
A0A4Q5A868      PE----------------EELLNSAKPVIVSEPGSP-----------------------V
A0A6N4VXX3      PV----------------DKPRRTAPVISFASDNSR-----------------------I
A0A1H4I042      PM----------------DKARRGTPAISFGTENSQ-----------------------I
A0A4R7A6D9      PM----------------DKARRGAPAISFGTENSQ-----------------------I
A0A345NSU7      PM----------------RKADDAHSIYLELDPFGP-----------------------Q
A0A222TG79      PR----------------FPSAADSPVSFGAGSSP------------------------A
A0A0W8I9Y2      PT----------------DDRLADHREIVETGFSAGRGHHE------------------F
A0A7C6LSF9      PK----------------LGRSARENARILVADEPHGV---------------------Y
A0A255G8R8      PY----------------VAGTPEHPLELGAHTDQ------------------------R
A0A6G7Y423      GR----------------RHPDPAQGGE-GAHWAT------------------------A
A0A4Q4D4T1      AQ----------------DRHVADHPLISTLSNQHP-----------------------R
A0A1Q2CRV2      PL------------------DESGDVLVLNSDPHGL-----------------------R
A0A261FE22      PK----------------SPTLAGRTPAVIVKPRGH-----------------------A
A0A7K0NRJ7      PK--------------------------------------GEGFE--------------T
K6WHS4          PD----------------DPAVDRNVVN----------FGVGGSP--------------A
A0A7K0NTR2      PV----------------MNLDKSLRFQ-------ITTAADPTSL--------------M
A0A1H6WL79      PL----------------DKRLSEKSSV--LESTSVVHRVPGGHA--------------M
A0A101LAM5      PL----------------DKRLSEKSSV--LESTTGMHRVPGGHA--------------M
A0A4Y3NEG0      PL----------------DKRLSEKSSV--LE-TTGTHRVPGGHA--------------M
A0A1Q2CI19      PK----------------ITAAQRRNKE-------ILTVTQPLSP--------------Y
A0A512T3M3      PK----------------LARGQRASAG-------TLVVTEPLSP--------------F
W6JTW4          PK----------------LPRAKRSDAY-------HMVLDQPLSP--------------F
A0A839J1M0      PR----------------LRRGDRGQGK-------ILTVSKPLSI--------------Y
A0A8A4Z8K4      PR----------------LRRGDRGQGK-------ILTVSKPLSI--------------Y
A0A0A0JTY0      PR----------------LKRAQRSRAS-------IAVATDPLSI--------------Y
A0A0A0JXF2      PR----------------LKRSQRNRNS-------IAVVEDPLNL--------------Y
E6S8H2          PK----------------MSRSLRRRRS-------IGVADEPLSP--------------Y
A0A0A0JGH0      PR----------------LKRSQKGERT-------ITVAVDPLSP--------------Y
N0E4U7          PR----------------LSQAQKRKAS-------IMVAADPLDP--------------Y
A0A0A0IYK2      PR----------------LRRSERHQGA-------IAVAEDPLSN--------------Y
A0A0Q9L0H3      PR----------------LKRSQRNSAS-------IAVASDPLSN--------------Y
A3TMK0          PR----------------LKRSQRNRAT-------LGVLEDPLSL--------------Y
A0A543PXP1      PR----------------LNRSQRSSPS-------IGVAEQPLSP--------------Y
A3TMH6          PR----------------LGRTKRRDKT-------IGVAEQPLSP--------------Y
A0A6I2XCV4      PV----------------FTRAERQELS-------VIALDAPRSR--------------T
A0A5R8VLL6      PV---------------DLRLTGENKVLGGLPAAPAPGSRPQSPA--------------F
A0A3L7ADK2      PM----------------NPFLRKGSQLLSQLTETSTESRHASFA--------------M
A0A538JQF8      PL----------------LSRRARRVPG-------ILAFNRPLSP--------------L
A0A1H6YPK1      PW----------------DGAIAKKGPL----------GAVPGFA--------------F
A0A0Q9TBP0      PQ---------------WSERSHRDRLV---------TLVDPHSP--------------A
A0A0G3V3M7      PV----------------MNLDRSLRFQ-------VTTAVDPTSL--------------M
A0A6I3DD56      PV----------------MNLDRTLRFQ-------VITAVDPTSL--------------M
A0A5Q2FA83      RL---------------LPKGTSPTVMS-----------SDPHGV--------------A
A0A2R7MGI0      PV----------------DKELANGRAV---FSFTDIRDGRGSFA--------------H
A0A2T7WQY4      PI----------------DKELANGRAV---FSFTDTHDGRGSFA--------------H
A0A0Q5Q5L3      PV----------------DKELAAGRAV---FSFDDIRDGRGSFA--------------H
A0A0Q6DVM4      PV----------------DKELAAGRAV---FSFDDIRDGRGSFA--------------H
A0A1N7DLV3      PV----------------DKELAAGRAV---FSFDDIRDGRGSFA--------------H
A0A1V2NSB5      PV----------------DKELAAGRAV---FSFDDIRDGRGSFA--------------H
A0A1R3WWR6      PV----------------DKELASGRAV---FSFDDIRDGRGSFA--------------H
A0A1G6GTN3      PV----------------DKELASGRAV---FSFDDIKDGRGSFA--------------H
A0A7W5GFA5      PV----------------DKELAGGRAV---FSFDDIKDGRGSFA--------------H
A0A2S5WZJ5      PK--S-------------PQLMGKNRGA-----------NDADAI--------------A
A0A0Q5JKD6      PV----------------DKELAGGRAV---FSFDDIKDGRGSFA--------------H
A0A2W6DK08      PQ----------------ARHSERRNFA-------VITASEPESS--------------A
A0A346XTB0      PL----------------YRMTSEDQLT---------GLLRVDPS--------------A
A0A542FTE6      IR--YEPFDAGRRLATAVSPLSGPARRS--------------HFA--------------I
A0A7Y9QM02      IR--YEPFDAGRRLATAVSPLSGPARRS--------------HFA--------------I
A0A6I1G2U1      PK----------------LSRSQREQRQ-------ILVADEPHGV--------------Y
A0A351ETF8      PG----------------YQLNSDQVVE---------VIERPKSL--------------A
A0A349B7N2      PL----------------LRRRQRRNSE-------VVSAERPRSR--------------I
A0A4Q2JUT1      PW--VAGFDSGERL----VDTSAANRTG-----------RTGTFA--------------V
A0A6L5R0V7      PW--VAGFDSGERL----VDTSAANRTG-----------RSGTFA--------------V
A0A2S0LQ32      PR--S-------------TDLSAKGRRN-----------VDGLGQ--------------A
A0A7T8DZN6      PR--S-------------TDLSAKGRRN-----------VDGLGQ--------------A
A0A2N6V1R5      PK--S-------------TELNAKGRQN-----------VDGLGQ--------------A
G9PHS6          PK--S-------------TELNAKGRQN-----------VDGLGQ--------------A
U1PLM7          PK--S-------------TELNAKGRQN-----------VDGLGQ--------------A
A0A4V1VGV9      PK--A-------------PTLQSRRRGG-----------LGELGT--------------T
A0A2S5UYV0      PK--S-------------PQLMGKNRAS-----------NDADAI--------------A
A0A7W4UQ09      PK--S-------------PQLMGKNRGT-----------NDADAI--------------A
A0A2S5X9U6      PK--S-------------PQLMGKNRGT-----------NDADAI--------------A
A0A2S5ULV5      PK--S-------------PQLMGKNRGT-----------NDADAI--------------A
A0A653YMF0      PK--S-------------PQLMGKNRGT-----------NDADAI--------------A
A0A7V9H755      PRLATSAYGSRNFVQRALPSRSSNGRSAPTGGREELVTITDVRSS--------------A
A0A3Q9IY80      PD--EKSFTADNRL----LPVDGISSGS-----------HADLFG--------------V
A0A0F0LP73      PK----------------FDPDGRSKKD-----------AIARAV--------------A
A0A346Y185      PS--FEE-----------IGLTGSVPTV-----------EAPKSP--------------A
A0A7W0HGW1      HN--PSYATQSSDVILPFEDRRSQER----------------------------------
A0A259S8H9      PR--M--------------RKSGQGRNA-----------ALARAV--------------A
A0A2W1Z497      PL--NPALTDHRQLVDALPNRTPEERRV-----------NFATS----------------
A0A0Q5L115      PQ--NDALAEHGGLVAALPNATADDRHV-----------NFAMS----------------
A0A7G6YY64      PQ--NDALAEHGGLVAALPNATADDRHV-----------NFAMS----------------
A0A7J5B4S5      PK--S-------------PQLMGKNRAS-----------NDADAI--------------A
A0A852U976      PK--S-------------PQLMGKNRAS-----------NDADAI--------------A
A0A1F1X071      PD--A----KE-------LARGKDGVLP-----------EPTSFP--------------S
A0A3R8RWC7      PD--A----KE-------LARGKDGVLP-----------EPASFP--------------S
A0A4U0RJZ4      PK--A-------------KNLQTKSRGG-----------LGALGS--------------T
A0A4R1FGL9      PK--A-------------KNLQTKSRGG-----------LGALGS--------------T
E3B8H1          PK--A-------------KNLQTKSRGG-----------LGALGS--------------T
A0A7D7WDT9      PK----------------MGRKGTPQGD-----------SLTETV--------------A
A0A0Q5AWK6      PK----------------AGRRAGRKGE-----------T-VDRI--------------T
A0A6P1F176      PK--I----GKGRGGRGQGGRDRGGRGR-----------A-VDGI--------------T
A0A3N1NLD3      PK--M----GKGR-----VGRRGDARA--------------VDGI--------------T
A0A3N2FVI8      PK--M----GKGR-----GGRRGDARA--------------VDGI--------------T
A0A2S5XDQ6      PK--------AGR-----PGRTGGRRG--------------TDAL--------------T
A0A2S5XNN6      PK--------AGR-----PGRTGGRRG--------------TDAL--------------T
A0A5C8C085      PK----------------APLLAHDTNEAANLAVLEAAARGAGQS--------------A
A0A4Y5YMQ6      PR----------------RRNPAQGAAFLISPNGS------------------------A
A0A1E4BP96      PL----------------DHDLDNRREVLSFTGASGNVVRGA-----------------L
A0A7V9FXS6      PA----------------SRALRTRATAGLSDPA-------------------------A
A0A7W0PY69      PR----------------SRILRARPTEAFSDPV-------------------------T
A0A7W8YB99      PS----------------DPRLSKGRQVLPVTATNSSRADRSNHA--------------Y
A0A1L2ZMQ6      PS----------------DPRLSRGRQVLPVVYSAETRTDRSYHA--------------Y
A0A7W8TR75      PS----------------DPRLSRGRQVLPVVYSAETRTDRNYHA--------------Y
A0A151BT98      PR----------------VGGGHRVVDTSDHPSGA------------------------M
A0A2Y8ZRF8      PR----------------VGSGQRVVDTSDSPSGA------------------------M
A0A2R9UAT1      PV----------------EKSFTAANRLIPVGGQRDERLFA------------------V
A0A3E2DN22      PD----------------DKKLAEQREKSIVHISGV-----------------------T
A0A3Q9ULZ9      PE----------------DRQLSKQRKTGDLGLSGI-----------------------T
A0A3S9JFL2      PE----------------DRQLTKQRKSGDLELAGI-----------------------A
A0A3L8NYD3      PE----------------SDELDRVGDDGLVGSQTGP----------------------A
A0A1M6K628      PT----------------AVELASGVSLVNDSGT-------------------------A
A0A561E8R3      PK----------------VPELAEDYRGDTGLGN-------------------------A
A0A4Q5J5D7      PT----------------ASDLASTDGAGPVAVQDRSGSQRRSE---------------S
A0A1Y4CKD6      PE----------------VRAKARKRSAASRYVSALDKRVSHG----------------F
A0A0Q7KBQ4      PF----------------DRQLKKQALTSEGHGA-------------------------L
A0A5Q5BFU2      PL----------------SKDRRKQAAIGFESDNSG-----------------------I
A0A439DNZ6      PL----------------DKERKRSPAKSLDNDNSA-----------------------F
A0A7I7UD03      PL----------------DKDRRKQPAISFDADNSL-----------------------I
A0A7I7MI62      PL----------------DKERRRQAAIFFDGDNSA-----------------------I
A0A0J6YE86      PL----------------DKERRRHAAIAFENDNSV-----------------------I
A0A7I7K1R9      PL----------------DKERRRQPAIAFDADNSG-----------------------I
A0A7I9ZLK4      PL----------------DKERRKHPAISFDNDNSG-----------------------I
A0A1F1IHY9      PE----------------STRSARNRRRRDGGDVINLAGRVDGETSPKQHQDSFR----L
A0A7H2BCD6      PK----------------SEDLASTKILHEAGDHV------------------------S
A0A3S0V9U6      PK----------------TNALDQNSFLEDAADHQ------------------------S
A0A7T4T4U7      PK----------------SSALDENTFLSDRADHQ------------------------S
A0A1S2N0P2      PK----------------SSALDENTFLSDRADHQ------------------------S
A0A0Q3BEY5      PK----------------SSALDENTFLSDRADHQ------------------------S
A0A4R6Q3C6      PK----------------SSALDENTFLSDRADHQ------------------------S
A0A7T3CHP7      PK----------------SSALDENTFLSDRADHQ------------------------S
A0A7Y5U6C1      PS----------------PPSRLAQNNRIAMLEERHGP---------------------H
A0A542HCT5      PE----------------TSALVRKKGGLVPLVVTGPRKDKDPVH--------------S
A0A537WNY9      PH----------------EPAVTRLATPEALALDNRLHV--------------------F
A0A5B8M469      P-------------------RFKGKGGVRGGELDRL-----------------------S
A0A2S8WHZ8      PE----------------DQRLTEGRSVVETGSIVHDDRAAHA----------------F
A0A1Y4CTD2      PF----------------ERKRVVRGGDERSVPALVLSSPLVSMG--------------F
A0A3N3ZPU0      PL----------------DKRLTAKRGVIPTAPPRKDREAWA-----------------T
A0A359IQX7      PK----------------VAELEQQRVEEGQVSLGE-----------------------A
A0A7W9IKV0      CY----------------ERDAKRHPLILRSRGRSS-----------------------R
A0A1N7E3F1      GY----------------ERDARRHPLVLRDQGRSV-----------------------R
A0A544ZKQ1      GY----------------ERDAKRHPLILRDQGRSS-----------------------R
A0A5D0Q2X0      GY----------------ERDAKRHPLILRDQGRSS-----------------------R
A0A5R8Z2E7      GY----------------ERDAKRHPLILRDQGRSS-----------------------R
A0A0Q9LZR0      PE----------------TSALVRKKGGLVPLVVAGTSKEKDPVH--------------S
A0A1F1J417      PV----------------SDDLAEENIVHASNDDHI-----------------------A
A0A2A8D6P2      PV----------------SDDLAEENIVHASNDDHI-----------------------A
A0A1F0THV9      PV----------------SDDLAEENIVHASNDDHI-----------------------A
A0A5F0M6Y0      PV----------------SDDLAEENIVHASNDDHI-----------------------A
E3H5W1          PV----------------SDDLAEENIVHASNDDHI-----------------------A
A0A1F1QKB0      PV----------------SDDLAEENIVRASNDDHI-----------------------A
A0A509JY23      PV----------------SDDLAEENIVRASNDDHI-----------------------A
A0A448USF4      PV----------------SDDLAEENIVRASNDDHI-----------------------A
A0A7Z9A2N0      PT----------------SDDLTEENIVTGSSNDHI-----------------------A
A0A433EDP2      PT----------------SDDLTEENIVTGSSNDHI-----------------------A
A0A231VTW0      PT----------------SDDLTEENIVTGSSNDHI-----------------------A
A0A433ECD0      PT----------------SDDLTEENIVTGSSNDHI-----------------------A
A0A7T9UPU8      PT----------------SDDLTEENIVTGSSNDHI-----------------------A
U7V3Z1          PT----------------SDDLTEENIVTGSSNDHI-----------------------A
A0A6I3F378      PV----------------TSSTGDRPLATTDPTND------------------------A
A0A838H0S5      PN----------------FGAVGVTGTMPAMTAPHSV----------------------A
A0A1S1CQC5      PV----------------SEDLNEENIVNGDTDDHI-----------------------A
A0A1E9T6I0      PV----------------SEDLNEENIVNGDTDDHI-----------------------A
A0A1F1GHA7      PV----------------SEDLNEENIVNGDTDDHI-----------------------A
A0A1S1CAD0      PV----------------SDDLNEDNIVKGDTDDHI-----------------------A
G5ET14          PV----------------SDDLNEDNIVKGDTDDHI-----------------------A
A0A1E9DXX2      PI----------------SDDLNEENIVNGDTDDHI-----------------------A
A0A1E8S156      PV----------------SDDLNEDNIVKGDTDDHI-----------------------A
A0A1E8S5S2      PV----------------SDDLNEDNIVKGDTDDHI-----------------------A
A0A1S1DFA8      PV----------------SDDLNEDNIVKGDTDDHI-----------------------A
A0A2I1Z490      PV----------------SDDLNEDNIVKGDTEDHI-----------------------A
A0A1F0DAA9      PV----------------SDDLNEENIVKGNTDDHI-----------------------A
A0A1F0PHK9      PV----------------SDDLNEENIVKGNTDDHI-----------------------A
A0A1F0VZG6      PV----------------SDDLNEENIVKGNTDDHI-----------------------A
A0A1E9G8X4      PV----------------SDDLNEENIVNGNTDDHI-----------------------A
A0A1E9IAW2      PV----------------SDDLNEENIVNGNTDDHI-----------------------A
A0A1E9ZBC9      PV----------------SDDLNEENIVNGNTDDHI-----------------------A
A0A1E9ZDP4      PV----------------SDDLNEENIVNGNTDDHI-----------------------A
A0A1F0R6B5      PV----------------SDDLNEENIVNGNTDDHI-----------------------A
A0A1F0Z7N5      PV----------------SDDLNEENIVNGNTDDHI-----------------------A
A0A1F1D897      PV----------------SDDLNEENIVNGNTDDHI-----------------------A
D2NP38          PV----------------SDDLNEENIVNGNTDDHI-----------------------A
A0A1F1FV74      PV----------------SEDLNEENIVKGDTDDHI-----------------------A
A0A1E9M791      PV----------------SEDLNEENIVKGDTDDHI-----------------------A
A0A291DEI8      PV----------------SEDLNEENIVKGDTDDHI-----------------------A
A0A1S1D5T1      PV----------------SDDLSEENIVNGGTDDHI-----------------------A
A0A1E8TRD6      PV----------------SDDLSEENIVNGDTDDHI-----------------------A
A0A1F0XT88      PV----------------SDDLSEENIVNGDTDDHI-----------------------A
A0A1F1EVP5      PV----------------SDDLSEENIVNGDTDDHI-----------------------A
C6R548          PV----------------SDDLSEENIVNGDTDDHI-----------------------A
A0A0K2RXS2      PV----------------SDDLNEENIVNGNTDDHI-----------------------A
A0A1F0KX60      PV----------------SDDLNEENIVNGNTDDHI-----------------------A
A0A542I3V2      PY----------------DPDISGALKVLGTERHQLTQAGERNRA--------------F
A0A2T0UZ65      PL----------------SNELRKARGGRSSG-----------LG---------L----A
A0A0Q5M6Z7      PA----------------SPALEDRRRVTDSDSGDDA-----------------VELFTI
A0A7G6YA19      PA----------------SPALSDRRRVVEQDGSADS-----------------VQLFAI
A0A853CXS3      PA----------------SPALSERQRVVEQASTADS-----------------VQLFAI
A0A7W8YB56      PQ----------------DPRLGDHRQVVTMVEAGD------------------KRGWAT
A0A1L2ZMV4      PQ----------------DKRLDHHRQVITVGEPGD------------------KQGWAT
A0A7W8TSW5      PQ----------------DKRLDHHRQVITVGEPGD------------------KQGWAT
A0A1R4JTI6      PA----------------MAGLGRRAQRNRTQSKDSNAEVESRSALLELTGHTGRDDFHV
A0A4R7TM52      PF----------------EKSFTSAGRLIPFGGGYDEGIRSKHF----------R----V
A0A542XE74      PE----------------TKSLKVRKGQASKR----------VSG---------A----A
A0A0Q7QDF6      AQ----------------DRHVADHPLISTLS----------NQH---------P----R
A0A7X7XPM3      RK----------------IRDMTADRLVVETD----------PHS---------L----A
A0A5R8L819      PL----------------ERTFSSASRLLPAGGSHVPHELF-------------A----M
A0A7K0PFV4      PT----------------VRGFGGINMPP-------------------------P----V
A0A0G3V3F3      PK----------------GEGF--------------------------------E----T
A0A7K0MUQ7      PK----------------GEGF--------------------------------E----T
A0A7K0U619      PK----------------GEGF--------------------------------E----T
A0A6I3DFP2      PK----------------GEGF--------------------------------E----T
A0A7K0SI36      PK----------------GEGF--------------------------------E----T
A0A7K0V140      PK----------------GEGF--------------------------------E----T
A0A261FQA1      PK----------------SDTFRGTAPAVISD----------PSS---------K----A
A0A1Q2CJ92      PA----------------AAELAGESALVTGS------------S---------A----A
A0A2T0S3C8      PF----------------DADARSGPLRLTGS----------GHS---------P----R
A0A810MDE3      PF----------------DADARSGPLRLTGS----------GHS---------P----R
A0A4Y8WZJ3      PE----------------STRSARNRRRRDGGDVINLAGRVDGETSPKQHQDSFR----L
A0A7X0KT97      PI----------------SESLGGDSRLFDPK---SSGRGKGTGF---------A----V
A0A853DGU7      PK----------------TSMLRGNSRRDADP-----------HS---------H----A
A0A7Z0A2Z7      EF----------------DPDARSQALIVGEA----------FTS---------V----R
A0A285VUW0      PV----------------LPTAGRTSSMYIEN---------DPFG---------P----Q
A0A849PJI9      PK----------------VNELSGKRRGGLGR-----------LG---------P----A
A0A2R7Z032      PK----------------VDALNRTHRGVRGD-----------LG---------Q----A
A0A6J4MTQ2      PK----------------VDSLAQSSRGIRGD-----------LG---------Q----A
A0A1I0W453      PK----------------EDSLGRSHRGVRGD-----------LG---------K----A
A0A0Q6VV12      PK----------------EDALGRTHRGVRGD-----------LG---------R----A
A0A495NTA9      PK----------------EDALDRGHRGVRGD-----------LG---------R----A
A0A1H4LCS9      PK----------------EDALGRGHRGVRGD-----------LG---------R----A
A0A4Q2RZP8      PK----------------EDALGRGHRGVRGD-----------LG---------R----A
A0A0Q9QB08      PK----------------EDALGRVNRGVRGD-----------LG---------R----A
A0A7Y9H290      PK----------------EDALDRAHRGVQGD-----------LG---------R----A
A0A4Q2SA86      PK----------------EDSLGRTHRGVRGD-----------LG---------R----A
A0A4Z1C3Z0      PT----------------EDSLGRTHRGVRGD-----------LG---------R----A
A0A6V8KDX4      PF----------------DAKAADAPLLTEAA-----------SC---------S----R
A0A444BL03      PV----------------TSELRVQGGRGRLD----------HLG---------I----A
A0A7V9PCQ0      PP----------------TRRLARGNESVASL-------LEDGPP---------E----L
A0A4Y8X357      PQ----------------DKTMTAERTDRLGD----------PSP---------R----A
R4LD52          PF----------------DDDAKEGPRALLGT----------GHS---------A----R
A0A4T2CD79      PK----------------DAALTDENRIVSETGGIHAGSVTVQSR---------P----L
A0A6L6AM03      PK----------------EDALGRVHRGVRGD-----------LG---------R----A
A0A4Q2RU39      PK----------------EEVLGRTHRGVRGD-----------LG---------R----A
A0A4Q2SK58      PK----------------EEALGRSHRGVRGD-----------LG---------K----A
A0A2N3YJR1      PV----------------TPELRAARGRGRLD----------ALG---------A----S
A0A6G8FYB9      PQ----------------TKELGVVRGRGRVG----------QLG---------I----A
A0A4Q4D742      PF----------------YPQVKKEP--LSAE----------TGG---------N----L
A0A1C6T1J1      PL----------------DTAARTAPLIVGEA----------ATS---------A----R
A0A2W2CFC8      PL----------------DNDARTAPLIIGVA----------AAS---------A----R
A0A2W2A4B0      GF----------------DPEASKQPLVLRDA----------RAS---------A----R
A0A4Y9MDA5      PT----------------RPAGSTPGAVVDAD----------PSG---------V----V
A0A1H7N9P7      PT----------------RPSGSTAHPAVDAD----------PHG---------V----V
A0A1M7V0F8      PA----------------RSPRSAPGAVVETD----------SHS---------V----A
A0A1M3LEY6      AF----------------DKLAPKRPLIVQSEPNSP-----------------------R
A0A538AJI7      PP----------------SRALKQGPLAAFSDLRT-------------------------
A0A538AM15      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      -----------------------------------------------------------E
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      -----------------------------------------------------------V
A0A419GS64      -----------------------------------------------------------L
A0A4R1CW45      -----------------------------------------------------------R
A0A4R5Z7B0      -----------------------------------------------------------I
A0A542H054      -----------------------------------------------------------I
A0A6M8GFV5      -----------------------------------------------------------F
A0A7G8U6J2      -----------------------------------------------------------I
A0A2S8MDM2      -----------------------------------------------------------T
A0A357ZDL3      -----------------------------------------------------------I
A0A1I6GVG4      -----------------------------------------------------------I
A0A1I6IST1      -----------------------------------------------------------I
A0A412JBM5      -----------------------------------------------------------I
A0A6J4SUA1      -----------------------------------------------------------M
A0A1C2B334      -----------------------------------------------------------I
R7Y679          -----------------------------------------------------------T
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      -----------------------------------------------------------S
A0A7K0LE65      -----------------------------------------------------------T
A0A838JYQ6      -----------------------------------------------------------A
A0A510HHA8      -----------------------------------------------------------A
A0A6G8Q9J3      -----------------------------------------------------------A
A0A538BBM6      -----------------------------------------------------------Q
A0A5Q2F9A3      -----------------------------------------------------------R
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      -----------------------------------------------------------V
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      -----------------------------------------------------------E
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      -----------------------------------------------------------R
A0A7V8X3I0      -----------------------------------------------------------T
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      -----------------------------------------------------------N
A0A6G8QDQ0      -----------------------------------------------------------A
A0A023X491      -----------------------------------------------------------A
A0A4R1BMZ2      -----------------------------------------------------------A
A0A838JNW7      -----------------------------------------------------------A
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      SNASKTLFANI-------------------RFVSI----------------------DEK
A0A538BYZ4      AEQYRGLRHLV----------------------------------------------EQF
A0A348NU28      SEEFRRIRAAL-------------------SYSGV----------------------AEK
A0A2N4T4Q5      SEALRELRTNL-------------------SFVSV----------------------DAP
A0A4Q5APW3      AEGFRRVRTNL-------------------SFMAPVE--------------------DTN
A0A4Q5B0V3      AEGFRRVRTNL-------------------SFMAPVE--------------------DTN
A0A022KX11      AEAVRRLRTNL-------------------MFVDV----------------------TTG
A0A4Q5A868      AEGFRRVRTNL-------------------SFMAPME--------------------DTN
A0A6N4VXX3      AESFRKLRTNL-------------------SFLAV----------------------DNP
A0A1H4I042      AESFRKLRTNL-------------------SFLSV----------------------DNP
A0A4R7A6D9      AESFRKMRTNL-------------------SFLSV----------------------DNP
A0A345NSU7      AEAVRQLRTNM-------------------MFVDV----------------------TTG
A0A222TG79      SEAYRRLRTNL-------------------SFIGV----------------------DSP
A0A0W8I9Y2      SEALRELRTNL-------------------SFVSV----------------------DSP
A0A7C6LSF9      ADGYRTARAAVMHTASLGFGRGGTEAHELARSTGA-------------------------
A0A255G8R8      FEAYRRLRTNV-------------------QFVA-----------------------APQ
A0A6G7Y423      -EAYRRLRTNV-------------------GFVAL----------------------GGE
A0A4Q4D4T1      AEAMRIIRTNL-------------------QFLDV----------------------DRV
A0A1Q2CRV2      AEAYRSMRTNL-------------------QFLAL----------------------DKG
A0A261FE22      AEEFRRLITNL-------------------SFVKN----------------------DRG
A0A7K0NRJ7      VEAFRVLRTNL-------------------MVLEA----------------------AGR
K6WHS4          AEAFRHLRTNL-------------------SFMDV----------------------DSP
A0A7K0NTR2      AEAYRSFRTSL-------------------------VAMWHRHPVNNPSGKTGSQDTEPL
A0A1H6WL79      AEALRELRTNL-------------------NFIDV----------------------DNP
A0A101LAM5      AEALRELRTNL-------------------DFIDV----------------------DNP
A0A4Y3NEG0      AEALRELRTNL-------------------DFIDV----------------------DNP
A0A1Q2CI19      ADGYRSVRAAL-------------------AHGQAEAAPA----------------RGHQ
A0A512T3M3      ADGYRAARTAI-------------------SHTLGRSAKPSDMSPR-----ERRGTRTNH
W6JTW4          ADAYRAARAAT-------------------THSVETSRAAAPRGPR-----E--NDPEPQ
A0A839J1M0      ADGYRAARTAL-------------------MHLPAQQVPDDWSPRR----ADGQGEHVKQ
A0A8A4Z8K4      ADGYRAARTAL-------------------MHLPAQQVPDDWSPRR----ADGQGEHVKQ
A0A0A0JTY0      SDGYRAARTAL-------------------VHTTGQVMPGDYTPRRAASEVPEKQ-AATG
A0A0A0JXF2      SDAYRAARTAL-------------------SHTAGQVMPSDYTPRR--STVEPRR-SASS
E6S8H2          ADGYRGARTAL-------------------VHTSSLLVQGD--DRR--PTSPPEPVSAAS
A0A0A0JGH0      SDAYRAARTAL-------------------MHTVSRQAPGEYMGRR--AARPEPRPVVEG
N0E4U7          SDAYRAARTAL-------------------MHTVSRKMTGDYTGRR--AATAERGGTATG
A0A0A0IYK2      SDGYRAARTAL-------------------VHTTGQIMPGDYTPRR--SAAGARP-AAKG
A0A0Q9L0H3      SDGYRAARTAL-------------------VHTSGQIMPGDYTPRR--PGGEESR-SRQG
A3TMK0          ADGYRAARTAL-------------------THTAGQVMPGDYSPRR--SAIEPRR-PANT
A0A543PXP1      SDSYRAARTAL-------------------AHTASQHAGASVSSTD--VPRGYAA---AQ
A3TMH6          ADAYRGARTAI-------------------VHTASQRLSVGSAPRH--LLDGPAT-QLEG
A0A6I2XCV4      AELYRTVRTSI-------------------LFAIEAESLAALANSD--SPDSPR---NDR
A0A5R8VLL6      SEALRELRTNL-------------------TFLDV----------------------DNP
A0A3L7ADK2      AESLRELRTNL-------------------SYVDV----------------------DNP
A0A538JQF8      AEGYRVLRTSLLRMPTRVFTEAPPTPDASGGHPEVEAAAAVPSGVG--EWRPVGDSNGAT
A0A1H6YPK1      TEAMRQLRTNL-------------------QFMNV----------------------DHP
A0A0Q9TBP0      SEEYQRLGVNV-------------------RFMVATG--------------------AQE
A0A0G3V3M7      AEAYRSFRTSL-------------------VAMWQRHPTNNRPVLA--GASEP----EAT
A0A6I3DD56      AEAYRSFRTSL-------------------VAMWQRHPTNNRAGLS--GSSEP----EAT
A0A5Q2FA83      AEEYRRLRTNL-------------------QFADV----------------------TTG
A0A2R7MGI0      KEAIRELRTNL-------------------QYVDV----------------------DRP
A0A2T7WQY4      KEAVRELRTNL-------------------QYVDV----------------------DHP
A0A0Q5Q5L3      KEAMRELRTNL-------------------QYVDV----------------------DRP
A0A0Q6DVM4      KEAMRELRTNL-------------------QYVDV----------------------DRP
A0A1N7DLV3      KEAMRELRTNL-------------------QYVDV----------------------DRP
A0A1V2NSB5      KEAMRELRTNL-------------------QYVDV----------------------DRP
A0A1R3WWR6      KEAMRELRTNL-------------------QYVDV----------------------DRP
A0A1G6GTN3      KEAMRELRTNL-------------------QYVDV----------------------DRP
A0A7W5GFA5      KEAMRELRTNL-------------------QYVDV----------------------DRP
A0A2S5WZJ5      AESFRRLRTNL-------------------RFASV----------------------DEE
A0A0Q5JKD6      KEAMRELRTNL-------------------QYVDV----------------------DRP
A0A2W6DK08      AEAYRSLRSSI-------------------MFTENRMNHFDREDMV--LDRSAVDT-TQP
A0A346XTB0      AEAYEFVLSSI-------------------EFALA----------------------DLD
A0A542FTE6      TEGIRELRTNL-------------------AYVSI----------------------DDP
A0A7Y9QM02      TEGIRELRTNL-------------------AYVSI----------------------DDP
A0A6I1G2U1      ADGYRTARAAV-------------------MHTASLEVGRSESALA--ERRRAR---QGH
A0A351ETF8      AERYEAVLTAI-------------------EFASI----------------------GEP
A0A349B7N2      AEAYRGLRTSV-------------------QYMGVVTSRVGESPSD--LRRQQTKRRDRS
A0A4Q2JUT1      SEALRSLRTNL-------------------QFMDV----------------------DHP
A0A6L5R0V7      SESLRSLRTNL-------------------QFMDV----------------------DHP
A0A2S0LQ32      AEAIRLLRTNL-------------------RFVDV----------------------DNP
A0A7T8DZN6      AEAIRLLRTNL-------------------RFVDV----------------------DNP
A0A2N6V1R5      AEALRHLRTNL-------------------RFVDV----------------------DNP
G9PHS6          AEALRHLRTNL-------------------RFVDV----------------------DNP
U1PLM7          AEALRHLRTNL-------------------RFVDV----------------------DNP
A0A4V1VGV9      AEAFRMLRTNL-------------------RYIST----------------------ERP
A0A2S5UYV0      AESFRRLRTNL-------------------RFASV----------------------DEE
A0A7W4UQ09      AESFRRLRTNL-------------------RFASI----------------------DEE
A0A2S5X9U6      AESFRRLRTNL-------------------RFASV----------------------DEE
A0A2S5ULV5      AESFRRLRTNL-------------------RFASV----------------------DEE
A0A653YMF0      AESFRRLRTNL-------------------RFASV----------------------DEE
A0A7V9H755      AEGYRTLRTNL-------------------MFSQA----------------------VQA
A0A3Q9IY80      SEAMRELRTNL-------------------QFMDV----------------------DNP
A0A0F0LP73      HEAHRQIRTGL-------------------RFASV----------------------DQE
A0A346Y185      GEAYQFLVGAL-------------------AFALA----------------------ETG
A0A7W0HGW1      -EAYRALRTTL-------------------LFGQH----------------------DER
A0A259S8H9      HEAYRQIRTGL-------------------RFASV----------------------DQE
A0A2W1Z497      -EALRELRTNL-------------------SYVHV----------------------DER
A0A0Q5L115      -EALRELRTNL-------------------AYVKV----------------------DAQ
A0A7G6YY64      -EALRELRTNL-------------------AYVKV----------------------DAQ
A0A7J5B4S5      AESFRRLRTNL-------------------RFASV----------------------DEE
A0A852U976      AESFRRLRTNL-------------------RFASV----------------------DEE
A0A1F1X071      REALRKLRTNL-------------------RYIDV----------------------DNP
A0A3R8RWC7      REALRKLRTNL-------------------RYIDV----------------------DNP
A0A4U0RJZ4      SEAFRMLRTNL-------------------RYVLA----------------------EQP
A0A4R1FGL9      SEAFRMLRTNL-------------------RYVSA----------------------EQP
E3B8H1          SEAFRMLRTNL-------------------RYVSA----------------------EQP
A0A7D7WDT9      NEAFRQLRTSL-------------------RFANV----------------------DSE
A0A0Q5AWK6      AEAYRALRTGL-------------------RFSSV----------------------DDE
A0A6P1F176      AEAFRALRTGL-------------------RFSSV----------------------DDE
A0A3N1NLD3      AEAFRALRTGL-------------------RFSSV----------------------DDE
A0A3N2FVI8      AEAFRALRTGL-------------------RFSSV----------------------DDE
A0A2S5XDQ6      AEAFRSLRTGL-------------------RFSSV----------------------DEE
A0A2S5XNN6      AEAFRSLRTGL-------------------RFSSV----------------------DEE
A0A5C8C085      AEAFRKLRTNL-------------------QFMNV----------------------DNP
A0A4Y5YMQ6      AEAFRQVRSAL-------------------RFSAV----------------------EHQ
A0A1E4BP96      TEAIRELRTNL-------------------QFMDV----------------------DDP
A0A7V9FXS6      GSAFRILRANL-------------------EPQLR----------------------DGT
A0A7W0PY69      GAAFRTLRANL-------------------EPQIR----------------------ERK
A0A7W8YB99      AEALRELRTNL-------------------AYMDV----------------------DNP
A0A1L2ZMQ6      SEALRELRTNL-------------------AYMDV----------------------DNP
A0A7W8TR75      SEALRELRTNL-------------------AYMDV----------------------DNP
A0A151BT98      VEAMRRLRTNV-------------------KFVNV----------------------TND
A0A2Y8ZRF8      VEAMRRLRTNV-------------------KFVNV----------------------TND
A0A2R9UAT1      SEALRELRTNI-------------------QFMDV----------------------DHP
A0A3E2DN22      GEAFRHLRTNL-------------------RFANV----------------------DNP
A0A3Q9ULZ9      AEAFRQLRTNL-------------------RFINV----------------------DHP
A0A3S9JFL2      GEAFRQLRTNL-------------------RFINV----------------------DHP
A0A3L8NYD3      AEALRQLRTNL-------------------RFVDV----------------------DKP
A0A1M6K628      AEALRQLRTNL-------------------RFVSV----------------------DTP
A0A561E8R3      AEALRMLRTNL-------------------RFIDV----------------------DRH
A0A4Q5J5D7      AEAFRKLRTNL-------------------QFMDV----------------------DNP
A0A1Y4CKD6      RESARAMGARV-------------------RDALS----------------------ERG
A0A0Q7KBQ4      AEAFRVLRTNL-------------------QFANL----------------------DAK
A0A5Q5BFU2      AEAFRKLRTNL-------------------QFLAV----------------------DNP
A0A439DNZ6      AEAFRKLRTNL-------------------QFLAV----------------------DNP
A0A7I7UD03      AEAFRKVRTNL-------------------QFLAV----------------------DNP
A0A7I7MI62      AEGFRKLRTNL-------------------QFLAV----------------------DNP
A0A0J6YE86      AEAFRKLRTNL-------------------QFLSV----------------------DNP
A0A7I7K1R9      AEAFRKLRTNL-------------------QFLSV----------------------DNP
A0A7I9ZLK4      AEAFRKVRTNL-------------------QFLAV----------------------DNP
A0A1F1IHY9      TESFKELRTNL-------------------QFLRP----------------------DEA
A0A7H2BCD6      QESIRQLRTNL-------------------RFVNV----------------------DRP
A0A3S0V9U6      AESLRQLRTNL-------------------RFVSV----------------------DQP
A0A7T4T4U7      EEALRQLRTNL-------------------RFVSV----------------------DAP
A0A1S2N0P2      EEALRQLRTNL-------------------RFVSV----------------------DAP
A0A0Q3BEY5      EEALRQLRTNL-------------------RFVSV----------------------DAP
A0A4R6Q3C6      EEALRQLRTNL-------------------RFVSV----------------------DAP
A0A7T3CHP7      EEALRQLRTNL-------------------RFVSV----------------------DAP
A0A7Y5U6C1      AESFRVLRTNL-------------------EFFNL----------------------DLQ
A0A542HCT5      AESFLKLRTNL-------------------QFMDI----------------------DNP
A0A537WNY9      AEALRDVRTNL-------------------LFTEG----------------------GK-
A0A5B8M469      AESFRQVRTGL-------------------RFSSV----------------------DGE
A0A2S8WHZ8      SESLRELRTNL-------------------NYIDV----------------------DNP
A0A1Y4CTD2      AEANRRTATRL-------------------EAHLR----------------------SGG
A0A3N3ZPU0      SEAFRQLRTNL-------------------TFANV----------------------DDP
A0A359IQX7      SEAFRHLRTNL-------------------RYVNV----------------------DSP
A0A7W9IKV0      AEAFRSLRTNL-------------------QFVGV----------------------DRK
A0A1N7E3F1      AEAFRSLRTNL-------------------QFIGV----------------------DRQ
A0A544ZKQ1      AEAFRSLRTNL-------------------QFIGV----------------------DRQ
A0A5D0Q2X0      SEAFRSLRTNL-------------------QFIGV----------------------DRQ
A0A5R8Z2E7      SEAFRSLRTNL-------------------QFIGV----------------------DRQ
A0A0Q9LZR0      AESFLKLRTNL-------------------QFMDI----------------------DNP
A0A1F1J417      HESIRQLRTNL-------------------RFVNI----------------------DNP
A0A2A8D6P2      HESIRQLRTNL-------------------RFVNI----------------------DNP
A0A1F0THV9      HESIRQLRTNL-------------------RFVNI----------------------DNP
A0A5F0M6Y0      HESIRQLRTNL-------------------RFVNI----------------------DNP
E3H5W1          HESIRQLRTNL-------------------RFVNI----------------------DNP
A0A1F1QKB0      HESIRQLRTNL-------------------RFVNI----------------------DNP
A0A509JY23      HESIRQLRTNL-------------------RFVNI----------------------DNP
A0A448USF4      HESIRQLRTNL-------------------RFVNI----------------------DNP
A0A7Z9A2N0      QESIRQLRTNL-------------------RFVNI----------------------DEP
A0A433EDP2      QESIRQLRTNL-------------------RFVNI----------------------DEP
A0A231VTW0      QESIRQLRTNL-------------------RFVNI----------------------DEP
A0A433ECD0      QESIRQLRTNL-------------------RFVNI----------------------DEP
A0A7T9UPU8      QESIRQLRTNL-------------------RFVNI----------------------DEP
U7V3Z1          QESIRQLRTNL-------------------RFVNI----------------------DEP
A0A6I3F378      VEAYRWLRTSV-------------------QFAGT----------------------DRN
A0A838H0S5      GEAYHFLVAAL-------------------GFALE----------------------RAG
A0A1S1CQC5      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1E9T6I0      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1F1GHA7      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1S1CAD0      QESIRQLRTNL-------------------RFVNV----------------------DTP
G5ET14          QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1E9DXX2      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1E8S156      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1E8S5S2      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1S1DFA8      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A2I1Z490      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1F0DAA9      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1F0PHK9      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1F0VZG6      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1E9G8X4      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1E9IAW2      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1E9ZBC9      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1E9ZDP4      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1F0R6B5      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1F0Z7N5      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1F1D897      QESIRQLRTNL-------------------RFVNV----------------------DTP
D2NP38          QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1F1FV74      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1E9M791      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A291DEI8      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1S1D5T1      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1E8TRD6      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1F0XT88      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1F1EVP5      QESIRQLRTNL-------------------RFVNV----------------------DTP
C6R548          QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A0K2RXS2      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A1F0KX60      QESIRQLRTNL-------------------RFVNV----------------------DTP
A0A542I3V2      VEALRALRTNL-------------------RFVDV----------------------DHR
A0A2T0UZ65      GESFRQIRTNL-------------------RFVSP----------------------DAP
A0A0Q5M6Z7      SESLRELRTNL-------------------SYIDV----------------------DQP
A0A7G6YA19      SESLRELRTNL-------------------SYIDV----------------------DNP
A0A853CXS3      SESLRELRTNL-------------------SYIDV----------------------DNP
A0A7W8YB56      AEALRDLRTNL-------------------TFSRV----------------------DNP
A0A1L2ZMV4      SEALRELRTNL-------------------TFSRV----------------------DNP
A0A7W8TSW5      SEALRELRTNL-------------------TFSRV----------------------DNP
A0A1R4JTI6      VEAFKELRTNL-------------------QFLRP----------------------DNP
A0A4R7TM52      AEAMRELRTNI-------------------QFMDV----------------------DRP
A0A542XE74      GEALRQLRTNL-------------------RFVSV----------------------DAP
A0A0Q7QDF6      AEAMRIIRTNL-------------------QFLDV----------------------DRV
A0A7X7XPM3      AEEFRRLRTNL-------------------QFVDV----------------------TTG
A0A5R8L819      SEAMRELRTNI-------------------QFMDV----------------------DHP
A0A7K0PFV4      REAFRTLQIQL-------------------DLQPK----------------------DG-
A0A0G3V3F3      VEAFRVLRTNL-------------------MVLEA----------------------AGR
A0A7K0MUQ7      VEAFRVLRTNL-------------------MVLEA----------------------AGR
A0A7K0U619      VEAFRVLRTNL-------------------MVLEA----------------------AGR
A0A6I3DFP2      VEAFRVLRTNL-------------------MVLEA----------------------AGR
A0A7K0SI36      VEAFRVLRTNL-------------------MVLEA----------------------AGR
A0A7K0V140      VEAFRVLRTNL-------------------MVLEA----------------------AGR
A0A261FQA1      AEDIRRLALNL-------------------DFIVP----------------------DKT
A0A1Q2CJ92      AEAIRQIRTNL-------------------RFVSV----------------------DNP
A0A2T0S3C8      SEALRQLRTNL-------------------QFVDV----------------------DRP
A0A810MDE3      SEALRQLRTNL-------------------QFVDV----------------------DRP
A0A4Y8WZJ3      TESFKELRTNL-------------------QFLRP----------------------DEA
A0A7X0KT97      SEALRALRTNL-------------------QFMDV----------------------DNP
A0A853DGU7      GEALRQLRTNL-------------------RFVNV----------------------DNP
A0A7Z0A2Z7      AEGYRQLRANL-------------------RYIDS----------------------AKP
A0A285VUW0      AEAIRKLRTNL-------------------VFVDV----------------------ASD
A0A849PJI9      SEAMRMLRTNL-------------------RFVDV----------------------DNP
A0A2R7Z032      AEAFRQLRTNL-------------------RFLDV----------------------DNP
A0A6J4MTQ2      AEAFRQLRTNL-------------------RFVDV----------------------DRP
A0A1I0W453      AESFRQLRTNL-------------------RFVDV----------------------DNE
A0A0Q6VV12      AESFRQLRTNL-------------------RFVDV----------------------DNE
A0A495NTA9      AEAFRQLRTNL-------------------RFVDV----------------------DNE
A0A1H4LCS9      AESFRQLRTNL-------------------RFVDV----------------------DNE
A0A4Q2RZP8      AESFRQLRTNL-------------------RFVDV----------------------DNE
A0A0Q9QB08      AEAFRVLRTNL-------------------RFVDV----------------------DNE
A0A7Y9H290      AEAFRQLRTNL-------------------RFVDV----------------------DNE
A0A4Q2SA86      AEAFRQLRTNL-------------------RFVDV----------------------DNE
A0A4Z1C3Z0      AEAFRLLRTNL-------------------RFVDV----------------------DNE
A0A6V8KDX4      SESLRHLRTNL-------------------QFADV----------------------DGP
A0A444BL03      SESFRQIRTNL-------------------RFVGV----------------------DDP
A0A7V9PCQ0      IEAFQSLRTNL-------------------DLLLL----------------------DRK
A0A4Y8X357      AEAVRQLRTNL-------------------RFAAV----------------------DDP
R4LD52          AEALRQLRTNL-------------------QYVDV----------------------DRP
A0A4T2CD79      AEAFRELRTNM-------------------RFMRV----------------------DSP
A0A6L6AM03      AEAFRQLRTNL-------------------RFVDV----------------------DNE
A0A4Q2RU39      AEAFRQLRTNL-------------------RFVDV----------------------DNE
A0A4Q2SK58      AEAFRQLRTNL-------------------RFVDV----------------------DNE
A0A2N3YJR1      AESFRQIRTNL-------------------RFVGV----------------------DDP
A0A6G8FYB9      TEAFRQIRTNL-------------------RFVGV----------------------DDP
A0A4Q4D742      AEAFRVLRTNL-------------------QFVKL----------------------DAE
A0A1C6T1J1      AEAVRKLRTNL-------------------RFVDV----------------------HEP
A0A2W2CFC8      AEAIRKLRTNL-------------------RFVDA----------------------DEP
A0A2W2A4B0      AEAFRSLRTNV-------------------QFLAS----------------------RPE
A0A4Y9MDA5      AEAFRQLRTNL-------------------QFVGV----------------------GDG
A0A1H7N9P7      AEAVRQFRTNL-------------------QFLGM----------------------QDE
A0A1M7V0F8      AEAFRHLRTNL-------------------QFVGV----------------------QDE
A0A1M3LEY6      AEAFRSLRTNL-------------------QFLDV----------------------EGG
A0A538AJI7      ASAFRILRANL-------------------EPQLR----------------------EGS
A0A538AM15      AEQYRALRHTV-------------------EQLHK----------------------ARD
A0A520EHH5      ----------------------------------------------------------DN
A0A4R0U4F1      AEEIRRLRTNV-------------------MF-VL----------------------PDE
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      QNAAKTLYANI-------------------RF-LS----------------------PDK
A0A419GS64      AESYRTLRANI-------------------LL-TN----------------------VDS
A0A4R1CW45      SRPFSLMRTQL-------------------AK-RL----------------------VEE
A0A4R5Z7B0      SEQYRTIRTNI-------------------QY-SS----------------------IDK
A0A542H054      SEQYKTVRTSI-------------------NF-SS----------------------VDQ
A0A6M8GFV5      AEQYRTVRTNI-------------------QF-SS----------------------IDK
A0A7G8U6J2      TEQYRLIRTNI-------------------QF-SS----------------------VDK
A0A2S8MDM2      AEAFRKLRTNL-------------------QF-LA----------------------IDS
A0A357ZDL3      QNAIKTLYANI-------------------RF-LS----------------------PDN
A0A1I6GVG4      GEAMRELRTNL-------------------QY-MD----------------------VDN
A0A1I6IST1      GEAMRELRTNL-------------------QY-MD----------------------VDN
A0A412JBM5      REAYVRLRTNL-------------------MF-CV----------------------NGD
A0A6J4SUA1      VEAFRSIRLAL-------------------RH-TF----------------------ASD
A0A1C2B334      AESYRRIRTNL-------------------AF-AA----------------------VDP
R7Y679          AEQFRKIRTNL-------------------TF-AN----------------------VDN
A0A4Y8ZIU8      ------LRTNL-------------------RF-AA----------------------VDD
A0A0F0KYJ9      ---MRELRTNL-------------------VY-MD----------------------VDN
A0A838H149      ------LRNNV-------------------EF-AS----------------------VDA
A0A7M2YYB9      AEPFRMLRLAV-------------------DL-RP----------------------RGD
A0A7K0LE65      VEAFRVLRTNL-------------------MV-LE----------------------AAG
A0A838JYQ6      SEAYRTLRTNL-------------------LY-AF----------------------VDD
A0A510HHA8      SEAYRTLRTGL-------------------LY-AV----------------------VDA
A0A6G8Q9J3      SEAYRGLRTNL-------------------LY-AQ----------------------VDA
A0A538BBM6      REAVRVLRSNL-------------------QV-AL----------------------AGL
A0A5Q2F9A3      AEAFRRLRTNL-------------------QY-LG----------------------RGQ
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      -------RTNL-------------------SF-LD----------------------VDQ
A0A1Q7WJN6      IEALRGVRLNV-------------------AY--A----------------------HGT
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      AEQYRVLRHLV-------------------ET-LR----------------------KGA
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      VEAFRLLRTNL-------------------QF-LD----------------------LDS
A0A7V8X3I0      DEAFRVLRSNL-------------------LV-TL----------------------SDL
A0A7V8YPJ0      -----MLRSNL-------------------LV-AI----------------------SEL
A0A7X7Q7T7      AEAYRKLRTNV-------------------GFVGL----------------------GGE
A0A6G8QDQ0      AEDYRTLRTSL-------------------LY-TV----------------------VDN
A0A023X491      AEAYRTLRTSL-------------------LY-SV----------------------VDE
A0A4R1BMZ2      AEAYRTLRTNL-------------------LY-AL----------------------VDD
A0A838JNW7      SEDYRTLRTSL-------------------LY-AL----------------------VDE
                                                                            

A0A519GXS6      ------------------GEGKTTTAVNLALAYV-E-SG-QRVVLVDADLRRPAVANLL-
A0A6N6NKS9      ----V---KTIVVTSTGMDEGKTQVSTNLACAIA-S-SG-KKVLIVDTDMRRRCIAGLL-
A0A538BYZ4      HKSAR--LSVLAVSSPASGDGKTTTAINLAGALA-Q-APEARVLLVDLDLRRGSVREHL-
A0A348NU28      ----V---QRLMVTSVSPGEGKSMFASNLGLTLA-G-LR-NNVLIIDADLRRPRVADYF-
A0A2N4T4Q5      ----P---RVVVVTSSMPGEGKSSITANLAVAIA-S-TG-RDVVVVDGDLRRPVMTELF-
A0A4Q5APW3      ----C---RLIVVTSIGASEGKTTTSVNIAAALA-E-NG-AKVLLIDADLRHPSVANKL-
A0A4Q5B0V3      ----C---RLIVVTSIGASEGKTTTSVNIAAALA-E-NG-AKVLLIDADLRHPSVANKL-
A0A022KX11      ----R---HSFVITSAVPGEGKTTTAVNLALAMA-D-SG-RRTLLVDADLRNPSVAKTL-
A0A4Q5A868      ----C---RLIVVTSTGASEGKTTTSVNIAAALA-E-NG-AKVLLIDADLRHPSVANKL-
A0A6N4VXX3      ----P---RVIVVTSSVPNEGKSTTAINLALALA-E-TE-NNVVVVDGDMRRSMIQDYL-
A0A1H4I042      ----P---RVIVVTSSIPNEGKSTTAVNIALALV-E-VE-NNVLLVDGDMRRSIAHKHL-
A0A4R7A6D9      ----P---RVIVVTSSIPNEGKSTTAVNIALALV-E-VD-NNVLLVDGDMRRSIAHKHL-
A0A345NSU7      ----K---HSFVISSTLPGEGKTTTAVNLALAMS-D-AG-TKVLLIDADLRHPSVGTTL-
A0A222TG79      ----H---RRFAVTSALEGEGKTTTAVNLAVCLS-E-VG-YKVVVVDADLRRPMVAVRL-
A0A0W8I9Y2      ----P---KMIVVTSALPGEGKSSITANLAVAIA-S-TG-RNVVVVDGDLRRPVITDLF-
A0A7C6LSF9      --------RVVLVTSAQAGEGKTTSIANLAASFA-E-TG-QSILVLDADLRSPDLHLLF-
A0A255G8R8      ----G--RTALVVTSSVPGEGKSVTVANLALAMA-D-AG-NRTLLIDADMRRPTVADNF-
A0A6G7Y423      ----R--RRSMVITSSVQGEGKTQTAVNLARVLA-S-AG-ESVLLVDADLRAPQVAQRM-
A0A4Q4D4T1      ----S---NVYVVTSSVAGEGKTTTASNLAISLA-Q-SG-QNVVLVDGDLRRPRLHEVF-
A0A1Q2CRV2      ----G---RSIVVTSSVPGEGKTSTAINLAATLA-A-AG-EKVLLIDADLRRPRVAAQL-
A0A261FE22      NRG-----NVLVVTSAMLGEGKTTVSVNIAATFV-E-KG-ESVLLIDADVRHPSVAKAL-
A0A7K0NRJ7      ----P---RTVAVVSNTQDAGKSFISINLAQSAS-A-LD-DKVVLIDADLRRPTIHEQL-
K6WHS4          ----A---RMIAVTSPSPGDGKTTVALNLAASLA-E-AG-HSVLLVDADLRNPSVAGRV-
A0A7K0NTR2      ----P--LRLLLVTSPGPAEGKSISVVNLAAAFA-E-TG-MSVVIIDGDFRRPQVHKYF-
A0A1H6WL79      ----P---RILLITSSLPSEGKSTVTSNLAATIA-A-AG-RDVIVVDADLRRPTVHQVF-
A0A101LAM5      ----P---RILLITSSLPSEGKSTVTSNLAATIA-A-AG-RDVIVVDADLRRPTVHQVF-
A0A4Y3NEG0      ----P---RILLITSSLPSEGKSTVTSNLAATIA-A-AG-RDVIVVDADLRRPTVHQVF-
A0A1Q2CI19      ----S---LVVLVSSAHVAEGKSTSTANLAASFA-E-TG-KQVLVIDADLRSPDVHEKL-
A0A512T3M3      ----T---PWVLVTSANPGDGKTTSVGNLAASFA-E-SG-KSVLVLDADLRSPDTHNVF-
W6JTW4          ----A---VAVLVTSAQPSEGKTTSVANLAASFA-E-SG-RRVLVLDADLRSPDAHNLF-
A0A839J1M0      ----A---QVILLSSAHAAEGKSTSVANLAASFA-E-TG-QRVLVLDADLRSPDTHVKF-
A0A8A4Z8K4      ----A---QVILLSSAHAAEGKSTSVANLAASFA-E-TG-QRVLVLDADLRSPDTHVKF-
A0A0A0JTY0      ----A---RLIVVTSAHAAEGKTTSVANLAASFA-E-TG-QRVLVLDADLRSPDVHNVF-
A0A0A0JXF2      ----A---RLVLITSAHAAEGKTTSVANLAASFA-E-TG-QKVLVVDADLRSPDVHNVF-
E6S8H2          ----A---SLILVTSAHPREGKTTSVANLAASFA-E-TG-QRILVLDGDLRSPDTHNIF-
A0A0A0JGH0      ----A---RLILVTSGNAAEGKTTTVANLAASFA-E-TG-QRVLVLDADLRSPNTHTLF-
N0E4U7          ----A---RLILVTSANAAEGKTTTVANLAASFA-E-TG-QRVLVLDADLRSPDTHSLF-
A0A0A0IYK2      ----A---RLILVTSAHAAEGKTTSVANLAASFA-E-TG-QRVLVLDADLRSPDAHNVF-
A0A0Q9L0H3      ----G---RLVLITSAHAAEGKTTSVANLAASFA-E-TG-QTVLVLDADLRSPDIHTAF-
A3TMK0          ----A---RLVLITSAHASEGKTTSVANLAASFA-E-TG-QQVLVLDADLRSPDAHNAF-
A0A543PXP1      ----G---RLILVTSAYPGEGKTTSVANLAASFA-E-TG-LRVLVLDADLRSPDTHDLF-
A3TMH6          ----A---RVVLVTSAHPAEGKTTTVANLAVSFA-E-SG-QRVLVLDADLRSPDTHTLF-
A0A6I2XCV4      ----T---PVILVTSPSPGEGKTTTTANVASVFA-A-AG-TRTLIVDCDYRKPSIGKYL-
A0A5R8VLL6      ----P---RIIVVTSSVSGEGKSTIAANLASAMA-A-AG-DPVIVVDGDLRHPSVAKIF-
A0A3L7ADK2      ----P---QVFVVTSPNPGEGKSTLSANLAETLAVN-SG-KNVVVIDCDLRRPTLSKIF-
A0A538JQF8      ----P---KVVLVCSPRPREGKTMTVANLAVCLA-E-SG-HTVLVLDSDLRAPQAHRLF-
A0A1H6YPK1      ----P---RVLVVTSPVPGDGKSTMAVMLAAAIA-E-SG-RDVVLVDADLRRPTLAKAL-
A0A0Q9TBP0      ----S--APIVLLTSGQESEGKTVTSCNLAVSAA-R-LG-LNVVLIDADFRRASVAPRF-
A0A0G3V3M7      ----P--LRVLLVTSPGPAEGKSISVVNIAAAFA-E-TG-ISVLLIDGDFRRPQMYKYF-
A0A6I3DD56      ----P--LRVLLVTSPGPAEGKSISVVNIAAAFA-E-TG-MSVLLIDGDFRRPQMHKYF-
A0A5Q2FA83      ----G--KHSFVISSVMPGEGKTTTAVNLAIALA-D-SG-ANVVLVDGDLRNPSVAKAM-
A0A2R7MGI0      ----P---RVIVVTSPLPGDGKSTTAANLAVSIA-A-TG-QSVILIDADLRRPVMGGVF-
A0A2T7WQY4      ----P---RVIVVTSPLPGDGKSTTAANLAVSIA-A-TG-QSVILIDADLRRPVMGGVF-
A0A0Q5Q5L3      ----A---RIMVVTSPLPGDGKSTTAANLAVSIA-A-TG-QSVILVDADLRRPVLGGMF-
A0A0Q6DVM4      ----A---RIMVVTSPLPGDGKSTTAANLAVSIA-A-TG-QSVILVDADLRRPVLGGMF-
A0A1N7DLV3      ----P---RVMVVTSPLPGDGKSTTAANLAVSIA-A-TG-QSVILIDADLRRPVLGATF-
A0A1V2NSB5      ----P---RVMVVTSPLPGDGKSTTAANLAVSIA-A-TG-QSVILIDADLRRPVLGATF-
A0A1R3WWR6      ----A---RVMVITSPLPGDGKSTTAANLAVSIA-A-TG-QAVVLIDADLRRPVLGGVF-
A0A1G6GTN3      ----A---RIVVVTSPLSGDGKSTTAANLAVSIA-A-TG-QSVVLIDADLRRPVLGGMF-
A0A7W5GFA5      ----A---RVLVVTSPLPGDGKSTIAANLAVSIA-A-TG-QSVVLIDADMRRPVVGGMF-
A0A2S5WZJ5      ----I---RSMVITSSNAGEGKSTIATSLAQVLA-Q-SN-TPTILIDADLRRPTVATVL-
A0A0Q5JKD6      ----A---RVLVVTSPLPGDGKSTIAANLAVSIA-A-TG-QSVVLIDADMRRPVVGGMF-
A0A2W6DK08      ----P---QVILVASACAAEGKTATVVNLAACFA-E-VG-KRVLVLDCDFRGPDAHQYL-
A0A346XTB0      ----G---KSLLITSTLPGDGKTTTTLQLAIAAS-R-DR-RRVVLVDADIRARGLTRVL-
A0A542FTE6      ----P---SVVVVVSASPGEGKSTVAANLADAVA-A-SG-RPVIVVDCDLRKPMIATIY-
A0A7Y9QM02      ----P---SVVVVVSASPGEGKSTVAANLADAVA-A-SG-RPVIVVDCDLRKPMIATIY-
A0A6I1G2U1      ----A---KVVMVTSAQAGEGKSTSVANLAASFA-E-TG-KSVLVLDADLRSPNLHPMF-
A0A351ETF8      ----V---SSVLFTSAVPGDGKTTTAVNVAALAS---KY-MNVLLVDGDMRRPRVHRML-
A0A349B7N2      ----D--GTVVLVTSPGPAEGKSTTVVNLAAAYA-E-SG-SRVLIVDGDFRRPAVHEFL-
A0A4Q2JUT1      ----P---KTIVVTSPLPGDGKSTIACNLALTLA-A-AG-STVVLVDGDLRRSMVAKTM-
A0A6L5R0V7      ----P---KTIVVTSPLPGDGKSTIACNLALTLA-A-AG-TTVVLVDGDLRRSMVAKTM-
A0A2S0LQ32      ----P---RAIVMTSANPGEGKSTISAVLAQMLA-A-SG-QRTILVDTDLRKPVVHRIF-
A0A7T8DZN6      ----P---RAIVMTSANPGEGKSTISAVLAQMLA-A-SG-QRTILVDTDLRKPVVHRIF-
A0A2N6V1R5      ----P---RAIVMTSANPGEGKSTMSAVLAQMLA-S-SG-QRTVLIDTDLRKPVVHKIF-
G9PHS6          ----P---RAIVMTSANPGEGKSTMSAVLAQMLA-S-SG-QRTVLIDTDLRKPVVHKIF-
U1PLM7          ----P---RAIVMTSANPGEGKSTMSAVLAQMLA-S-SG-QRTVLIDTDLRKPVVHKIF-
A0A4V1VGV9      ----P---RSLVITSAMQSEGKSTVAANLARVLS-A-AG-QSVVLVDTDLRRPTVHETF-
A0A2S5UYV0      ----I---RSMVITSSNAGEGKSTIATSLAQVLA-Q-SN-TPTILIDADLRRPTVASVL-
A0A7W4UQ09      ----I---RSFVVTSANAGEGKSTIATSLAQVLA-Q-SN-TPTILIDADLRRPTVATVL-
A0A2S5X9U6      ----I---RSIVVTSANAGEGKSTVSTSLAQVLA-Q-SN-TPTILIDADLRRPTVATVL-
A0A2S5ULV5      ----I---RSIVVTSANAGEGKSTVATSLAQVLA-Q-SN-TPTILIDADLRRPTVATVL-
A0A653YMF0      ----I---RSIVVTSANAGEGKSTVATSLAQVLA-Q-SN-TPTILIDADLRRPTVATVL-
A0A7V9H755      ----L---RTLVVTSASPGEGKTTTAANLAVSFA-Q-QG-MRVLLVDCDLRRARLHKLF-
A0A3Q9IY80      ----P---RIIVVTSPLPGDGKSTTSANLAITLA-A-NG-SKVVLIDGDLRRPMVATIF-
A0A0F0LP73      ----V---RVVMVTSANLGEGKSSTTRTLARVLA-E-SG-QRTLVIDGDLRRPTVAEGF-
A0A346Y185      ----G---QSVVLTSASPVDGKTVTCLNLAVASA-Q-DG-RDVVLVDADTRVRGLTRRL-
A0A7W0HGW1      ----P--ARRVLVTSPNQGDGKTTTSANLALSMA-N-SG-RRVVLIDCDLRRPRVHAVM-
A0A259S8H9      ----V---RVVMVTSANLGEGKSETTRALARVLA-E-SG-QRTLVIDGDLRRPTIAKGF-
A0A2W1Z497      ----P---KVLVVTSPLPGDGKSTIAANLARSLAVT-ST-GRVVLIDCDLRRPVLSAVF-
A0A0Q5L115      ----P---RVIVMTSPQPGDGKSTLAANLAESLAVS-SD-QRVVVIDCDLRRPTLSKVL-
A0A7G6YY64      ----P---RVIVMTSPQPGDGKSTLAANLAESLAVS-SD-QRVVVIDCDLRRPTLSKVL-
A0A7J5B4S5      ----I---RSMVITSSNAGEGKSTIATSLAQVLA-Q-SN-TPTILIDADLRRPTVASVL-
A0A852U976      ----I---RSMVITSSNAGEGKSTIATSLAQVLA-Q-SN-TPTILIDADLRRPTVASVL-
A0A1F1X071      ----P---RSIVVTSSAPGEGKSTVAANLARVMA-R-AG-QPTLLVDADLRRPMIAQQF-
A0A3R8RWC7      ----P---RSIVVTSSAPGEGKSTVAANLARVMA-R-AG-QPTLLVDADLRRPMIAQQF-
A0A4U0RJZ4      ----P---RSLVITSAVQSEGKSTVASNLARVLA-A-AG-QHVVLVDTDLRRPVIHETF-
A0A4R1FGL9      ----P---RSLVITSAVQSEGKSTVASNLARVLA-A-AG-QHVVLVDTDLRRPVIHETF-
E3B8H1          ----P---RSLVITSAVQSEGKSTVASNLARVLA-A-AG-QHVVLVDTDLRRPVIHETF-
A0A7D7WDT9      ----V---RVVMVTSANQGEGKSMTASSLARVIA-E-SG-ERTLIIDGDLRRPKVARNF-
A0A0Q5AWK6      ----T---RSVVITSANQAEGKSTIASGLARVTA-D-SG-QRTLLIDADLRRPTVAKML-
A0A6P1F176      ----T---RSVVITSANQAEGKSTIASGLARVMA-D-SG-QRTLLIDADLRRPTVAKLL-
A0A3N1NLD3      ----T---RSVVITSANQAEGKSTIASGLARVTA-D-SG-QRTLLIDADLRRPTVAKLL-
A0A3N2FVI8      ----T---RSVVITSANQAEGKSTIASGLARVMA-D-SG-QRTLLIDADLRRPTVAKLL-
A0A2S5XDQ6      ----T---RSVVITSANQAEGKSTIAAGLARVTA-E-SG-QRTLLVDADLRRPSVARML-
A0A2S5XNN6      ----T---RSVVITSANQAEGKSTIAAGLARVTA-E-SG-QRTLLVDADLRRPSVARML-
A0A5C8C085      ----P---RIIVVTSSKPGDGKSTVTANLAAAIA-A-SG-APVILVDGDLRRPTVASSF-
A0A4Y5YMQ6      ----I---GVLAVTSSIAGEGKTTMSVNTALAFA-E-MG-NRVLLVDADLRRPNVANVL-
A0A1E4BP96      ----P---RSIVVTSPLPGDGKSTTAANLAMSLA-A-AG-QRVVLIDGDLRQPVVASLF-
A0A7V9FXS6      ----N---DVIVVTSPAASDGKTTVAALLAEALG-R-LD-MKVLLIDADLRRPGVARFA-
A0A7W0PY69      ----I---RVLLVTSPGKAEGKTTVSALLAESLG-R-LG-MSVLLVDADLRRPRLAPLA-
A0A7W8YB99      ----P---RVVVITSSVPGEGKSSLSANLAVTIA-Q-TG-RDVIVVDGDLRRPVIAELF-
A0A1L2ZMQ6      ----P---RVIVVTSSVPGEGKSSLSANLAVTIA-H-TG-QKVIVVDGDLRRPVVSEMF-
A0A7W8TR75      ----P---RVIVVTSSVPGEGKSSLSANLAVTIA-Q-TG-QKVIVVDGDLRRPVISEMF-
A0A151BT98      ----V---PAVVVTSARPGDGKTTVAANLALAMA-R-DG-YRTVLVDGDLRKPGVGSAI-
A0A2Y8ZRF8      ----V---PAVVVTSARPGDGKTTVAANLALAMS-R-DG-HRTLLVDGDLRKPGVASAV-
A0A2R9UAT1      ----P---RVVVVTSPLPGDGKSTMSANLALAMA-A-SG-QQVVLIDGDLRRPMIAAIF-
A0A3E2DN22      ----P---RAVVVTSANPGEGKSTVSTHLAVVMA-Q-AG-EKVVLIDADMRRPVQHKAF-
A0A3Q9ULZ9      ----P---KAVVITSANPGEGKSTVGSYLARAVA-R-SG-QATVLVDADMRRPMQHTAF-
A0A3S9JFL2      ----P---KAVVVTSANPGEGKSTVCSYLARSVA-R-SG-QATVLVDADMRRPMQHTAF-
A0A3L8NYD3      ----P---QSIVITSANAGEGKSVVTANLARVLA-A-AG-QKTILLDGDLRRPMVSTIF-
A0A1M6K628      ----V---RSIVVTSPSQGEGKSTIAMQLAALLA-E-SG-EPTVLIDADLRRPRVAQLF-
A0A561E8R3      ----P---RSIVVTSPNPGEGKSTVAANLARVLA-A-AG-QPVVLIDADLRKPMVATIF-
A0A4Q5J5D7      ----P---RVIIITSPQQGDGKSTVAANLAGALA-V-SG-EPVILIDGDLRRPTVAEKF-
A0A1Y4CKD6      ----A---KVVLVTSSIAGEGKSTVAINLAEQLA-Q-DG-SRVLLVDMDLRSQGDGALL-
A0A0Q7KBQ4      ----V---ESILVSSAVPNEGKTLVATNLAMSMA-Q-SG-RSVLLIDADMRNPNVADLL-
A0A5Q5BFU2      ----P---RVIVLTSSVPHEGKSTTAINIALALA-E-AE-HNVVLVDGDMRRPMLHKYL-
A0A439DNZ6      ----P---RVIVVTSSMPGEGKSTTAINLALVLA-E-AE-HNVVLVDGDLRRPRLDKYL-
A0A7I7UD03      ----P---RVIIVTSSVPNEGKSTTAINIALALA-E-AE-HNVLLIDGDMRRPSLHQYL-
A0A7I7MI62      ----P---RVISVTSSMPHEGKSTTAINIALSLA-E-AE-HNVVLVDGDMRRPMLHKYL-
A0A0J6YE86      ----P---RVIVITSSMPHEGKSTTAINIALALA-E-AE-HNVVLVDGDMRRPTLSKYL-
A0A7I7K1R9      ----P---RVIVVTSSMPSEGKSTTAINIALALA-E-AE-HNVVLVDGDLRRPTAHKYL-
A0A7I9ZLK4      ----P---RVIVVTSSMPSEGKSTTAINIALALA-E-AE-HNVVLVDGDMRRPMLHKYL-
A0A1F1IHY9      ----V---SIVTVTSAHPGEGKSTVAANLAVPVA-E-SG-QRVVLVDGDLRRPVVAENF-
A0A7H2BCD6      ----P---KSVLITSSEPGEGKSTVASTLAQALA-E-AG-QPTIIIDADLRRPTVAKKF-
A0A3S0V9U6      ----P---RSIIVTSPNPGEGKSTVTSSLAHAFA-K-AG-QPTVLIDADLRRPTIAKIF-
A0A7T4T4U7      ----P---RSIIVSSPNPGEGKSTVSASLAHAFA-K-AG-QPTILIDADLRRPTQAKIF-
A0A1S2N0P2      ----P---RSIIVSSPNPGEGKSTVSASLAHAFA-K-AG-QPTILIDADLRRPTQAKIF-
A0A0Q3BEY5      ----P---RSIIVSSPNPGEGKSTVSASLAHAFA-K-AG-QPTILIDADLRRPTQAKIF-
A0A4R6Q3C6      ----P---RSIIVSSPNPGEGKSTVSASLAHAFA-K-AG-QPTILIDADLRRPTQAKIF-
A0A7T3CHP7      ----P---RSIIVSSPNPGEGKSTVSASLAHAFA-K-AG-QPTILIDADLRRPTQAKIF-
A0A7Y5U6C1      ----A---RTILVTSPMSNEGKSTTAANLAVAFA-R-AG-RHVLLVDLDLRRPTLDRFF-
A0A542HCT5      ----P---RIIVVTSPLPGDGKSTVAMNLAAALS-M-SD-RRVILIDGDLRRPVIADSF-
A0A537WNY9      ----L---RSVLITSPEGSHGKTTISYGLAVTLA-R-AG-TSTLLVDGDLRRGRISEMM-
A0A5B8M469      ----V---RCVVVTSPNQSEGKSTVAARLAAVIA-E-SG-QPTLIIDADLRRPSVARQF-
A0A2S8WHZ8      ----P---RIIVVSSSVPGEGKSSVTANLAVAIA-S-TG-RNVVLIDADLRRPVQTELF-
A0A1Y4CTD2      ----F---KTVLVASVEENEGKSTVAANLAAALA-E-RG-RRVLLIDGDFRKPAQRRIFD
A0A3N3ZPU0      ----P---RTVVVTSSVAGEGKSSVAANLAVTLG-A-LG-QPTVLVDADLRRPVQTELF-
A0A359IQX7      ----P---KCIVVTSANASEGKSTVAANLARVLA-E-SG-QITLLVDADLRRPSQHRTF-
A0A7W9IKV0      ----P---RSLVVTSCLPGEGKSSTSANLAITLA-Q-AG-RRVILVDGDLRRPSIPGYL-
A0A1N7E3F1      ----P---KSLVVTSCLPGEGKSSTSVNLAITMA-Q-AG-WRVVLVDADLRRPSVPRYL-
A0A544ZKQ1      ----P---KSLVVTSCLPGEGKSSTSANLAITMA-Q-AG-WRVVLVDADLRRPSVPRYL-
A0A5D0Q2X0      ----P---KSLVVTSCLPGEGKSSTSANLAITMA-Q-AG-WRVVLVDADLRRPSVPRYL-
A0A5R8Z2E7      ----P---KSLVVTSCLPGEGKSSTSANLAITMA-Q-AG-WRVVLVDADLRRPSVPRYL-
A0A0Q9LZR0      ----P---RIIVITSPLPGDGKSTVAMNLAAALS-M-SD-RRVVLIDGDLRRPVVAESF-
A0A1F1J417      ----P---SSFIVTSAVPGEGKSTVSLAVARSMA-S-SG-QPVILIDADLRRPTVAKKL-
A0A2A8D6P2      ----P---SSFIVTSAVPGEGKSTVSLAVARSMA-S-SG-QPVILIDADLRRPTVAKKL-
A0A1F0THV9      ----P---SSFIVTSAVPGEGKSTVSLAVARSMA-S-SG-QPVILIDADLRRPTVAKKL-
A0A5F0M6Y0      ----P---SSFIVTSAVPGEGKSTVSLAVARSMA-S-SG-QPVILIDADLRRPTVAKKL-
E3H5W1          ----P---SSFIVTSAVPGEGKSTVSLAVARSMA-S-SG-QPVILIDADLRRPTVAKKL-
A0A1F1QKB0      ----P---SSFIVTSAVPGEGKSTVSLAVARSMA-S-SG-QPVILIDADLRRPTVAKKL-
A0A509JY23      ----P---SSFIVTSAVPGEGKSTVSLAVARSMA-S-SG-QPVILIDADLRRPTVAKKL-
A0A448USF4      ----P---SSFIVTSAVPGEGKSTVSLAVARSMA-S-SG-QPVILIDADLRRPTVAKKL-
A0A7Z9A2N0      ----P---RSFLVTSAVPSEGKSTVSLSLARSMA-E-SG-QAVILIDADLRRPTLAKKL-
A0A433EDP2      ----P---RSFLVTSAVPSEGKSTVSLSLARSMA-E-SG-QAVILIDADLRRPTLAKKL-
A0A231VTW0      ----P---RSFLVTSAVPSEGKSTVSLSLARSMA-E-SG-QAVILIDADLRRPTLAKKL-
A0A433ECD0      ----P---RSFLVTSAVPSEGKSTVSLSLARSMA-E-SG-QAVILIDADLRRPTLAKKL-
A0A7T9UPU8      ----P---RSFLVTSAVPSEGKSTVSLSLARSMA-E-SG-QAVILIDADLRRPTLAKKL-
U7V3Z1          ----P---RSFLVTSAVPSEGKSTVSLSLARSMA-E-SG-QAVILIDADLRRPTLAKKL-
A0A6I3F378      ----L---KVLQVTSAMPGEGKTTTTANLAIVLA-N-AG-ALVLIVDGDLRRPRIHTMF-
A0A838H0S5      ----G---STVLITSGGPGAGKTVTAMNLAVAAV-R-DG-RRTVLVDADERMRGLTRTS-
A0A1S1CQC5      ----P---RSFIVTSAVPGEGKSTVSLSLARSLA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1E9T6I0      ----P---RSFIVTSAVPGEGKSTVSLSLARSLA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1F1GHA7      ----P---RSFIVTSAVPGEGKSTVSLSLARSLA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1S1CAD0      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
G5ET14          ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1E9DXX2      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1E8S156      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1E8S5S2      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1S1DFA8      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A2I1Z490      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1F0DAA9      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1F0PHK9      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1F0VZG6      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1E9G8X4      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1E9IAW2      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1E9ZBC9      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1E9ZDP4      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1F0R6B5      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1F0Z7N5      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1F1D897      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
D2NP38          ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1F1FV74      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1E9M791      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A291DEI8      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1S1D5T1      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1E8TRD6      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1F0XT88      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1F1EVP5      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
C6R548          ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A0K2RXS2      ----P---RSFIVTSAVPGEGKSTVSLSLARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A1F0KX60      ----P---RSFIVTSAVPGEGKSTVSLALARAMA-D-AG-SPVILIDADLRRPTVAKKL-
A0A542I3V2      ----P---RIILVTSPMTSDGKSTVTGNLAVTMA-A-TG-EPVVVVDGDLRRPRIAGAF-
A0A2T0UZ65      ----P---QSIVVTSASPSEGKSTVSSTLASIIA-E-DG-RPVVIIDADLRRPNIANIL-
A0A0Q5M6Z7      ----P---KVIVVTSSIPGEGKSTLTANLADAIA-S-AN-SNVVVIDCDLRRPMQSTLF-
A0A7G6YA19      ----P---KVIVVTSSIPGEGKSTLTANLADAIA-S-GN-ANVVIIDCDLRRPMQSTLY-
A0A853CXS3      ----P---KVIVVTSSIPGEGKSTLTANLADAIA-S-SN-QNVVIIDCDLRRPMQSTLF-
A0A7W8YB56      ----P---RVIVVTSALAGEGKSSIAANLAVAIS-Q-SG-NNVVLIDADLRRSVQTDLF-
A0A1L2ZMV4      ----P---RIIVVTSALAGEGKSSIAANLAVTIA-Q-SG-SKVILIDADLRRSVQTDIF-
A0A7W8TSW5      ----P---RIIVVTSALAGEGKSSIAANLAVTIA-Q-SG-SKVVLIDADLRRSVQTDIF-
A0A1R4JTI6      ----P---RIIVVTSAAPAEGKSTVAANAAITLA-Q-SD-VPTVLVDADLRRPTVAGSF-
A0A4R7TM52      ----P---RIIVVTSPLPGDGKSTTSANLAIILA-A-SG-QRVVLVDGDLRRPMVASVF-
A0A542XE74      ----P---RSVVVTSPAPGDGKSTIAAQLARLMA-V-AG-QPVVLIDCDLRRPTQGDQF-
A0A0Q7QDF6      ----S---NVYVVTSSVAGEGKTTTASNLAISLA-Q-SG-QNVVLVDGDLRRPRLHEVF-
A0A7X7XPM3      ---GK---HSFVVTSPMAGEGKTTVAANLALAVA-S-TD-TRVLLVDGDLRNPSVADTL-
A0A5R8L819      ----P---RILVVTSPLPGDGKSTTSANLAVTLA-A-SG-QPVVLVDADLRRPMLANIF-
A0A7K0PFV4      ----C---RRILVTSASSGDGKTTAVLNLAFALV-S-AG-HRVVLVDFDLRKPDLGRQL-
A0A0G3V3F3      ----P---RTVAVVSNTQDAGKSFISINLAQSAS-A-LD-DKVVLIDADLRRPTIHEQL-
A0A7K0MUQ7      ----P---RTVAVVSNTQDAGKSFISINLAQSAS-A-LD-DKVVLIDADLRRPTIHERL-
A0A7K0U619      ----P---RTVAVVSNTQDAGKSFVSINLAQSAS-A-LD-DKVVLIDADLRRPTIHERL-
A0A6I3DFP2      ----P---RTVAVVSNTQDAGKSFVSINLAQSAS-A-LD-DKVVLIDADLRRPTIHERL-
A0A7K0SI36      ----P---RTVAVVSNTQDAGKSFVSINLAQSAS-A-LD-DKVVLIDADLRRPTIHERL-
A0A7K0V140      ----P---RTVAVVSNTQDAGKSFVSINLAQSAS-A-LD-DKVVLIDADLRRPTIHERL-
A0A261FQA1      DM--S---NVIVVASSDASEGKTTIAVNLAAAIA-E-RG-RTVLLIDTDLRKPSMAGVL-
A0A1Q2CJ92      ----A---KSIVITSSNEGEGKSTLAANIAAMFA-D-AG-EPTVLIDADLRRPVQAERL-
A0A2T0S3C8      ----V---KTLVITSAMPGEGKSSTACTLAGLFA-E-AG-QRVLLIDADLRRPRIADYL-
A0A810MDE3      ----V---KTLVITSAMPGEGKSSTACTLAGLFA-E-AG-QRVLLIDADLRRPRIADYL-
A0A4Y8WZJ3      ----V---SIVTVTSAHPGEGKSTVAANLAVTVA-E-SG-QRVVLVDGDLRRPVVAENF-
A0A7X0KT97      ----P---RVLVVTSPLPSDGKSTIAANLALTLA-A-SG-QSVVLVDGDLRRSTVAKTM-
A0A853DGU7      ----P---KAIVVTSPNPGEGKSTVASTLARVLA-D-AG-TPTVLIDADLRRPTVAEVY-
A0A7Z0A2Z7      ----A---GVLLITSSVPKEGKSTVAADLALAFV-E-TG-SRVLLIDGDLRRPAIADLF-
A0A285VUW0      ---AG---HSFVVTSSLSAEGKTTTVVNLGMAMA-E-SG-RRVLVLDADLRHPSVASEL-
A0A849PJI9      ----P---RSIVITSANPGEGKSTVSANLARVLA-E-AG-QPVVLVDADLRKPMAATIF-
A0A2R7Z032      ----P---RRIVITSALASEGKSTVSSNLARLVA-Q-AG-EKVVLIDADLRRPMLATTF-
A0A6J4MTQ2      ----P---RRIVITSALAGEGKSTVSANLARLVA-H-AG-ESVVLVDADLRRPMLATTF-
A0A1I0W453      ----P---RKIVVTSALAGEGKSTVSSNIARLVA-Q-AG-TPVLLIDADLRRPMIATTF-
A0A0Q6VV12      ----P---RKIVVTSALAGEGKSTVSANIARLVA-Q-AG-TPVLLIDADLRRPQIATTF-
A0A495NTA9      ----P---RKIVVTSALAGEGKSTVSSNIARLVA-Q-AG-TPVLLIDADLRRPMIASTF-
A0A1H4LCS9      ----P---RRIVVTSALAGEGKSTVSSNIGRLVA-Q-AG-TPVLLIDADLRRPQIASTF-
A0A4Q2RZP8      ----P---RRIVVTSALAGEGKSTVSSNIARLVA-Q-AG-TPVLLIDADLRRPMIASTF-
A0A0Q9QB08      ----P---RRIVVTSALAGEGKSTVSSNVARLVA-Q-AG-TPVLLIDADLRRPMIATTF-
A0A7Y9H290      ----P---RRIVVTSALAGEGKSTVSANIARLMA-Q-AG-TPVLLIDADLRRPQIAATF-
A0A4Q2SA86      ----P---RRIVVTSALAGEGKSTVSANIARLVA-H-AG-TPVLLIDADLRRPMLATTF-
A0A4Z1C3Z0      ----P---RRIVVTSALAGEGKSTVSANIARLVA-Q-AG-TPVLLIDADLRRPMLATTF-
A0A6V8KDX4      ----V---RTLVVTSAVPGEGKSTTAVNTAITFA-Q-AD-KRVLLIDADLRRPKVAEYL-
A0A444BL03      ----P---RSIVVTSANAHEGKSTVSSTLARVLG-E-AG-QRVVIVDADLRRPTLAKVF-
A0A7V9PCQ0      ----P---TAIAVASWSAGEGKSTVAAGLALSMA-A-IG-RDVVVIDADLRRPTQHDRL-
A0A4Y8X357      ----P---RVVMVTSSNPGEGKSTVIGSLAQAVA-A-SG-QPVILIDADLRRPRQAGQF-
R4LD52          ----V---KTLVVTSAVPGEGKSSTACGIAMLFA-Q-AG-QRVLIVDADLRRPRIAEYL-
A0A4T2CD79      ----P---RIIVISSPSPNDGKSTVTANLAVALS-A-AG-QKVVVVDGDLRKPMVASTF-
A0A6L6AM03      ----P---RRIVVTSALAGEGKSTVSSNIARLVA-Q-AG-TPVLLIDADLRRPMIATTF-
A0A4Q2RU39      ----P---RKIVVTSALPGEGKSTVSANIARLVA-Q-AG-TKVLLIDADLRRPMIATTF-
A0A4Q2SK58      ----P---RKIVVTSALPGEGKSTVSANIARLVA-Q-AG-TPVLLIDADLRRPMIATTF-
A0A2N3YJR1      ----P---RSIVVTSANAGEGKSTVSATLARVLG-Q-SG-QSVVIVDADLRRPTLAKVF-
A0A6G8FYB9      ----A---RSIVVTSANAGEGKSTVAATLARVLG-A-SG-QSVVIIDADLRRPTLAKVF-
A0A4Q4D742      ----R---QAILVSSALPNEGKTLTATNLAISMA-Q-SG-RSVLLIDADMRNPNVAELL-
A0A1C6T1J1      ----A---RVIAVTSALQGEGKTTMSCNLAIALA-E-AG-WRVLLVDADLRRPKVADYL-
A0A2W2CFC8      ----A---RVIAITSALQGEGKTTLSCNLAITLA-E-AG-WRVLLVDADLRRSKVGDYL-
A0A2W2A4B0      ---GA---RTLAITSSRPSEGKTTTAANLAVALA-E-SG-LRTVVIDADLRRPNLANVF-
A0A4Y9MDA5      DREGG---RVTAITSSRPGEGKSTVAVDLAAALA-E-TG-ARVLLVDADLRRPAIAERL-
A0A1H7N9P7      ERAGA---RIVAVTSSRSGEGKSTVAVELAAALA-E-TG-TRVLLVDADLRRPTIADRL-
A0A1M7V0F8      DQGGA---RVLAVTSSRPGEGKSTVAVNLAAALA-E-TG-ARVLLVDADLRRPAIADRL-
A0A1M3LEY6      ----P---RSFVVTSSVPSEGKSTTSANLAIVMA-Q-SG-ARVLLIDGDLRSPSVADLF-
A0A538AJI7      ----I---DLIVVSSPAPADGKTTVTTLLGEALS-R-LG-MRVLLIDGDLRRPGFARIM-
A0A538AM15      ----L---RIVAVSSPGVGDGKTTTAINLAGALA-Q-ASEARVLLVDADLRRPSVARLL-
A0A520EHH5      ----P--PRILLVTSCIAGEGKSTTAVNLALSLA-E-SG-NRVVLVDADLRRPHIADYL-
A0A4R0U4F1      ----PL-SNVIVVTSAGPSEGKTTLSVNLATAFA-E-NG-SKVLLIDADVRNPSVSKAL-
A0A1V8PLV6      ---------MIVISSVEPSEGKTTVSVNVAAALA-E-NG-AKVLLIDADLRHPSVADHI-
A0A357ZCV8      ----P--IKSIAITSSVPNEGKSTIALSLAQAIA-T-SG-QTVLVVDTDMRRRSLAHYM-
A0A419GS64      ----E--IGSVVVTSPDRGEGKSTICANLAIVMA-Q-AE-KRVLLIDCDLRLPTQHELF-
A0A4R1CW45      ----K--IRLVGVTSASPAAGKSFLAVNLAASLS-RVLK-VPTFLVDLDLRRGCVAEEL-
A0A4R5Z7B0      ----E--LKVLMVTSSGPGEGKSTTAANLAVVFA-Q-LG-KKVLLVDADLRKPTVHRSF-
A0A542H054      ----H--IRSIVVTSSGPGEGKSTTAANLAVVFA-Q-EG-KNVLLVDGDMRKPTSHYTF-
A0A6M8GFV5      ----K--VKSILVTSSEPSEGKTTTIANLAVTYA-Q-QG-KKVLLVDADLRKPQLHTDF-
A0A7G8U6J2      ----E--IKTIVVTSSEPNDGKSTTAANLAIVLA-Q-DE-KKVLLVDADLRKPSVHYAF-
A0A2S8MDM2      ----P--PRVLVVTSSVPSEGKSTTAINLALALA-E-AD-HKVLLVDGDMRRPSLHQYL-
A0A357ZDL3      ----P--VKTIAITSSVPNEGKSTIALNLAQAIA-G-SG-KTVLLVDTDLRRRSLAMYL-
A0A1I6GVG4      ----P--PRIIVVTSPLPGDGKSTISSNLAVTLA-S-SG-QPVVLIDGDLRRPMVDTVF-
A0A1I6IST1      ----P--PRIIVVTSPLPGDGKSTISSNLAVTLA-S-SG-QPVVLIDGDLRRPMVDTVF-
A0A412JBM5      ----GDPCTTFLVTSGSPSEGKSLTAANTAISFA-M-LG-KKTLLVDADVRKPSQQRLW-
A0A6J4SUA1      ----G--PVVLAVTSPGMGDGKSFVSSNLAMSFA-E-AG-HRTLLIDGDIRRGEQHATF-
A0A1C2B334      ----A--SRRILVTSASVAEGKTTTAINVAASLA-E-YG-HRVVLVDADLRRPTVAKRL-
R7Y679          ----S--VRKILISSPSQSEGKTTTSLNLAASLA-E-LG-KSVVLVDADLRRPAVASRL-
A0A4Y8ZIU8      ----P--PRTIAFTSANPGEGKSTVIGSLAVAVA-A-SG-QPVILIDADLRRPRQALQF-
A0A0F0KYJ9      ----P--PRIIVVTSPLPGDGKSTISSNLAVTLA-S-SG-QPVVLIDGDLRRPMIGTVF-
A0A838H149      ----P--IQTLLVTSSIPGEGKTVTAANLAVVFA-Q-AG-RQVLLVDADLRKPGIHVIF-
A0A7M2YYB9      ----V--RRPVVFTSADPAEGKSIIAANYAFVAA-Q-TD-RRVLLVDADMRKPTLHKLF-
A0A7K0LE65      ----R--PRTVAVVSNTQDAGKSFISINLAQSAS-A-LD-DKVVLIDADLRRPTIHERL-
A0A838JYQ6      ----P--PRVILLTSPGRREGKSITCANLGVVLA-Q-VG-KSVLIVDCDLRKPAVHDVF-
A0A510HHA8      ----P--PRVISLTSPGPTEGKSTVCANLGVVLA-Q-AN-KSTLLIDGDLRRPSLHAIF-
A0A6G8Q9J3      ----P--PKVILLTSPGSREGKSTICANLGVALA-Q-AD-RATLVIDCDLRGPTLHGIF-
A0A538BBM6      ----E--NPIVIVTSPNAGEGKTSTCVPLAQSLA-Q-AG-SRVVLVDLDLRHPDAHRLL-
A0A5Q2F9A3      ----G--GNSFVITSSVPDEGKTSTAINTALVLA-D-AG-LRVLLIDADMRRPRVGQSL-
A0A0K8Q3D9      -----------MVTSSMQAEGKSTVTANLAVTMA-A-AG-ENVVVVDGDLRRPTLTDVF-
A0A2R7RCA1      ----P--PRIIVVTSSVQAEGKSTVTANLAVTLA-A-AG-ENVVVVDGDLRRPTLVDVF-
A0A1Q7WJN6      ----G--PLLVSITSPGRSDGKSFVASNLALAFA-S-VG-YRTLLIDGDVRRGGLHRIL-
A0A1E2SNF6      ----------------MPSEGKSTLSANLAVTIA-R-GG-QPVVVVDADMRHPTQGKTF-
Q6ADE8          ----------------MPSEGKSTLSANLAVTIA-R-GG-QPVVVVDADMRHPTQGKTF-
A0A1Q7CZ24      ----N--LQVVAVTSPGVGDGKTTTAINLAGSLA-QAAD-ARVLLVDMDLRRPAVAGQL-
A0A2W6VLC6      -------PTTFVITSSVPGEGKTSSGINIARALA-D-VG-THTLLVDADLRRPKTDVYL-
A0A519G798      ----R--PRALVITSAVPSEGKTSTATNLAIALA-Q-TG-LRVLLVDGDLRRPKVASVL-
A0A7V8X3I0      ----A--NPIVVITSAQAGEGKTSTCAGLATALA-S-TG-RRVVVVDFDLRRPDLHKHL-
A0A7V8YPJ0      ----A--NPSVIVTSAYAREGKTSMCVNLAESLA-A-AG-PRVVLVDLDLRNPDSHRLL-
A0A7X7Q7T7      ----R--RSSMVVTSSVAGEGKTETATNLARVLA-L-AG-ERVLLIDADLRRPQVADRL-
A0A6G8QDQ0      ----P--PKVVVVTSPGPKEGKSTTCANLGVVLA-Q-AD-KSTLIIDCDFRRPAMHQVF-
A0A023X491      ----P--PHVVAVTSPGQQEGKSTTCANLAVTLA-Q-AE-KSVLLLDCDLRKPVVHSIF-
A0A4R1BMZ2      ----P--LKVVTFTSPGPGEGKSTTCANLGVVLA-Q-AN-KNTLILDCDFRRPVMHRFF-
A0A838JNW7      ----P--PKLIMVSSPGPMEGKSTTSANLGVVLA-Q-AN-KSTLLVDCDLRKPIIHKIF-
                                    **:      .             .::* * *         

A0A519GXS6      -------------GLE-NAVG---LTSVL--VES-I-AVEDAI--I--------ATATG-
A0A6N6NKS9      -------------GIH-TECG---LYSVL--VGQ-A-PLKSAI--Y--------PTDRP-
A0A538BYZ4      ----------GL-GGR-QSPG---LVDAI--LKP-ALALEDVT--Q--------LCPSF-
A0A348NU28      -------------GLE-GSVG---LTTVL--LGD-V-SIEDAR-MT--------RPGST-
A0A2N4T4Q5      -------------GLV-PGVG---ITDVL--VGE-A-EVDDVL--Q--------VYDKF-
A0A4Q5APW3      -------------DID-GSAG---LTHVL--SGQ-A-SVKDVV--Q--------RYWKP-
A0A4Q5B0V3      -------------DID-GSAG---LTHVL--SGQ-A-SVKDVV--Q--------RYWKP-
A0A022KX11      -------------GME-GSVG---LTTLL--LGD-A-DLDDVI--Q--------TWGSA-
A0A4Q5A868      -------------DID-GSAG---LTHVL--SGQ-A-SVKDVV--Q--------RYWKP-
A0A6N4VXX3      -------------KLD-GSVG---LSTVL--SGA-V-PLSEAL--Q--------QTRFS-
A0A1H4I042      -------------NVD-GAVG---LSTVL--SGA-V-SLSDAL--Q--------ETQFS-
A0A4R7A6D9      -------------NVD-GAVG---LSTVL--SGA-V-SLSDAL--Q--------ETQFS-
A0A345NSU7      -------------GLE-GGVG---LTTVL--LGD-A-DVHDVV--Q--------PWGGN-
A0A222TG79      -------------GVN-PDIG---FTDFL--SGR-A-ALEDVL--Q--------STSFS-
A0A0W8I9Y2      -------------GLV-PGVG---VTDVL--TGQ-V-QVDEVL--Q--------TYDKF-
A0A7C6LSF9      -------------DVP-QGAG---ISDFLYDPSS-T-QLAALA--R--------PTSVP-
A0A255G8R8      -------------GLV-GTAG---LSTIL--AGQ-A-TLSDLV--Q--------PFSGH-
A0A6G7Y423      -------------GLD-GALG---LSHIL--TGR-G-TLDGLA--I--------R-TEP-
A0A4Q4D4T1      -------------GAE-QNVG---LTSVL--VGK-V-PLDSAV--Q--------GTDVP-
A0A1Q2CRV2      -------------QLE-GAVG---LTTVL--IGD-A-RLGDVV--Q--------PYGRT-
A0A261FE22      -------------GIS-NGVG---LMQML--TNQ-V-DAQTAV--Q--------QYWKP-
A0A7K0NRJ7      -------------SVP-RTPG---LTSVLLGS-----DLSEAL--R--------KVAES-
K6WHS4          -------------NLT-GSVG---LTTIL--STG-A-TLTDCI--Q--------HSSVA-
A0A7K0NTR2      -------------SNI-TTPN---LSDLPHLATS-S-DLEGIL--Q--------ETGIP-
A0A1H6WL79      -------------DVL-PDVG---VTDIL--SGR-A-SIDDVL--Q--------EWGPN-
A0A101LAM5      -------------GVL-PDVG---VTDVL--SGR-A-SIDDVL--Q--------EWGPN-
A0A4Y3NEG0      -------------GVL-PDVG---VTDIL--SAR-A-SIDEVL--Q--------EWGPN-
A0A1Q2CI19      -------------DVP-QGAG---VSDLLVDGQG---SLNSVI--R--------PTNIP-
A0A512T3M3      -------------DVP-QGAG---ISDYLTDPDF-G-PLSNLV--R--------PTNLP-
W6JTW4          -------------DVP-QGAG---ISDYLVDSAL-E-HLQQLV--R--------PTNMP-
A0A839J1M0      -------------DVP-QGAG---ISDYLTGRGT-V-ELADIV--R--------PTSVD-
A0A8A4Z8K4      -------------DVP-QGAG---ISDYLTGRGT-V-ELADIV--R--------PTSVD-
A0A0A0JTY0      -------------DVP-QGAG---ISDYLSDVSG-DASLASLM--R--------PTSVP-
A0A0A0JXF2      -------------DVP-QGAG---ISDYLSD-PG-GTSLETVV--R--------PTSVP-
E6S8H2          -------------DVP-QGAG---ISDYLTGPDD-T-PLGSLI--R--------PTNVP-
A0A0A0JGH0      -------------DVP-QGAG---ISDYISDNED-T-PLEALI--R--------PTNVP-
N0E4U7          -------------DVP-QGAG---ISDFITDPGD-V-PLEALV--R--------PTSVP-
A0A0A0IYK2      -------------DVP-QGAG---ISDFLSDPSD-DASLGSVV--R--------PTSVP-
A0A0Q9L0H3      -------------DVP-QGAG---ISDYLSDPSD-GAALDAVV--R--------PTSVP-
A3TMK0          -------------DVP-QGAG---ISDYLTDPGE-G-SLSAVV--R--------PTSVP-
A0A543PXP1      -------------DVP-QGAG---LSDYLSRPED-A-SLEALI--R--------PTSIP-
A3TMH6          -------------DVP-QGAG---ISDYLSRHNE-S-SLEALI--R--------PTSID-
A0A6I2XCV4      -------------------------------API-P-DLEHPT--N--------PQPTR-
A0A5R8VLL6      -------------DVV-PGIG---ITDVL--TGK-A-EVDDVL--Q--------QRGDL-
A0A3L7ADK2      -------------NAV-EGAG---LTDVL--SGR-A-ELQQVI--Q--------PCGDS-
A0A538JQF8      -------------GVQ-VEPG---LSDVL--SGS-P-DAPSLA--D--------VAQDT-
A0A1H6YPK1      -------------GVS-PEAG---LTSVL--ASQ-A-SIEEVT--Q--------QVGDS-
A0A0Q9TBP0      -------------GLG-DPPG---LSDLL--VSE-E-DPSSYL--I--------DIGVD-
A0A0G3V3M7      -------------SGA-TTPN---LTDIPHQGTA-A-DVLAVA--Q--------ETGIP-
A0A6I3DD56      -------------SGA-TSPN---LTDIPYQGTA-A-DVSAVA--Q--------ETGVP-
A0A5Q2FA83      -------------GLE-GNVG---LTTVL--LGR-A-TVAEAA--Q--------KWGDS-
A0A2R7MGI0      -------------GFS-DDVG---LSDVL--AAR-A-QIEQVA--H--------QVDEE-
A0A2T7WQY4      -------------GFS-DDVG---LSDVL--ASR-A-QIEQVA--H--------QVDDH-
A0A0Q5Q5L3      -------------GFS-DDVG---LSDVL--AGR-A-QIEQVA--H--------QVDEH-
A0A0Q6DVM4      -------------GFS-DDVG---LSDVL--AGR-A-QIEQVA--H--------QVDEH-
A0A1N7DLV3      -------------GFS-DDVG---LSDVL--AGR-A-RIEQVA--H--------QVDEN-
A0A1V2NSB5      -------------GFS-DDVG---LSDVL--AGR-A-RIEQVA--H--------QVDEH-
A0A1R3WWR6      -------------GFS-DDVG---LSDVL--AGR-A-QIEQVA--H--------QVDEN-
A0A1G6GTN3      -------------GFS-DDVG---LSDVL--AGR-A-QIEQVA--R--------QVDQN-
A0A7W5GFA5      -------------GFS-DDVG---LSDVL--AGR-A-QIEQVA--H--------QVDEH-
A0A2S5WZJ5      -------------GID-GKIG---LSEVL--SGQ-V-SLEDAL--V--------ASKIP-
A0A0Q5JKD6      -------------GFS-DDVG---LSDVL--AGR-A-QIEQVA--H--------QVDEH-
A0A2W6DK08      -------------GVS-PGTG---LSNLLRSTTT-V-DLSLHV--R--------QSDIP-
A0A346XTB0      -------------GAD-DRVG---LSDLA--AMD-M-EPNEVL--R--------RYKFS-
A0A542FTE6      -------------EKE-GAVG---LTDVL--AGR-A-TPADVA--Q--------RVPGN-
A0A7Y9QM02      -------------EKE-GAVG---LTDVL--AGR-A-SAADVA--Q--------RVPGN-
A0A6I1G2U1      -------------DVP-QGAG---ISDFLYDPAS-T-RLEALA--R--------PTSVP-
A0A351ETF8      -------------GVS-NSVG---LSDVL--AGE-A-TRRDAR--Q--------VFERD-
A0A349B7N2      ----------PEADVG-RGNG---LAPV----DA-P-DVSGLI--G--------RSHIP-
A0A4Q2JUT1      -------------GLP-SGAG---LSDVL--AGR-A-ALSEVL--Q--------RTPKS-
A0A6L5R0V7      -------------GLP-SGAG---LSDVL--AGR-A-ALSEVL--Q--------RTPKS-
A0A2S0LQ32      -------------DID-GSVG---LTQVL--AGD-V-PVSDVA--Q--------FVKGH-
A0A7T8DZN6      -------------DID-GSVG---LTQVL--AGD-V-PVSDVA--Q--------FVKGH-
A0A2N6V1R5      -------------GLD-GSVG---LTQIL--AGD-M-QLSDVA--Q--------KIEGQ-
G9PHS6          -------------GLD-GSVG---LTQIL--AGD-M-QLSDVA--Q--------KIEGQ-
U1PLM7          -------------GLD-GSVG---LTQIL--AGD-M-QLSDVA--Q--------KIEGQ-
A0A4V1VGV9      -------------DLE-NLVG---LTEVL--TGQ-A-PLASAI--Q--------QGDHK-
A0A2S5UYV0      -------------GID-GSVG---LSEVL--SGQ-V-SLEDAL--T--------ATKTP-
A0A7W4UQ09      -------------GID-GKVG---LSEVL--SGQ-V-SLEDAL--V--------ASKIP-
A0A2S5X9U6      -------------GID-GKIG---LSEVL--SGQ-V-SLEDAL--V--------GSKIP-
A0A2S5ULV5      -------------GID-GKIG---LSEVL--SGQ-V-SLEDAL--V--------GSKIP-
A0A653YMF0      -------------GID-GKIG---LSEVL--SGQ-V-SLEDAL--V--------GSKIP-
A0A7V9H755      -------------DMS-REPG---LTDLV--LGL-N-DADAVC--R--------QTSVT-
A0A3Q9IY80      -------------RLV-DGVG---VTDVL--AGR-A-TVEDVA--Q--------RVGRK-
A0A0F0LP73      -------------DLD-GTVG---LSEVL--SGQ-M-PIGPAI--R--------QTSDP-
A0A346Y185      -------------GAK-DTGG---LPALA--DPR-N-NLSEII--V--------PLTAD-
A0A7W0HGW1      -------------GVS-NDVG---LVSVA--RDG-A-PLQDAL--R--------TVDLP-
A0A259S8H9      -------------EID-EAIG---LSEVL--SGQ-V-PIGSAI--R--------RTEEA-
A0A2W1Z497      -------------GVA-RGAG---LTDVL--SGR-A-DLADVM--Q--------QTDDV-
A0A0Q5L115      -------------GVS-EGAG---LTDVL--SGR-A-QLHQVM--Q--------QTEAA-
A0A7G6YY64      -------------GVS-EGAG---LTDVL--SGR-A-QLHQVM--Q--------QTEAA-
A0A7J5B4S5      -------------GID-GSVG---LSEVL--SGQ-I-SLEDAL--T--------ATKTP-
A0A852U976      -------------GID-GSIG---LSEVL--SGQ-V-SLEDAL--T--------ATKTP-
A0A1F1X071      -------------SVD-GEVG---LSQLL--AAS-V-SLEDVA--E--------PTTVP-
A0A3R8RWC7      -------------SVD-GEVG---LSQLL--AAS-V-SLEDVA--E--------PTTVP-
A0A4U0RJZ4      -------------DVD-NAVG---LTEVL--TGQ-A-SLRQAI--Q--------PGDHK-
A0A4R1FGL9      -------------DVD-NAVG---LTEVL--TGQ-A-SLRQAI--Q--------PGDHK-
E3B8H1          -------------DVD-NAVG---LTEVL--TGQ-A-SLRQAI--Q--------PGDHK-
A0A7D7WDT9      -------------GLE-GTVG---LSEVL--SGQ-I-TVRDAV--Q--------STDAA-
A0A0Q5AWK6      -------------GID-GAVG---LSEVL--SHQ-I-PVEDAI--R--------PTGTE-
A0A6P1F176      -------------GID-GAVG---LSEVL--SHQ-I-PVEDAI--R--------PTATE-
A0A3N1NLD3      -------------GID-GAVG---LSEVL--SHQ-I-PVEDAI--R--------PTATE-
A0A3N2FVI8      -------------GID-GAVG---LSEVL--SHQ-I-PVEDAI--R--------PTATE-
A0A2S5XDQ6      -------------DID-GAIG---LSEVL--SHQ-I-PVDDAI--R--------PTGTA-
A0A2S5XNN6      -------------DID-GAIG---LSEVL--SHQ-I-PVDDAI--R--------PTGTA-
A0A5C8C085      ----------GL---V-EGVG---LTDVL--VGR-A-SIDDVL--Q--------QHHEL-
A0A4Y5YMQ6      ----------GL---E-NAVG---LASVL--VDA-V-TFDDAV------------ISTA-
A0A1E4BP96      ----------DL---P-EGAG---LTDIL--AGR-A-TTGDVV--Q--------PVQGS-
A0A7V9FXS6      ----------RI---R-PEHG---LSTLL--RGE-H-PFGRAV--Q--------QGWSE-
A0A7W0PY69      ----------QV---D-GRPG---LSDIL--RDR-V-PLERGV--H--------PGWST-
A0A7W8YB99      ----------SL---P-GDAG---LTDVL--AGQ-A-DLEDVL--Q--------DFGPI-
A0A1L2ZMQ6      ----------SL---P-GDAG---LTDVL--AGQ-A-ELDDVL--Q--------DFEPV-
A0A7W8TR75      ----------SL---P-GDAG---LTDVL--AGQ-A-ELDDVL--Q--------DFEPV-
A0A151BT98      ----------GI---D-GSVG---LTNVL--VHE-V-GLKDVLVEP--------EPSLP-
A0A2Y8ZRF8      ----------GI---D-GSVG---LTNVL--VHE-L-ALKDVLVEP--------EPSLP-
A0A2R9UAT1      ----------GL---V-EGAG---VTDIL--AGR-A-EVDDVA--Q--------TFGHL-
A0A3E2DN22      ----------GA---E-AGVG---LSQVL--AGD-V-TLDDAL--M--------RTETK-
A0A3Q9ULZ9      ----------GI---D-SRVG---LSQVL--AGD-V-SLSDAL--T--------PTDVP-
A0A3S9JFL2      ----------SI---D-SHVG---LSQVL--AGD-V-SLEDAL--N--------PTDVP-
A0A3L8NYD3      ----------EL---D-PVVG---LTQVL--AGD-I-DLRATI--Q--------DPGLP-
A0A1M6K628      ----------GI---D-GAVG---LTQVV--AGS-L-TVADAL--V--------STSQP-
A0A561E8R3      ----------NL---E-GSIG---LTQAL--AGD-I-TLHDVM--Q--------PTTTP-
A0A4Q5J5D7      ----------GL---V-EGAG---LTDVL--IGR-V-DFEDVA--Q--------EHPDY-
A0A1Y4CKD6      ----------GC---G-ASHG---PAEVL--EDSGL-GVDDCI--V--------LLEES-
A0A0Q7KBQ4      ----------GL---E-NSVG---LMTVL--IGR-T-SLDEAT--Q--------VHDSG-
A0A5Q5BFU2      ----------GL---V-GPVG---FSTVL--SGG-A-SLSEAL--Q--------NTRFP-
A0A439DNZ6      ----------GL---V-GSVG---LSTVL--AGR-A-SLEDVL--Q--------ETAFP-
A0A7I7UD03      ----------DL---V-GGVG---FSTVL--SGA-A-SVDDAL--Q--------KTRFP-
A0A7I7MI62      ----------DL---V-GAVG---FSTVL--SGS-A-SLSEAL--Q--------KTRFP-
A0A0J6YE86      ----------DL---M-SKVG---FSTVL--SGA-V-SIDDSL--Q--------KTRFP-
A0A7I7K1R9      ----------DL---V-GAVG---FSTVL--SGA-A-TLDEAL--Q--------KTRFA-
A0A7I9ZLK4      ----------DL---V-GPVG---FSTVL--SGG-A-SLDEAL--Q--------KTRFP-
A0A1F1IHY9      ----------GL---I-STVG---LTDVV--LGR-V-ELADAL--Q--------TVGNR-
A0A7H2BCD6      ----------RI---D-SKIG---LTEVI--AGQ-V-ELSEAV--R--------QFENS-
A0A3S0V9U6      ----------GI---D-SGVG---LSQVL--SGQ-V-GIEEAI--Q--------RFHES-
A0A7T4T4U7      ----------GL---D-DAVG---LSQVL--SGQ-V-GPEEAI--Q--------RIGDT-
A0A1S2N0P2      ----------SL---D-DAVG---LSQVL--SGQ-V-GPEEAI--Q--------RIGDT-
A0A0Q3BEY5      ----------GL---D-DAVG---LSQVL--SGQ-I-GPEEAI--Q--------RIGDT-
A0A4R6Q3C6      ----------GL---D-DAVG---LSQVL--SGQ-I-GPEEAI--Q--------RIGDT-
A0A7T3CHP7      ----------GL---D-DAVG---LSQVL--SGQ-V-GPEEAI--Q--------RIGDT-
A0A7Y5U6C1      ----------DL---R-GLPG---VVDVL--DGD-V-SLDEVIAEQ--------PTHDSH
A0A542HCT5      ----------GL---I-EGLG---LTDVL--IGT-V-QFDEVA--Q--------QVGGL-
A0A537WNY9      ----------NI---T-RSPG---LTEVL--IGD-S-SLDDAI--R--------KTSNP-
A0A5B8M469      ----------DM---D-GTIG---LSEVL--SGQ-V-PVQEAV--R--------TVGRE-
A0A2S8WHZ8      ----------DM---M-DGAG---LTDVL--SHS-A-DLEDVL--Q--------PYGHL-
A0A1Y4CTD2      EQNLERPSFSDYVLED-GVAG---VGPVL--NGR-S-GVYELF-----------------
A0A3N3ZPU0      ----------GL---T-EGAG---LTDVL--AGA-A-ELEDVL--Q--------DWEPG-
A0A359IQX7      ----------DL---D-GSVG---LTQVL--AGD-V-SIDDAI--Q--------NSELA-
A0A7W9IKV0      ----------GI---E-GGTG---LTDVL--IDR-A-RLEDVI--Q--------IWGDP-
A0A1N7E3F1      ----------GI---E-GGTG---LTDVL--IER-A-RLHEVI--Q--------TWGQP-
A0A544ZKQ1      ----------GI---E-GGTG---LTDVL--IER-A-RLHDVI--Q--------TWGQP-
A0A5D0Q2X0      ----------GI---E-GGTG---LTDVL--IER-A-RLHDVI--Q--------TWGQQ-
A0A5R8Z2E7      ----------GI---E-GGTG---LTDVL--IER-A-RLHDVI--Q--------TWGQQ-
A0A0Q9LZR0      ----------GL---I-EGLG---LTDVL--IGS-V-EFEEVV--Q--------QVGGL-
A0A1F1J417      ----------HI---N-AKIG---LTQVL--AGQ-V-DIAEAV--H--------QVEDS-
A0A2A8D6P2      ----------HI---N-AKIG---LTQVL--AGQ-V-DIAEAV--H--------QVEDS-
A0A1F0THV9      ----------HI---N-AKIG---LTQVL--AGQ-V-DIAEAV--H--------QVEDS-
A0A5F0M6Y0      ----------HI---N-AKIG---LTQVL--AGQ-V-DIAEAV--H--------QVEDS-
E3H5W1          ----------HI---N-AKIG---LTQVL--AGQ-V-DIAEAV--H--------QVEDS-
A0A1F1QKB0      ----------HI---N-AKIG---LTQVL--AGQ-V-DIAEAV--H--------QVEDS-
A0A509JY23      ----------HI---N-AKIG---LTQVL--AGQ-V-DIAEAV--H--------QVEDS-
A0A448USF4      ----------HI---N-AKIG---LTQVL--AGQ-V-DIAEAV--H--------QVEDS-
A0A7Z9A2N0      ----------NV---D-AKVG---LTQVL--AGQ-V-DIAEAV--Y--------QLEES-
A0A433EDP2      ----------NV---D-AKVG---LTQVL--AGQ-V-DIAEAV--Y--------QLEES-
A0A231VTW0      ----------NV---D-AKVG---LTQVL--AGQ-V-DIAEAV--Y--------QLEES-
A0A433ECD0      ----------NV---D-AKVG---LTQVL--AGQ-V-DIAEAV--Y--------QLEES-
A0A7T9UPU8      ----------NV---D-AKVG---LTQVL--AGQ-V-DIAEAV--Y--------QLEES-
U7V3Z1          ----------NV---D-AKVG---LTQVL--AGQ-V-DIAEAV--Y--------QLEES-
A0A6I3F378      ----------GL---S-GEAG---LVDAL--VGR-N-PLELVR--H--------TLDGP-
A0A838H0S5      ----------AI---A-AEPG---LTDLA--DDA-V-PFAGCVGLV--------KVSDD-
A0A1S1CQC5      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1E9T6I0      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1F1GHA7      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1S1CAD0      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGES-
G5ET14          ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QVGES-
A0A1E9DXX2      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGES-
A0A1E8S156      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGES-
A0A1E8S5S2      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGES-
A0A1S1DFA8      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGES-
A0A2I1Z490      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QVDES-
A0A1F0DAA9      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1F0PHK9      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1F0VZG6      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1E9G8X4      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1E9IAW2      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1E9ZBC9      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1E9ZDP4      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1F0R6B5      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1F0Z7N5      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1F1D897      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
D2NP38          ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1F1FV74      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1E9M791      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A291DEI8      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1S1D5T1      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1E8TRD6      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1F0XT88      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1F1EVP5      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
C6R548          ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A0K2RXS2      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A1F0KX60      ----------KL---D-AKVG---LTQVL--AGQ-V-EIANAV--H--------QLGDS-
A0A542I3V2      ----------NL---V-PGVG---VTNVL--SGQ-A-QLVDVI--Q--------APTVL-
A0A2T0UZ65      ----------EV---S-STVG---LSEVL--SGQ-M-DYTDAM--Q--------ATRHQ-
A0A0Q5M6Z7      ----------SL---R-SGVG---LTDVL--SGR-V-DLNDAL--Q--------APSDS-
A0A7G6YA19      ----------NL---R-GGVG---LTDVL--SGR-V-ALGDAL--Q--------APSES-
A0A853CXS3      ----------SL---R-GGVG---LTDVL--SGR-V-ALGDAL--Q--------APSAS-
A0A7W8YB56      ----------HL---Q-SGAG---LTDLL--SGA-V-DLQDVL--Q--------DWSAD-
A0A1L2ZMV4      ----------QL---Q-SGAG---LTDLL--SGA-V-DLDDVL--Q--------EWSGD-
A0A7W8TSW5      ----------QL---Q-SGAG---LTDLL--SGA-V-DLDDVL--Q--------EWSGD-
A0A1R4JTI6      ----------HV---E-GSVG---LTNAV--VGN-A-QVDDVL--Q--------PVSEV-
A0A4R7TM52      ----------GL---V-EGVG---LTDVL--AGR-A-DFEDVA--Q--------PVGQG-
A0A542XE74      ----------NV---D-SGVG---VTQVL--AGD-V-PLEEAL--V--------ESGTR-
A0A0Q7QDF6      ----------GA---E-QNVG---LTSVL--VGK-V-PLDSAV--Q--------GTDVP-
A0A7X7XPM3      ----------GL---E-GGAG---LTTIL--LGR-A-APSDVI--Q--------QWRDT-
A0A5R8L819      ----------GI---V-ADVG---LTDVL--ARR-S-TWREVS--Q--------PAHTP-
A0A7K0PFV4      ----------GV---T-GSVA---LDATV--AGG-G-PLTSIM--R--------SVPRL-
A0A0G3V3F3      ----------SV---P-RTPG---LTSVL--LGS---DLSEAL--R--------KVAES-
A0A7K0MUQ7      ----------NV---P-RTPG---LTSVL--LGS---DLSEAL--R--------KVAES-
A0A7K0U619      ----------SV---P-RTPG---LTSVL--LGS---DLSEAL--R--------KVAES-
A0A6I3DFP2      ----------SV---P-RTPG---LTSVL--LGS---DLSEAL--R--------KVAES-
A0A7K0SI36      ----------SV---P-RTPG---LTSVL--LGS---DLSEAL--R--------KVAES-
A0A7K0V140      ----------SV---P-RTPG---LTSVL--LGS---DLSEAL--R--------KVAES-
A0A261FQA1      ----------GI---N-GKVG---LAHVL--ARQ-A-KLDEAI--Q--------QYWKP-
A0A1Q2CJ92      ----------GL---D-GAVG---LSQVL--AGT-I-KLSDAM--Q--------ATDHK-
A0A2T0S3C8      ----------GL---E-GAVG---LTTVL--AGR-A-SIADVV--Q--------PWSEG-
A0A810MDE3      ----------GL---E-GAVG---LTTVL--AGR-A-SIDDVV--Q--------PWSEG-
A0A4Y8WZJ3      ----------GL---I-STVG---LTDVV--LGR-V-ELADAL--Q--------TVGNR-
A0A7X0KT97      ----------GI---P-GGAG---LSDVL--AGR-A-KLTDVL--Q--------RTPRS-
A0A853DGU7      ----------GI---D-GSVG---LSQVL--AGT-V-ELEDAL--R--------SVSTE-
A0A7Z0A2Z7      ----------GL---E-QNVG---LTNVL--VGQ-L-TVDRAI--Q--------PWGAK-
A0A285VUW0      ----------GL---E-GAVG---LTSVL--AGD-A-RAEDVI--Q--------RWRDT-
A0A849PJI9      ----------DV---D-ASVG---LTQVL--AGD-V-APADVI--V--------ASEHE-
A0A2R7Z032      ----------DI---D-GEVG---LTQVL--AGD-L-RAGEAM--V--------SSGID-
A0A6J4MTQ2      ----------DI---D-GEIG---LTQVL--AGD-V-ELADAL--I--------DPGMP-
A0A1I0W453      ----------EV---D-GAVG---LTQAL--AGD-V-EIRDVI--I--------DSGMP-
A0A0Q6VV12      ----------EI---D-GTVG---LTQAL--AGD-V-DVRDVI--V--------GSGMA-
A0A495NTA9      ----------EI---D-GAVG---LTQAL--AGD-V-EVRDVI--V--------GSGLA-
A0A1H4LCS9      ----------EI---D-GAVG---LTQAL--AGD-V-DIRDVI--V--------DSGLT-
A0A4Q2RZP8      ----------EI---D-GAVG---LTQAL--AGD-V-DIRDVI--V--------GSGLS-
A0A0Q9QB08      ----------EI---D-GAVG---LTQAL--AGD-V-DVRDVI--V--------ESGVA-
A0A7Y9H290      ----------EV---D-GAVG---LTQAL--AGD-V-NVREVI--I--------ESTMA-
A0A4Q2SA86      ----------DI---D-GAVG---LTQAL--AGD-V-EVRDVI--V--------ESGMA-
A0A4Z1C3Z0      ----------EV---D-GAVG---LTQAL--AGD-V-DVRDVI--V--------QSGMA-
A0A6V8KDX4      ----------DL---E-GAVG---LSNVL--AGQ-V-GIEDVV--Q--------HWGRH-
A0A444BL03      ----------EA---P-GSIG---LSHVL--TDQ-V-DLEDAF--Q--------PTDQE-
A0A7V9PCQ0      ----------GERFGP-GELG---LADL----GN-V-DVQQVL--R--------RTRYE-
A0A4Y8X357      ----------GV---D-GRVG---LSEVL--SGD-V-FLADAL--I--------TLEDG-
R4LD52          ----------GL---E-GAAG---LTTVL--AGK-A-AVDDVL--Q--------RYGDH-
A0A4T2CD79      ----------NV---V-GGVG---VTDLL--IGS-A-ELDDVL--Q--------PWGER-
A0A6L6AM03      ----------EV---D-GAVG---LTQAL--AGD-V-DVREVI--I--------ESGMP-
A0A4Q2RU39      ----------EI---D-GAVG---LTQAL--AGD-V-EVKDVI--V--------DSGMT-
A0A4Q2SK58      ----------EI---D-GAVG---LTQAL--AGD-V-EVKDVI--I--------DSGMT-
A0A2N3YJR1      ----------DR---E-NTIG---LSHVL--TDQ-V-SLVDAL--Q--------ATDQP-
A0A6G8FYB9      ----------DV---V-GTVG---LSHVL--TGQ-V-PVEDVL--L--------ETDEP-
A0A4Q4D742      ----------GL---E-NSVG---LLSVL--VGR-T-TIEQAI--Q--------PH-VS-
A0A1C6T1J1      ----------GL---D-GGVG---LTDVL--VGD-V-QVGDVV--Q--------RWGDK-
A0A2W2CFC8      ----------GI---D-SAVG---LTDVL--VGD-V-PVGDVV--Q--------RWGDK-
A0A2W2A4B0      ----------GI---E-GSAG---LSDIL--VGR-V-ELADVL--Q--------PWGRA-
A0A4Y9MDA5      ----------GL---E-GAAG---LTTVL--LGR-A-GLPDLV--Q--------EWGTS-
A0A1H7N9P7      ----------GL---E-AAAG---LTTAL--LGR-A-SVADLV--Q--------EWGTA-
A0A1M7V0F8      ----------GL---E-AAAG---LTTVL--LGR-A-TVADLV--Q--------DWGTE-
A0A1M3LEY6      -------------GIE-GGVG---LTDVL--IGR-A-RLSDVT--Q--------AWGLR-
A0A538AJI7      -------------RVN-PHPG---LAEVL--RGE-T-PIMEAA--Q--------KGWAE-
A0A538AM15      -------------AIG-GSDGPGLVNAIL--DPR-L-PLERVA--R--------PLPPF-
A0A520EHH5      -------------GIV-GSVG---VSSVL--AHDA--GLDEVV--Q--------TTGHT-
A0A4R0U4F1      -------------GIE-GAVG---LTHLI--TNRV--SSHDAI--Q--------RYWKP-
A0A1V8PLV6      -------------GLE-GGAG---LTHVL--SDQA--AVKDAV--Q--------RYWKP-
A0A357ZCV8      -------------RLK-PSVG---SYAVL--TGLA--KLSDAV--V--------STPIP-
A0A419GS64      -------------QIT-LDHG---LTRMI--STYD--EGDDPF--A------FGDQVMD-
A0A4R1CW45      -------------GIE-FEAG---VSDYL--LGEME-SLHEVG--L--------HIDGT-
A0A4R5Z7B0      -------------GVN-NLFG---FTTVL--TKQA--TLGSTV--L--------ETEEK-
A0A542H054      -------------NVN-NTFG---LTSTL--SRQK--SLREVV--H--------QTDIK-
A0A6M8GFV5      -------------RLE-NFKG---LTTAI--AQDK--QLKDFV--Q--------KSQIE-
A0A7G8U6J2      -------------SIS-NIHG---LTSVL--TKKM--DLRKTI--L--------NSNVS-
A0A2S8MDM2      -------------DLL-QPVG---FSTVL--SGRA--LLGEAL--Q--------KTRFP-
A0A357ZDL3      -------------NLR-APSG---LYAVL--AKQV--ALNDAV--M--------TTQAG-
A0A1I6GVG4      -------------GLP-KGAG---ISDVL--AGRA--TIAEVA--Q--------RFGNG-
A0A1I6IST1      -------------GLP-KGAG---ISDVL--AGRA--TIAEVA--Q--------RFGNG-
A0A412JBM5      ------------AGRN-TSTG---LCKYL--VGLG--ELG--L--A--------SIEGI-
A0A6J4SUA1      -------------NVD-QQPG---LMEFL--SGEA--GLDEIV--V--------PTEYD-
A0A1C2B334      -------------SLN-NSIG---LTDFL--IGQG--DLPDLL--Q--------QGGLD-
R7Y679          ------------QAVS-PDIG---LTDYL--RGSA--PVGDVL--Q--------RSGVG-
A0A4Y8ZIU8      -------------GVD-GRVG---LSEVL--NGDV--ALQDVL--V--------PVGDH-
A0A0F0KYJ9      -------------GLP-KGAG---ISDVL--AGCA--TIAEVA--Q--------RFGNG-
A0A838H149      -------------DLP-NAHG---LTTLV--RSDEV-SLDPIT--H--------ATEQE-
A0A7M2YYB9      -------------GVR-GTPG---LTEVI--AAGI--DYKTVI--K------PIQREPG-
A0A7K0LE65      -------------NVP-RTPG---LTSVL--LGS---DLSEAL--R-------KVAESP-
A0A838JYQ6      -------------GLG-NAQG---LITVL--VKER--RLQHTW--D---------EPME-
A0A510HHA8      -------------SLR-NING---LVNAI--TGER--GLQEVL--S---------EPLP-
A0A6G8Q9J3      -------------GLR-DSPN---LLDVL--ARED--GLGEAW--Q---------EAAP-
A0A538BBM6      -------------DRP-NSVG---VVDVL--RGNT--VVEDAL--Q-----YVPVTRET-
A0A5Q2F9A3      -------------RLE-DAAG---LSTIL--IGRA--SLREVV--Q--------VAGMG-
A0A0K8Q3D9      -------------NLV-PGAG---VTDVL--SGTA--DLDDVL--Q-------PWGALP-
A0A2R7RCA1      -------------NLV-PGVG---VTDVL--TGTA--ELADVL--Q-------PWGALP-
A0A1Q7WJN6      -------------TVS-RKPG---LTDVL--AGDV--TAEAAL--Q--------RTPYS-
A0A1E2SNF6      -------------GIP-NGAG---LSDVL--AGRV--SLREVL--Q-----DPDVSLHT-
Q6ADE8          -------------GIP-NGAG---LSDVL--AGRV--SLREVL--Q-----DPDVSLHT-
A0A1Q7CZ24      -------------GLSGGKRG---LAEAL--LADSGLSLEDTV--E--------TLAHF-
A0A2W6VLC6      -------------GIE-GGLG---LTDVL--IGRA--RVEDVV--I--------DMAPR-
A0A519G798      -------------GLE-RSVG---LTTVL--VGRS--ELQDSI--Q--------KHTDS-
A0A7V8X3I0      -------------DAA-NDVG---VSSFL--LGER--PLAECL--QYVSLPPAPGGADA-
A0A7V8YPJ0      -------------DAH-NEVG---VTDVL--LEHR--SLEECL--QYVELPAVDTDRPA-
A0A7X7Q7T7      -------------RLD-SELG---LSDVL--TGRG--TLQDLI--I--------DVAPG-
A0A6G8QDQ0      -------------GLR-NFKG---VVNVL--ANEL--ELQETW--H--------EPVPF-
A0A023X491      -------------ELR-NTRG---VVDAL--VGSE--NVEELW--Q--------TPLDN-
A0A4R1BMZ2      -------------GLR-NVWG---VVDVL--VGKR--SLPDTM--Q--------EVLVG-
A0A838JNW7      -------------GLK-NLWG---IVNVL--VGER--SLEDVQ--Q--------HPMEG-
                                                                            

A0A519GXS6      -------LDVLTAGEEAPNPAEL-LASQRMRVLLEGLREEY--DLVVVDTAPVLSVSDAT
A0A6N6NKS9      ---N---LYFMDSEPNIPSPPDV-LSTKRFAALVDTLREMF--DYVIFDSPPIGLFVDAA
A0A538BYZ4      ---N---LSVVLAGRSPATHYEL-LKSPRLGELLGEARHRY--DYVLLDTPPVVVVPDCR
A0A348NU28      -------LDVLPSGSIPPNPAEM-LTSDAMKRLLEEATARY--DYVIIDSPPVMSVADAN
A0A2N4T4Q5      ---PN--LQVLGAGRTPPNPTEL-LASQAMRTMLAELAEDA---FVLVDAPPLLPVTDAA
A0A4Q5APW3      ---N---LHVMPAGPKPPNASAL-LNSPIMVELLNNAIERY--DYVLVDTAPMVVANDAV
A0A4Q5B0V3      ---N---LHVMPAGPKPPNASAL-LNSPIMVELLNNAIERY--DYVLVDTAPMVVANDAV
A0A022KX11      ---G---MDVLPAGPIPPNPSEL-LGSAPMEALLTRLMQEY--DFVLIDSPPVVPVIDAV
A0A4Q5A868      ---N---LHVMPAGPKPPNASAL-LNSPIMVELLNNAIAQY--DYVLIDTAPMVVANDAV
A0A6N4VXX3      ---G---LTVLAAGTTPPNPSEL-LASQAAKKLLAELRGQF--DYVIVDSSPLLAVTDAS
A0A1H4I042      ---G---LTVLAAGATPPNPSEL-LASHAAKNLLEELRGKF--DYVIVDSCPLLAVTDAA
A0A4R7A6D9      ---G---LTVLAAGATPPNPSEL-LASHAAKNLLEELRGKF--DYVIVDSCPLLAVTDAA
A0A345NSU7      ---N---LHVLTAGEVPPNPSEL-LGSSKMHELFERLSEQY--DFILVDTPPVLPVTDAM
A0A222TG79      ---G---VDALAGGQIPPNPAEL-LTSQKASEGINSLSSLY--DYVIVDTPPVLPVTDAV
A0A0W8I9Y2      ---PN--LQVLGAGRTAPNPTEL-LSSKAMHAMLETLAEDA---LVLVDAPPLLPVTDAA
A0A7C6LSF9      ---G---VKIITAGTQLAHPASL---ATRMGVLVDEARKVA--DIILIDTAPLLAASDVF
A0A255G8R8      ---PD--LYVLTSGVVPPNPTEL-LDSAQMRALLDEALAEY--DVVLIDSPPLLPVSDGL
A0A6G7Y423      ---AG--LAVLPAGAVPPNPSEL-LGSDAMAHLITAAERSY--DYVLFDAPPLLPVTDAV
A0A4Q4D4T1      ---G---LDVLTSGTRPPNPSEI-IQTAAMETVLIELGRRY--DIVLVDAPPLLPVADAA
A0A1Q2CRV2      ---P---LDVLTAGRVPPNPAEL-LGHTRMRALLEDASKLY--DTVIIDSPPLLPVTDAA
A0A261FE22      ---E---FQVLPVEDNQGTAAVM-LSSAVMENMIDQAAKHY--DHVIIDTAPMQVSNDAS
A0A7K0NRJ7      ---PF--LRVLSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPPSGLFSDAL
K6WHS4          ---G---LDVLPSGPIAPNPAEL-LGSRKASDVFGSLRDSF--EYVVVDTPPCLPVTDAQ
A0A7K0NTR2      ---N---IRFVASAPTRTDPGSA-IEMVRVASRVG--REIA--DLVIVDSPPILLANDAA
A0A1H6WL79      ---PR--LRILTAGRIPPNPSEL-LGSRAMEHLLKDLAQRA---IVLIDAPPLLPVTDAA
A0A101LAM5      ---PH--LRILTAGRIPPNPSEL-LGSRAMEHLLRDLSQRA---MVLIDAPPLLPVTDAA
A0A4Y3NEG0      ---PH--LRILTAGRIPPNPSEL-LGSRAMEHLLNELSQRA---MVLIDAPPLLPVTDAA
A0A1Q2CI19      ---G---VRVVTAGTRLAHPTAL---ASRMGPLVASARKRA--DVVIIDSAPLLEAAEVF
A0A512T3M3      ---G---VKIITAGTQLEHPTSL---ASRMVALQEGTRQLA--DVVIVDSAPLLAASEVF
W6JTW4          ---G---VSIIVAGTQLDHPTSL---ASRMGPLLEEARGLA--DVVLVDTAPLLAASDVF
A0A839J1M0      ---G---VSIVTAGTRLDYPASL---TSRLAPLIDDARQSA--DIVLIDTSPLLAASDVF
A0A8A4Z8K4      ---G---VSIVTAGTRLDYPASL---TSRLAPLIDDARQSA--DIVLIDTSPLLAASDVF
A0A0A0JTY0      ---G---VRIMSAGSSLAHPAAL---ASRMSHLLDEARGMA--DVVLIDTAPLLEASDVF
A0A0A0JXF2      ---G---VRIITAGTVLTHPASL---ASRMGGLLEEAREMA--DVVLIDTAPLLEASDVF
E6S8H2          ---G---VRIITAGTRLEHPASL---ASRMGGLLTEARGLA--DVVLVDSAPLLAASDVF
A0A0A0JGH0      ---A---VRIITAGTRLTHPASL---ASRMGHLLAEVRELA--DVVIIDSAPLLAASDVF
N0E4U7          ---G---VRIITAGTRLTHPASL---ASRMGHLLEEVRGMA--DVVIIDSAPLLAASDVF
A0A0A0IYK2      ---G---VRIITAGTSLAHPASL---ASRLGSLLEEVRGMA--DVVLIDTAPLLEASDVF
A0A0Q9L0H3      ---N---VRIITAGTSLAHPAAL---ASRMGQMLEQARDLA--DVILIDSAPLLEASDVF
A3TMK0          ---G---VRIITAGTSLAHPASL---ASRMGHLLEEARDMA--DVVLIDTAPLLEASDVF
A0A543PXP1      ---D---VRIITAGTRLSHPASL---ASRMGGLLSETRGLA--DIVLIDTAPLLAASDVF
A3TMH6          ---G---VRIMTAGTRLSHPASL---ASLMGGLIAELRDLA--DVVLIDTAPLLAASDVF
A0A6I2XCV4      ---VEN-LWFIPAPRTSASPAIV-I--EELGRVIDSWRDDF--DIVFLDTPPMLTTNDAT
A0A5R8VLL6      ---PN--LSILGAGRTPPNPSEL-LSSHAMKQLLNSLAERG---IVIIDAPPLLPVTDAV
A0A3L7ADK2      ---EK--LWILGAGRIPPNPSEL-LGSRAMKELLAALGEQS---IVILDAPPILPVTDAV
A0A538JQF8      ---KVPGVQVIAAGSRVANPGRL-LA--RAADLVREARNLA--DFVLIDTAPTLIVNDAI
A0A1H6YPK1      ---GR--FSVVTAGVIPPNPSEL-VGSDTMRSLLYSFPEDT---MVIVDSPPLVPVSDAA
A0A0Q9TBP0      ----N--LTLLPAGTLPPNPAAL-LASGQMHLVLEELAAKA--DMIVVDSPPVLTGADTL
A0A0G3V3M7      ----N--IRFIASAPTRTDPGTA-IEMVKVAARLGRDIAD----LVIVDSPPILLANDAA
A0A6I3DD56      ----N--IRFIASAPTRTDPGTA-IELVKVAARLGREIAD----LVIVDSPPILLANDAA
A0A5Q2FA83      ---S---LHVLPSGAIPPNPSEL-LGSTAMETLFAELLQAY--DYVLVDSPPVLPVIDPI
A0A2R7MGI0      ---GR--LFVVAAGRTPPNPTEM-VGSQRLQSLARKLAEEM---VVIVDSPPTLAVADAA
A0A2T7WQY4      ---GR--LFVVAAGRTPPNPTEM-VGSQRMQALARKLAEDM---VVIVDSPPTLAVADAA
A0A0Q5Q5L3      ---GR--LFVVAAGRTPPNPSEM-VGSKRMQALSRKLAEDL---VVIVDSPPTLAVADAA
A0A0Q6DVM4      ---GR--LFVVAAGRTPPNPSEM-VGSKRMQALSRKLAEDL---VVIVDSPPTLAVADAA
A0A1N7DLV3      ---GR--LFVVAAGRTPPNPSEM-VGSQRMQQLARTLADDM---VVIIDSPPTLAVADAA
A0A1V2NSB5      ---GR--LFVVAAGRTPPNPSEM-VGSQRMQQLARTLADDM---VVIIDSPPTLAVADAA
A0A1R3WWR6      ---GR--LFVVAAGRTPPNPSEM-VGSQRMQALTRKLAEEL---VVIIDSPPTLAVADAA
A0A1G6GTN3      ---GR--LFVVAAGRTPPNPSEM-VGSQRMQALARKLADDM---VVIVDSPPTLAVADAA
A0A7W5GFA5      ---GR--LFVVAAGRTPPNPSEM-VGSQRMQSLARKLADDM---VVIIDSPPTLAVADAA
A0A2S5WZJ5      ----G--LYVLPSGRIPPNPSEM-LGSAAMKSIISLLSTDY---IVVIDAPPLLPVTDAA
A0A0Q5JKD6      ---GR--LFVVAAGRTPPNPSEM-VGSQRMQSLARKLADDM---VVIIDSPPTLAVADAA
A0A2W6DK08      ----R--VDVVTAGTQLERPSTL---PARMGNLVMQARELA--DIVLIDSAPMLLANDAT
A0A346XTB0      ---EQSQIPVVTAGQRRGDPAAL-LRTHAFRKGMERIVDSA--ELLIVDSSPLLAVADAT
A0A542FTE6      ---LD--LTVFTSGPTPPNPSEL-LGSNAMREFLDSLRRTG--AFVVLDAPPLLAVTDGA
A0A7Y9QM02      ---LD--LTVFTSGPTPPNPSEL-LGSNAMREFLDSLRRTG--AFVVLDAPPLLAVTDGA
A0A6I1G2U1      ----G--VKIITAGTQLAHPASL---ATRMGTLIDEARPLA--DIVIVDTAPILAASDGF
A0A351ETF8      ----GIRFDVITSGSKVQDPALL-LRGDRWTSLADELFLYD---LVIIDAPPVLAVTDAV
A0A349B7N2      ---GVSAITHLDERLESVQPADL-LSW--IRSTVQQARPTS--DVVLIDTAPFLTVNDAR
A0A4Q2JUT1      ---NN--LLVLAAGSVPPNPSEV-LGSERMHTLIADLTKHA---TVIIDAPPLLPVTDGA
A0A6L5R0V7      ---NN--LLVLAAGSVPPNPSEV-LGSERMHTLIADLTKHA---TVIIDAPPLLPVTDGA
A0A2S0LQ32      ---PH--LRVIPAGRIPPNPSEL-LGSQRMKALLDRLSQEA---VVLLDAPPLLPVTDAA
A0A7T8DZN6      ---PH--LRVIPAGRIPPNPSEL-LGSQRMKALLDRLSQEA---VVLLDAPPLLPVTDAA
A0A2N6V1R5      ---PN--LRVVPAGRIPPNPSEL-LGSQRMKALMDYLKDDA---MVIMDAPPLLPVTDAG
G9PHS6          ---PN--LRVVPAGRIPPNPSEL-LGSQRMKALMDYLKDDA---MVIMDAPPLLPVTDAG
U1PLM7          ---PN--LRVVPAGRIPPNPSEL-LGSQRMKALMDYLKDDA---MVIMDAPPLLPVTDAG
A0A4V1VGV9      ----N--LAVITSGRVPPNPSEL-LGSRRMSAVIEALGEEY---FVVLDAPPLLPVTDAG
A0A2S5UYV0      ----G--LYALPSGRIPPNPSEM-LGSEAMRSIIRLLSQDY---IVVIDAPPLLPVTDAA
A0A7W4UQ09      ----G--LYVLPSGRIPPNPSEM-LGSEAMKSIIKLLSTEY---IVVIDAPPLLPVTDAA
A0A2S5X9U6      ----G--LYVLPSGRIPPNPSEM-LGSEAMKSIVSLLSKDY---IVVIDAPPLLPVTDAA
A0A2S5ULV5      ----G--LYVLPSGRIPPNPSEM-LGSEAMKSIVSLLSKDY---IVVIDAPPLLPVTDAA
A0A653YMF0      ----G--LYVLPSGRIPPNPSEM-LGSEAMKSIVSLLSKDY---IVVIDAPPLLPVTDAA
A0A7V9H755      ----G--LYLLPAGPLPPNPAEL-LGSEGMRRTLETLAEAY--DLIVVDTPPLLAASDAA
A0A3Q9IY80      ---GN--LLVLGAGKLPPNPSEV-LGSERMKNLLRTLAKDY---TVIVDAPPLIPVTDAA
A0A0F0LP73      ----N--LFVLPAGGIPPNPSEM-LGSTAFQRLLGELRRDF---FIVIDAPPVLPVTDAS
A0A346Y185      ---EGQYVPFIPAKSLGDDTAAF-FRTPGFRQAITRLREVA--DLIIVDSPPLLLASDAS
A0A7W0HGW1      ---DSRHLDVLTAGPVSDNPAEL-LMSGAVTAIIDRLAERY--DCVLIDSSPLRAVADAL
A0A259S8H9      ----N--LFVLPAGGIPPNPSEM-LGSAAFQQLLTRLRQDF---FIVVDAPPVLAVTDAS
A0A2W1Z497      ---GN--LWIVGSGRVPPNPSEL-LGSRMFRDILASLGEHA---TVVLDAPPILAVTDAV
A0A0Q5L115      ---SN--LWVVGAGRIPPNPSEL-LGSQTFQDLVSTLAEHA---TVILDAPPVLAVTDAV
A0A7G6YY64      ---SN--LWVVGAGRIPPNPSEL-LGSQTFQDLVSTLAEHA---TVILDAPPVLAVTDAV
A0A7J5B4S5      ----G--LYALPSGRIPPNPSEM-LGSEAMRSIIRLLSQDY---IVIIDAPPLLPVTDAA
A0A852U976      ----G--LYALPSGRIPPNPSEM-LGSEAMRSIIRLLSQDY---IVIIDAPPLLPVTDAA
A0A1F1X071      ----L--LTLLPAGQIPPNPSEL-LGSRRMQELIEELSRQY---FVIIDAPPVLAVTDAQ
A0A3R8RWC7      ----L--LTLLPAGQIPPNPSEL-LGSRRMQELIEELSRQY---FVIIDAPPVLAVTDAQ
A0A4U0RJZ4      ----N--LSIITSGRIPPNPSEL-LGSRRMSAVIDALEEEY---FVVLDAPPLLPVTDAG
A0A4R1FGL9      ----N--LSIITSGRIPPNPSEL-LGSRRMSAVIDALEEEY---FVVLDAPPLLPVTDAG
E3B8H1          ----N--LSIITSGRIPPNPSEL-LGSRRMSAVIDALEEEY---FVVLDAPPLLPVTDAG
A0A7D7WDT9      ----G--LFALAAGGTPPNPSEM-LGSSAFGNLIKELRKDF---FIVIDAPPVLPVTDAT
A0A0Q5AWK6      ----G--LFALPSGHIPPNPSEM-LGSAAMRTLVERLSKDY---FVIIDAPPILPVTDAS
A0A6P1F176      ----G--LFALPAGHIPPNPSEM-LGSSAMRALIERLAEDY---FVIVDAPPILPVTDAS
A0A3N1NLD3      ----G--LFALPAGHIPPNPSEM-LGSSAMRALIERLAEDY---FVIIDAPPILPVTDAS
A0A3N2FVI8      ----G--LFALPAGHIPPNPSEM-LGSSAMRALIERLAEDY---FVIIDAPPILPVTDAS
A0A2S5XDQ6      ----G--LYALPAGHIPPNPSEM-LGSEAMRALVARLSKDY---FVIIDAPPVLPVTDAS
A0A2S5XNN6      ----G--LYALPAGHIPPNPSEM-LGSEAMRALVARLSKDY---FVIIDAPPVLPVTDAS
A0A5C8C085      ---EN--LSVLAAGGIPPNPSEL-LGSQAMRRLLTLLSQRA---IVLVDAPPLLPVTDGA
A0A4Y5YMQ6      ---G---VDVLTAGEHVPNPAQL-LASQKMTELVEGLRPRY--DFVVIDTAPLLSVADAT
A0A1E4BP96      ---QN--LYILASGRVPPNPSEV-LGSRRMRDLVTSLTEHA---LVIVDSPPTLLVADAA
A0A7V9FXS6      ---N---LAIMPTSQDPEGGDLL---ARRFADVIGEARLHY--DLIVIDTPPLLTTDDAR
A0A7W0PY69      ---D---LDLLPTAADPEAGDLL---ARRFADVMEEAKRKY--DIVVIDSPPLLGTDDTR
A0A7W8YB99      ---PN--LQVLAAGRIPPNPSEL-LASQSMRNLLDVLSERA---FVIIDAPPLLPVTDGA
A0A1L2ZMQ6      ---PN--LQVLAAGRIPPNPSEL-LASKTMGKLLEDLSERA---FVIIDAPPLLPVTDGA
A0A7W8TR75      ---PN--LQVLAAGRIPPNPSEL-LASKTMRKLLEDLSERA---FVIIDAPPLLPVTDGA
A0A151BT98      -------LFVLPAGPVPPNASEL-LGSSAMQGLFQELVAEF--DFVVFDSPPMLPVVDAL
A0A2Y8ZRF8      -------LFVLPAGPVPPNASEL-LGSAAMRNLFQELVAEF--DFVVFDSPPMLPVVDAL
A0A2R9UAT1      ---DT--LRIVAAGRTPPNPSEV-LGSERMKDLLRELSREA---MVIVDAPPLLPVTDAA
A0A3E2DN22      ---R---LQMLAAGRIPPNPSEL-LGSQRMKDLLTELRKRG--YFVVIDAPPLLAITDAG
A0A3Q9ULZ9      ---G---LRVLVAGRIPPNPSEL-LGSVRMHNLISRLTKAG--YFVVLDAPPLLAVTDAG
A0A3S9JFL2      ---G---MRVLVAGRIPPNPSEL-LGSVRMHNLIARLTKAG--YFVILDAPPLLAVTDAG
A0A3L8NYD3      ---N---LDVIAAGRIPPNPSEL-LGSQRMQSVIEELVAAD--YMVLIDAPPLLPVTDAG
A0A1M6K628      ---N---LSVLPAGRIPPNPSEI-VGSKRMADLIAHLSETH---LVIIDAAPLLPVADAG
A0A561E8R3      ---D---LVVIPAGRIPPNPSEL-VGSRRMETAITELSKDH---LVIIDAPPLLPVTDAG
A0A4Q5J5D7      ---PN--LLLLAAGGVPPNPSEL-LGSQTMRQLLTELAKTA---LVIVDAPPLLPVTDAA
A0A1Y4CKD6      ---G---IGFWGGAGPVQNPVEV-LSDERLPSLFDGLRGQW--DYIVLDASPCGMFQDAA
A0A0Q7KBQ4      -------ISFLGTGPKPPNPAEV-LDTQAMRDLLHGLRSEY--DVVVIDAPPMLPVADAS
A0A5Q5BFU2      ---G---LTVLTSGAIPPNPSEL-LGSQSARRLLNELRAQF--DYVIVDSTPLLAVTDAA
A0A439DNZ6      ---G---VTVVTSGAVPPNPSEL-LGSLAAKKILDELRTGF--DYVVVDSSPLLAVTDAA
A0A7I7UD03      ---G---LTLLTSGAIPPNPSEL-VGSQAARKLLRELRTQF--DYVIIDSSPLLAVTDAA
A0A7I7MI62      ---N---LTVLTSGPVPPNPSEL-LASLSAKKLLSELRAQF--DYVVVDSTPLLAVTDAA
A0A0J6YE86      ---G---LSVLTSGAVPPNPSEL-LGSQSARKVLAELRSRF--DYVIIDSTPLLAVTDAA
A0A7I7K1R9      ---G---LTVLTSGAVPPNPSEL-LGSQSARKLLHELRGRF--DYVIVDSAPLLAVTDAA
A0A7I9ZLK4      ---G---LTVLTSGTVPPNPSEL-LGSQSARNLLSELRSQH--DYVIVDSTPLLAVTDAA
A0A1F1IHY9      ---PS--LQVLASGPIPPNPSEI-LASDRFNDLINALAEDA---LVIIDAPPLLPVTDAA
A0A7H2BCD6      ---Q---LFILPAGRIPPNPSEL-LGSDKMRSLIRELSEEF---MVIIDAPPVLPVTDAT
A0A3S0V9U6      ---E---LYVVPAGRIPPNPSEL-LGSAKMRKLIEELAREY---LVLIDAPPLLPVTDGS
A0A7T4T4U7      ---E---LYVLPAGRIPPNPSEL-LGSSKMQRLIQEMSQEY---LVLIDVPPLLPVTDGS
A0A1S2N0P2      ---E---LYVLPAGRIPPNPSEL-LGSSKMQRLIQEMSQEY---LVIIDVPPLLPVTDGS
A0A0Q3BEY5      ---E---LYVLPAGRIPPNPSEL-LGSSKMQRLIQEMSQEY---LVIIDVPPLLPVTDGS
A0A4R6Q3C6      ---E---LYVLPAGRIPPNPSEL-LGSSKMQRLIQEMSQEY---LVIIDVPPLLPVTDGS
A0A7T3CHP7      ---E---LYVLPAGRIPPNPSEL-LGSSKMQRLIQEMSQEY---LVIIDVPPLLPVTDGS
A0A7Y5U6C1      DGRGS--LHVLPAGRVSSEAGEL-LLTRGLNSLLDRLAKQA--DIVLIDSPPMLNVGDAL
A0A542HCT5      ---PN--LRVLAAGRVPPNPSEM-LGSKAMRRLLERLGETC---TVIVDAPPLLPVTDAA
A0A537WNY9      ---S---LNVLTGGRRLADPGEM-L-TISFGSVLSQLAEMY--ETIVIDGTPLAPISDAR
A0A5B8M469      ---N---LMVLPAGGTPPNPSEM-LGAHAFEALLRELRERF---FVVVDAPPVLPVTDAL
A0A2S8WHZ8      ---PN--LQVLCSGRIPPNPSEL-LGSKAMKSLLSELALDA---VVLVDAPPLLPVTDAA
A0A1Y4CTD2      ------------QYKALRDPMAV-FSGERLADVMAELSERF--DYIFVDCSPVAAAADAE
A0A3N3ZPU0      ---SN--VHLLGAGRTPPNPSEL-LGSKTMRNLLARMGQDY---MVVIDSPPLLPVTDPS
A0A359IQX7      ---N---LKVLSAGRIPPNPSEL-VGSQRMHNLLIALSENR---TVIVDAPPLLPVTDGG
A0A7W9IKV0      ---E---VAVLPSGQIPPNPSEL-LGSDGMRQVLDRLSSAY--DMVIIDAPPLLPVTDAA
A0A1N7E3F1      ---G---LSVLPSGRIPPNPSEL-LGSRVMRSVLAQLTEEY--DMVIVDAPPLLPVTDAA
A0A544ZKQ1      ---G---LSVLPSGRIPPNPSEL-LGSRGMRSVLAQLTEEY--DMVIIDAPPLLPVTDAA
A0A5D0Q2X0      ---G---LSVLPSGRIPPNPSEL-LGSRGMRTVLAQLTEEY--DMVIIDAPPLLPVTDAA
A0A5R8Z2E7      ---G---LSVLPSGRIPPNPSEL-LGSRGMRTVLAQLTEEY--DMVIIDAPPLLPVTDAA
A0A0Q9LZR0      ---PN--LSVLAAGRVPPNPSEM-LGSKAMRRLLEGLGETY---TVIVDAPPLLPVTDAA
A0A1F1J417      ---K---LFVLPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDAS
A0A2A8D6P2      ---K---LFVLPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDAS
A0A1F0THV9      ---K---LFVLPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDAS
A0A5F0M6Y0      ---K---LFVLPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDAS
E3H5W1          ---K---LFVLPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDAS
A0A1F1QKB0      ---K---LFVLPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDAS
A0A509JY23      ---K---LFVLPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDAS
A0A448USF4      ---K---LFVLPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPPLLPVTDAS
A0A7Z9A2N0      ---N---LFVLTAGRIPPNPSEL-LGSDKMRQLVRELSEEF---VVVLDAPPLLPVTDAS
A0A433EDP2      ---N---LFVLTAGRIPPNPSEL-LGSDKMRQLVRELSEEF---VVVLDAPPLLPVTDAS
A0A231VTW0      ---N---LFVLTAGRIPPNPSEL-LGSDKMRQLVRELSEEF---VVVLDAPPLLPVTDAS
A0A433ECD0      ---N---LFVLTAGRIPPNPSEL-LGSDKMRQLVRELSEEF---VVVLDAPPLLPVTDAS
A0A7T9UPU8      ---N---LFVLTAGRIPPNPSEL-LGSDKMRQLVRELSEEF---VVVLDAPPLLPVTDAS
U7V3Z1          ---N---LFVLTAGRIPPNPSEL-LGSDKMRQLVRELSEEF---VVVLDAPPLLPVTDAS
A0A6I3F378      ---D-----VLPAGRSPYNSSEL-LSSRRMGEVLHELAAIY--DFVIIDTPPVLPVSESL
A0A838H0S5      ---IR--LSFVPAGSRLSDPAGF-FRTPEFRKALGRVQEQA--ELVIVDSPPLLSVADAS
A0A1S1CQC5      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLIKELSEEF---IVVVDVPPLLPVTDAS
A0A1E9T6I0      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLIKELSEEF---IVVVDVPPLLPVTDAS
A0A1F1GHA7      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLIKELSEEF---IVVVDVPPLLPVTDAS
A0A1S1CAD0      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
G5ET14          ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1E9DXX2      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1E8S156      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1E8S5S2      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1S1DFA8      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A2I1Z490      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVIDVPPLLPVTDAS
A0A1F0DAA9      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1F0PHK9      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1F0VZG6      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1E9G8X4      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1E9IAW2      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1E9ZBC9      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1E9ZDP4      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1F0R6B5      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1F0Z7N5      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1F1D897      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
D2NP38          ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1F1FV74      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLIKELSEEF---IVVVDVPPLLPVTDAS
A0A1E9M791      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLIKELSEEF---IVVVDVPPLLPVTDAS
A0A291DEI8      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLIKELSEEF---IVVVDVPPLLPVTDAS
A0A1S1D5T1      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1E8TRD6      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1F0XT88      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1F1EVP5      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
C6R548          ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A0K2RXS2      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A1F0KX60      ---N---LFVLPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPPLLPVTDAS
A0A542I3V2      ---SN--LSVLGSGPTPPNPSEL-LGTNAMKQLLNTLAAGA---TVLIDAPPLLPVTDAA
A0A2T0UZ65      ---D---VFVIAGGQVPPNPSEL-LGSARMRQLLQELTRDH---FVILDAPPLLPVTDAA
A0A0Q5M6Z7      ---PH--LRVLGAGRVPPNPSEL-LGSRTMRELVSALADVA---IVILDAPPLLSVTDAA
A0A7G6YA19      ---TH--LRVLGAGRVPPNPSEL-LGSRTMRELIDALSGVA---TVILDAPPLLSVTDAA
A0A853CXS3      ---TH--LRVLGAGRVPPNPSEL-LGSRTMRELIGALSGVA---TVILDAPPLLSVTDAA
A0A7W8YB56      ---QR--LQVLGAGRTPPNPSEL-LGSRAMKRLLADLSRDA---VVIVDSPPLLPVTDAS
A0A1L2ZMV4      ---PR--LQVLGAGRVPPNPSEL-LGSRAMKRLLTDLAQES---VVIVDSPPLLPVTDAS
A0A7W8TSW5      ---PR--LQVLGAGRVPPNPSEL-LGSRAMKRLLTDLAQES---VVIVDSPPLLPVTDAS
A0A1R4JTI6      ---EN--LTVLASGPVPPNPSEI-LGSDRLEAILRSLAQDH---MVIVDAPPLLPVTDAA
A0A4R7TM52      ---GN--LSVLGAGLLPPNPSEV-LGSARMRDLLQRLAVDS---TVIIDAPPLLPVTDAA
A0A542XE74      ---G---LQILPAGRIPPNPSEL-VGSNAMHRLIERLAADH---MVIIDAPPVLAVTDGA
A0A0Q7QDF6      ---G---LDVLTSGTRPPNPSEI-IQTAAMETVLIELGRRY--DIVLVDAPPLLPVADAA
A0A7X7XPM3      ---S---LYVLTAGEVPPNPSEL-LGSAAMKSLMSSLLDAY--DFVIVDSPPVGPVIDPV
A0A5R8L819      ---N---LTVLAAGRIPPNPSEL-VGSERMNLLLHELAAEA---IVILDAPPLLPVTDAA
A0A7K0PFV4      ---PP--LRLVDVATGPGDLALLPLLTTRTRAMLQDVDDVA--DYVLLDTAPVGEVGDAL
A0A0G3V3F3      ---PF--LRVLSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPPSGLFSDAL
A0A7K0MUQ7      ---PF--LRVLSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPPSGLFSDAL
A0A7K0U619      ---PF--LRVLSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPPSGLFSDAL
A0A6I3DFP2      ---PF--LRVLSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPPSGLFSDAL
A0A7K0SI36      ---PF--LRVLSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPPSGLFSDAL
A0A7K0V140      ---PF--LRVLSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPPSGLFSDAL
A0A261FQA1      ---T---FHVMPAGEQQANPSIL-INSKAMNMLLHAAAKQY--DNVIVDSTPMSVANDSA
A0A1Q2CJ92      ---H---LQVLPAGRIPPNPAEM-VGSSRMRSLIEHLSKAH---MVIIDAPPLLPVTDAT
A0A2T0S3C8      -------MWALPSGSLPPNPSEL-LGSQHMADLLEQFREQY--DMVIVDCPPLLPVTDGA
A0A810MDE3      -------MWALPSGSLPPNPSEL-LGSQHMADLLEQFREQY--DMVIVDCPPLLPVTDGA
A0A4Y8WZJ3      ---PS--LQVLASGPIPPNPSEI-LASDRFNDLINALAEDA---LVIIDAPPLLPVTDAA
A0A7X0KT97      ---PN--LFILTSGSAPPNPSEV-LGSERMHHVLDDLSQHA---FVIVDAPPLLPVTDGA
A0A853DGU7      ---N---LRILPAGRVPPNPSEL-VGSDRMRSLLSTLREDH---MVIIDAPPILPVTDAG
A0A7Z0A2Z7      ---G---LHVLASGGLPPNPSEL-LSSEAMQDLMQQLRGRY--DKIIIDAPPLLPVADAI
A0A285VUW0      ---E---MYVLAGGEIPPNPSEL-LGSRAMERLFKQFLRDF--DFVLVDSPPILPVTDAL
A0A849PJI9      ---N---LHVLPAGRVPPNPSEL-LGSQRMAQLVQYLAKDY---LVLLDAPPLLPVTDAG
A0A2R7Z032      ---N---LWLLPAGRIPPNPSEL-LGSLRMSQLIDELARTH---LVLLDAPPLLPVTDAG
A0A6J4MTQ2      ---N---LLLLPAGRIPPNPSEL-LGSKRMDQLVAELARDH---LVLLDAPPLLPVTDAG
A0A1I0W453      ---N---LSLLPAGRIPPNPSEL-LGSLRMKQFIDDLAHDY---LVILDAPPLLPVTDAG
A0A0Q6VV12      ---N---LSVLPAGRIPPNPSEL-LGSLRMKQFIDDLSQDH---LVILDAPPLLPVTDAG
A0A495NTA9      ---N---LSLLPAGRIPPNPSEL-LGSLRMKQFIDDLAQDH---LVILDAPPLLPVTDAG
A0A1H4LCS9      ---N---LSVLPAGRIPPNPSEL-LGSLRMKQFIEDLSHDY---FVILDAPPLLPVTDAG
A0A4Q2RZP8      ---N---LSLLPAGRIPPNPSEL-LGSLRMKQFIEDLSHDY---LVILDAPPLLPVTDAG
A0A0Q9QB08      ---N---LSLLPAGRIPPNPSEL-LGSLRMKQFIDDLSADH---LVILDAPPLLPVTDAG
A0A7Y9H290      ---N---LSLLPAGRIPPNPSEL-LGSLRMKQFIDDLSHDY---FVILDAPPLLPVTDAG
A0A4Q2SA86      ---N---LSLLPAGRIPPNPSEL-LGSLRMKQFIDELSHDY---FVILDAPPLLPVTDAG
A0A4Z1C3Z0      ---N---LSLLPAGRIPPNPSEL-LGSLRMKQFIDELSHDY---FVILDAPPLLPVTDAG
A0A6V8KDX4      ---Q---LFVLPSGSVPPNPSEL-LGSRAMAHLLARQREHY--DLIVIDTPPLVPVTDAA
A0A444BL03      ---N---VRLITSGRTPPNPSEL-LGSARMHELVRELTVDN---IVILDAPPLLPVTDAG
A0A7V9PCQ0      ---H---LWLLPAGVPDRHPADV-V-TVALPRAAEALAAQD--RLLLIDAPPLHGVAETP
A0A4Y8X357      -------LVLLPAGRTPPNPSEQ-LGSSRMRELLEALSETH---MILVDAPPVLPVTDST
R4LD52          -------LWVLPSGFLPPNPSEL-LGSQHMALLMDELRTAF--DTIIVDCPPLLPVTDAA
A0A4T2CD79      ---GN--LRVLGAGSIPPNPSEL-LGSHGMTTLLRELALDA---IVLVDAPPLLPVTDAA
A0A6L6AM03      ---N---LSLLPAGRIPPNPSEL-LGSLRMKQFVDELSVDY---LVILDAPPLLPVTDAG
A0A4Q2RU39      ---N---LSLLPAGRIPPNPSEL-LGSLRMKQLIDELAEEY---LVILDAPPLLPVTDAG
A0A4Q2SK58      ---N---LSLLPAGRIPPNPSEL-LGSLRMKQMIDDLALDY---LVILDAPPLLPVTDAG
A0A2N3YJR1      ---N---VRLITSGRTPPNPSEL-LGSARMHDLVRELSVD---NIVILDAPPLLPVTDAG
A0A6G8FYB9      ---N---VRLVTSGRTPPNPSEL-LGSVRMHELVARLTED---HVVILDAPPLLPVTDAG
A0A4Q4D742      ---G---ISFMGTGPAAPNPAEV-LESRAMRDLLARVRNEF--DTVIIDAPPMLPVADAS
A0A1C6T1J1      ---S---LLVLPSGSTPPNPSEL-LGSKAMADLLLGLRESA--DIVIIDTAPLLAVTDGV
A0A2W2CFC8      ---S---LLVLPAGSAPPNPSEL-LGSKAMADLLLALRESA--DIVIIDTAPLLAVTDGV
A0A2W2A4B0      ---G---LSVIPSGTVPPNPSEL-VGSPAFTALIEDVAALF--DVVIVDTPPLGSVTDAA
A0A4Y9MDA5      ---G---LHVLTAGPVPPNPSEL-LGSPAMRRLLEAAREEY--DHVVVDTAPVLPVADAA
A0A1H7N9P7      ---G---LHVLPSGPVPPNPSGL-LGSPVMRRLLERLRDDY--DHVVLDTAPVLPVSDAA
A0A1M7V0F8      ---G---LHVLASGPVPPNPSEL-LGSPAMRRLLERLRDEY--DHVVLDTAPVLPVADAA
A0A1M3LEY6      ---N---LSLLPAGAMPPNPSEL-LGSQAMVNLLRHVEKEY--DVVLIDGPPLLPVTDSA
A0A538AJI7      ---N---VWILPTAHDPEA--GD-LLARRLTDVLDEARENF--DLVVIDTPPLLSTDDAR
A0A538AM15      ---N---LSVIPAGQAPPSPYEV-LKSPRLGELLEEARLRY--DYVVLDTPPLCPVQDCR
A0A520EHH5      ---D---LWALGSGPAPPNPSEL-LGSSTAQSLLRDLGRAF--DYVVVDSPPLLPVTDAA
A0A4R0U4F1      ---N---FHVLPAGKQTMNPSIL-LNSRAMKALVEQVSGAY--DYVIIDTAPMQVANDAA
A0A1V8PLV6      ---N---LHILPAGPKPLNASML-LNSKTMSKLLDTALHTY--DYVIVDTAPMVVANDAA
A0A357ZCV8      ---N---LFFLDTEPNIPSPTDV-LSSKSFAKLVEVLESNF--EYVIFDTPPVGTFVDAA
A0A419GS64      ---G---LTVIGSGPPPPNPSEI-ISSRRFRKFIKNASAAY--DTVIIDTPPVGIVSDAA
A0A4R1CW45      ---K---LAVFPTHTVSMDSAEA-IASGRFDTLVETMRKHTGEAVVIFDLPPVFANDDAV
A0A4R5Z7B0      ---D---LYILTSGPVPPNPAEL-LSSKSMEQFIEEAKEQF--DYVLFDTPPLLAVADPQ
A0A542H054      ---N---LDLLTCGPIPPNPAEL-LSSRSMEELLKDIYQDY--DMVVFDTPPLLAVTDAQ
A0A6M8GFV5      ---N---LSILTSGPIPPNPSEL-LSSEKMKNLITLMYEQY--DMVLFDAPPLLAVTDAQ
A0A7G8U6J2      ---N---LDILTSGPIPPNPSEL-LNSKAIETAIDELKEIY--DYIIFDTPPVLVVPDSQ
A0A2S8MDM2      ---G---LTVLTSGSIPPNPSEL-LGSQSARRLLSELRSQY--DYVVVDSTPLLAVTDAA
A0A357ZDL3      ---N---LFFLDAEAGIPNPVDI-LSSNRFKALVKTLREGF--DYVVFDSPPLGPFVDAA
A0A1I6GVG4      ---Q---LLVVTAGKVPPNPSEV-LGSARMRELLKSIARE---AIVIIDAPPLIPVTDAA
A0A1I6IST1      ---Q---LLVVTAGKVPPNPSEV-LGSARMRELLKSIARE---AIVIIDAPPLIPVTDAA
A0A412JBM5      ---P---LDIAFCGVIPPNPSEL-LSSTRMKRFLEASRKAY--DYVIVDTAPINTVADAQ
A0A6J4SUA1      ---R---LSLIPCGTRRRRGPEL-LASANMASLVDLLRTRY--DAILIDSAPLGAGTDAY
A0A1C2B334      ---R---LDVLATGQLPPNPAEL-LGSSRARELFDTLAASY--DYVIVDTPPILPVSDGA
R7Y679          ---G---FDVLAAGALPPNPAEL-LGSRRTGQLLDELCELY--DYVLVDSPPVLPVTDAV
A0A4Y8ZIU8      ---G---LLLLPAGRTPPNPSEQ-LGSARMRDLLTALA-ET--HMVLVDAPPVLPVTDST
A0A0F0KYJ9      ---Q---LLVVAAGKVPPNPSEV-LGSARMRELLKSIARE---AIVIVDAPPLVPVTDAA
A0A838H149      ---N---LRILTTGPLPPNPAEL-LGSQRMRVIVDRLKAEA--EVVIFDSPPLQAVTDAS
A0A7M2YYB9      ---V---LHLLAAGTTLPNVGDV-ASSEAMETLFASVTALY--DLVVVDTPPLLAASDAA
A0A7K0LE65      ---F---LRVLSSGPPVEDPSAI-LGARAFRVVLDTLR-AV--RLVVVDTPPSGLFSDAL
A0A838JYQ6      ---G---LKVLTAGPTPPNPAEV-LSTQRFAEFMQQAREEF--DYVLLDGPPLGPVADSA
A0A510HHA8      ---N---LKVCPSGPVPPNPAEL-LSSNRFSALVEEARETF--DYVLIDSPPVEPVADPL
A0A6G8Q9J3      ---R---LKVVAGGPTPPNPAEL-LGSRRFSELLGRASREF--DYVLLDAPPLELVSDAA
A0A538BBM6      ---G---MYFLSTGSSVSNPTEL-LGAGRTARLLGALAEQA--DLVLVDTAPVLPVADTL
A0A5Q2F9A3      ---T---LQVLTSGPVPPNPAEL-LGSISMVRLLECATHEY--DAVVIDAPPLLPVTDAA
A0A0K8Q3D9      ---N---LSVLGSGRIPPNPSEL-LGSRAMKNMLQALA-QN--ATVLIDAPPLLPVTDAA
A0A2R7RCA1      ---N---LSVLGSGRIPPNPSEL-LGSQAMKNMLNALA-EN--AIVLIDAPPLLPVTDAA
A0A1Q7WJN6      ---G---LSFIGCGSRRHRGPEL-LSSAAMPRLVASLRPHY--EAIIVDTPPLVAGVDAF
A0A1E2SNF6      ---H---IRVLTAGRTPPNPSEL-LGSRTMRELLAALS-EL--AVVIVDAPPLLPVTDAA
Q6ADE8          ---H---IRVLTAGRTPPNPSEL-LGSRTMRELLAALS-EL--AVVIVDAPPLLPVTDAA
A0A1Q7CZ24      ---N---LSVLPAGRATVAPYEL-LKSPRLEALLDEARQRY--DYIVLDTPPFVPVPDCR
A0A2W6VLC6      ---G---FSVLPAGRIPPNPSEL-LSSPRMKQLIAQLSLAY--DVVIIDAPPLLPVSDAA
A0A519G798      ---G---IYFLASGPIPPNPTEV-LQSRAAQELFDRVSQMF--DMVIIDGPPLLPVSDAA
A0A7V8X3I0      ---G---LYLLAAGPLVASPAEL-LSSVRIKRLLDALAAQA--DVVLIDSPPVLPIVDTL
A0A7V8YPJ0      ---G---MYFLGTGPQVSSPTEL-LATPRTGRLLGSLAAQA--DIVLLDTPPVLPVADTL
A0A7X7Q7T7      ---Y---FYVLPAGTVPPNPSEL-LGSEAMAHLLATVERQF--DYVLFDAPPMLPVTDAV
A0A6G8QDQ0      -------LKVATVGPLPSRPAEL-LGSKRFSELLEKAREQF--DYVLLDAPPTAPVSDPA
A0A023X491      -------LSVLTSGPVPPNPAEL-LGSERFGALLGDLARRF--EYVLIDVPPVQVVSDAA
A0A4R1BMZ2      -------LNVLTCGPIPPNPAEL-LSSQRFAEFVARVRAEF--DYVLIDAPPVGLVSDPV
A0A838JNW7      -------LQVVTSGPLPPDPAAL-LSSRRFSNFLEEARQRF--DYVLLDVPPTEIVSDPV
                                                             :..*  *     :  

A0A519GXS6      VISQYVDATVIVVNTRRTGKAKIEQAVAALQSVRANLAGIVLNNVAVSRR----------
A0A6N6NKS9      IISNLVDGTLYVIRERAAKRDAVVAGVQQLKAANARILGSVITFSRE-EA----------
A0A538BYZ4      VIEKWVDGFLLVVAARKTPRKLLEEALTVMDP--AKILGLVFNGEDR-------------
A0A348NU28      LLAPFVDGVIVVVDAGKTRRNQLIQAAASLESAGGRIVGLVLNKVRR-KR----------
A0A2N4T4Q5      LLTASADGALVVATAQGTTVDELGKALGNIEHVRGRVLGVVLNHVPT-TG----------
A0A4Q5APW3      IFVRRGGSLIMVCRRDQTLKRDLREISEELTTLDLSANGVIFNCARESKK----------
A0A4Q5B0V3      IFVRRGGSLIMVCRRDQTLKRDLREISEELTTLDLSANGVIFNCARESKK----------
A0A022KX11      VIERLTGGLLMVVGVDRTKKRDLAAALKQLETVGAHVSGFARNFVAS-KG----------
A0A4Q5A868      IFVRRGGSLVMVCRRDQTLKRDLREISEELATLDLSANGVIFNCARE-SK----------
A0A6N4VXX3      LLAADADGALLLARYGKTRRDQLTHASEALASVGAAMLGTVFTMMPP-------------
A0A1H4I042      LLAANADGALLLGRYGQTRRDQLKNATDALQNVGAALLGSVFVMTPP-------------
A0A4R7A6D9      LLAANADGALLLGRYGQTRRDQLKNATDALQNVGAALLGSVFVMTPP-------------
A0A345NSU7      VIEKLTGGMLMVVASGETRKRHVSEAMRVLETTGTHVAGFVLTKAPA-------------
A0A222TG79      IASRLVDGVIVVVRSGASRRPDLESMLSHLGRANAAVVGVVLGDAQSRAG----------
A0A0W8I9Y2      LLTASADGAIIVATAQKTTTDELSKALENLHQVHGNVLGVVLNRVPT-TG----------
A0A7C6LSF9      DLLPIVDTVLFVVRNGRITEGAAQRVSELLGRFHVPVTGAILVGIQT-------------
A0A255G8R8      VLGKLVGGALLVTGIERVKKPQLAESLAALGTVDVKVQGVVLNMVRRKER----------
A0A6G7Y423      VLASQTGGAILVARSGVVRRPQFEGAVDLLKAGDVATLGVVLNDVTSPEK----------
A0A4Q4D4T1      LLSVISDGAILVVRHGRTGHDQVRAASERITTVGGRLLGTIISMSPK-------------
A0A1Q2CRV2      VLAGETAGVLVVVGSGIVRRPELTASLEVLERVEARVLGLVFNRVKRSEG----------
A0A261FE22      LFAREGATLLLVVAQTVGRKKVLRDVAHEFKVSRVKISGVAFNRVAH-------------
A0A7K0NRJ7      AVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTEV-VN----------
K6WHS4          VVSRLVDGVLVVVRIDKSAKHELSDTTRQMDTAGVHAMGVVINGTPV-RQS---------
A0A7K0NTR2      ELSTFCDATILMVRAGWTRRGGVVAASDLLRRLEATTVGIVLVGAEH-GAR---------
A0A1H6WL79      VLSRVADGTLVVARARKTTRDTLYRALSNLTRVQGRVLGVILNCVAT-KG----------
A0A101LAM5      VLSRVADGTLVVARARKTTRDTLYRALGNLTRVRGRVLGVILNCVAT-KG----------
A0A4Y3NEG0      VLSRVADGTLVVARARKTTRDTLFRALGNLTRVRGRVLGVILNCVAT-NG----------
A0A1Q2CI19      DILPHVDDVVLVARSGRLSAASAQRTKEMLARFNIPVVGAVIVGAPL-RK----------
A0A512T3M3      DLLPLVDTIMLVVRSGRLSETSGNRVSELLGRFRVPVSGVLLIGTSR-SR----------
W6JTW4          DILPLVDTVLVVVRSGRITHAAGSRLAELLGRFKVPVSGVLLIGSKA-SR----------
A0A839J1M0      DILPLADAIVLVVRAGRLTENAAHRVAELLGRFRVPVTGAILIAGHV-RK----------
A0A8A4Z8K4      DILPLADAIVLVVRAGRLTENAAHRVAELLGRFRVPVTGAILIAGHV-RK----------
A0A0A0JTY0      DILPMVDTLLLVVRSGRLTEVAGNRVAELVGRFQVPVSGVLIVGAPT-KR----------
A0A0A0JXF2      DILPMVDTILLVVRSGRLTEPDGNRVAELVGRFQVPVSGVILVGAKA-RR----------
E6S8H2          DVLPLVDTVLLVVRSGRLTEVAGHRVSELLGRFQVPVAGVVVVGAQS-KR----------
A0A0A0JGH0      DILPIVDTVVLVVRSGRLTDVAARRVAELLGRFQVPISGVVLVGARG-RR----------
N0E4U7          DVLPIVDTVLLVVRSGRLTDVAAHRVAELLGRFQVPISGVVLVGARG-RR----------
A0A0A0IYK2      DILPMVDTLLLVVRSGRLTELAGNRVAELVGRFQVPVSGVILLGAPE-KR----------
A0A0Q9L0H3      DVLPTVDTLLLVVRSGRLTEVSGNRVAELVGRFQVPVSGVIIVGAQT-MR----------
A3TMK0          DILPMVDTLLLVVRHGRLTEVAGNRVAELVGRFQVPVSGVIIVGAKA-KL----------
A0A543PXP1      DLLPLVDTVLMVVRNGRITEVAGRRVSELLGRFNVPVSGVLIVGVRT-E-----------
A3TMH6          DVLPVVDTVVVVVRHGRITDVAGRRVAELLGRFHVPVTGVVIVGAPT-RG----------
A0A6I2XCV4      DLLASADLTMLVIRSGQTRTVAAERVSGLLARFGAPVIGTIFNGCSA-ADMEGYYGYYGA
A0A5R8VLL6      LLAKIADGAIVVVRAGQTTKEQLTKSLGNIRKVNATILGTLLNCVPA-KEFEG-------
A0A3L7ADK2      VLANSADGVVLVASARNTTYEQFGRAQQLIKRGGAHLLGTVLNRVPT-SGQD--------
A0A538JQF8      DFMPEVDCVIPVLKCGSTTNDAAFRMGELLVRMGARVLGVVLVGVPT-SR----------
A0A1H6YPK1      VLAARTDGALVVARAGATSADMLEEALRILDRVQGRALGVILDGVAP-VGPRVKH-----
A0A0Q9TBP0      ELAALADMVVVVTRERVSRRRQLVAVRETLRQVSVESVGIVYNGVGD-SA----------
A0A0G3V3M7      ELSTFCDATVLMVRAGWTRRGGVVAASDLLRRLEATTVGVVLVGAEH-GAR---------
A0A6I3DD56      ELSTFCDATVLMVRAGWTRRGGVVAASDLLRRLEATTVGIVLVGAEH-GAR---------
A0A5Q2FA83      LIDRLVGGMLMVISVNTTLKRDLAQAVKQLRTVDAKVAGFALNRMP--------------
A0A2R7MGI0      VIASWADGAVLVVTAGRTTDDMLTRAIENISKTRGRLLGIVLNRVPL-RGPD--------
A0A2T7WQY4      VIGSWADGVVLVVTAGRTTDDMLTRAVDNLSKTRGRLLGIVLNRAPL-RGPD--------
A0A0Q5Q5L3      VIASWADGTVLVVTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAPL-RGAD--------
A0A0Q6DVM4      VIASWADGTVLVVTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAPL-RGAD--------
A0A1N7DLV3      VIANWADGAVLVVTAGRTTDDMLQRAVGNIAKTRGRLLGVVLNRVPL-RGAD--------
A0A1V2NSB5      VIASWADGAVLVVTAGRTTDDMLQRAVGNIAKTRGRLLGVVLNRVPL-RGAD--------
A0A1R3WWR6      VIASWADGAVLVVTAGRTTDDMLSRATENISKTRGHLLGVVLNRAPL-RGVD--------
A0A1G6GTN3      VIASWADGAVLVVTAGRTTDDMLTRATENIAKTRGHLLGVVLNRMPV-RGVD--------
A0A7W5GFA5      VIASWADGAVLVVTAGRTTDDMLTRATDNITKTRGHLLGIVLNRMPL-RGAD--------
A0A2S5WZJ5      VLSTRVDGVVLVATAGRTRREDASAARDMIDQVNGRLLGTVLNMVPP-RDT---------
A0A0Q5JKD6      VIASWADGAVLVVTAGRTTDDMLTRATDNIAKTRGHLLGVVLNRMPL-RGAD--------
A0A2W6DK08      DLMPYVDTVLVVSYASRTTSEEARRASELLARTRAPAIGVALVGVKG-RS----------
A0A346XTB0      IVAGSVDGIVIVVSHG-TPFSELQKVKERLKFVSTPLLGYVFNRSDS-ST----------
A0A542FTE6      VLSTIADGVIMTVDAASSTQDQLQRAVGAVHRVGGKILGVVLNRVPE-R-----------
A0A7Y9QM02      VLATVADGVIMTVDAASSTQDQLQRAVGAVHRVGGKILGVVLNRVPE-R-----------
A0A6I1G2U1      DILPIVDTVLFVVRSGRLTEAAGLRVSELLGRFHVPVTGAILVGTPS-RR----------
A0A351ETF8      LIGRAVNGQILLTRLGATKRSDLAEAAKLLATNGSRSLGVVVNRDQE-S-----------
A0A349B7N2      DLLDVADQVVVVARSGKTSRQSADRMSELLARLSAKVVGVVL------------------
A0A4Q2JUT1      VLAHQADGALVVVTLGKTTYDLLEKALDTLRKARGRALGIVLNKAPI-RG----------
A0A6L5R0V7      VLAHQADGALVVVTLGKTTYDLLDKALDTLRKARGRALGIVLNKAPI-RG----------
A0A2S0LQ32      LLSALADGAILTFEVGGTYKEQARLTGKILGQVDARLLGVVLNRASR-RSMG--------
A0A7T8DZN6      LLSALADGAILTFEVGGTYKEQARLTGKILGQVDARLLGVVLNRASR-RSMG--------
A0A2N6V1R5      LLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRASR-RNLG--------
G9PHS6          LLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRASR-RNLG--------
U1PLM7          LLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRASR-RNLG--------
A0A4V1VGV9      LLAVAADGAAVVYQHGRTHREQVGLCAKILEQVGAHYYGSILNMTPP-KQMGSTIYGYGA
A0A2S5UYV0      ILSTRVDGVVLVATAGRTRREDVGAARDMLSQVHGRLLGTVLNMVPP-RDT---------
A0A7W4UQ09      VLSTRVDGVVLVATAGRTRREDVASARDMLDQVNGRLLGTVLNMVPP-RDT---------
A0A2S5X9U6      VLSTRVDGVVLVASAGRTRREDVSAARDMLKQVHSRMLGTVLNMVPP-RDT---------
A0A2S5ULV5      VLSTRVDGVVLVASAGRTRREDVMAARDMLKQVHSRMLGTVLNMVPP-RDS---------
A0A653YMF0      VLSTRVDGVVLVASAGRTRREDVAAARDMLKQVHSRMLGTVLNMVPP-RDS---------
A0A7V9H755      ILATIADGVIIVLRAGATETTAAQQSMQQLNAVGARVVGAVLNDPD--------------
A0A3Q9IY80      VLSHSADGAIIITSVGKTTFEALTKALQNLERAGSRALGVVLNRVPR-KGR---------
A0A0F0LP73      VMSAFVDGVVFVIAMGRTRKTEVVEARTQLAQIRARILGVVLNFVAM-R-----------
A0A346Y185      AIATNVDGIVVVVSRG-TSMKLLEEMRERLDRIGTPVLGYIYTKAKL-DG----------
A0A7W0HGW1      PLANLVDGVILIARADVTRRRDLVDAMAQLEQVSSHLLAVVVSQVRN-TKDGRY------
A0A259S8H9      VLSSVVDGLVFVVAMGRTRRVEIVEARTQLEQVRARVLGVVLNLVSL-RG----------
A0A2W1Z497      VLAAGADGLVVTVSAQGTTIDQLGRALQLVARGGGTVLGAVLNRVPT-RG----------
A0A0Q5L115      VLAAKADGVLMTASAARTTFDQLDRALQLVTRGGGDVLGVVLNRVPT-KG----------
A0A7G6YY64      VLAAKADGVLMTASAARTTFDQLDRALQLVTRGGGDVLGVVLNRVPT-KG----------
A0A7J5B4S5      ILSTRVDGVVLVATAGRTRREDVGAARDMLSQVHGRLLGTVLNMVPP-RDT---------
A0A852U976      ILSTRVDGVVLVATAGRTRREDVGAARDMLSQVHGRLLGTVLNMVPP-RDT---------
A0A1F1X071      LLTRHSDGAILVAVPGQTRTAAMQKAVEAIRAVNGTVYGAVLNRAST-GRLNRLAYG---
A0A3R8RWC7      LLTRHSDGAILVAVPGQTRTAAMQKAVEAIRAVNGTAYGAVLNRAST-GRLNRLAYG---
A0A4U0RJZ4      LLSVAASGAAVVYHHGTTHKEQIALCTKILDQVGAHYFGSILNMTPP-RSMGSTVYGYGA
A0A4R1FGL9      LLSVAASGAAVVYHHGTTHKEQIALCTKILDQVGAHYFGSILNMTPP-RSMGSTVYGYGA
E3B8H1          LLSVAASGAAVVYHHGTTHKEQIALCTKILDQVGAHYFGSILNMTPP-RSMGSTVYGYGA
A0A7D7WDT9      VVSTMVDGVVFVLAVGQTRKTAGAVARAQLEQVNARVLGVVLNLVSL-NG----------
A0A0Q5AWK6      IVATVVDGVVFVVASNRTRRPEVTAARRILAQVRGRVLGTVLNMVTA-QD----------
A0A6P1F176      IVATVVDGIVFVVASNRTRRPEVTAARRIVQQVHGRVLGTVLNMVSA-QD----------
A0A3N1NLD3      IVATVVDGVVFVVASNRTRRPEVTAARRIVQQVRGRVLGTVLNMVSA-QD----------
A0A3N2FVI8      IVATVVDGVVFVVASNRTRRPEVTAARRIVQQVRGRVLGTVLNMVSA-QD----------
A0A2S5XDQ6      IVATVVDGVVFVVASNQTHRPEVVAARRIVQQVRARVLGTVLNMVTA-RD----------
A0A2S5XNN6      IVATVVDGVVFVVASNQTRRPEVVAARRIVQQVRARVLGTVLNMVTA-RD----------
A0A5C8C085      VLTTMADGAFIVVSAGRTLDNELEASLEHIKAVNGTTLGIVFNGVAA-------------
A0A4Y5YMQ6      IISQYVDSTIVVVNTRKTTRAQLERCLAALRGVGANLAGLVLNNVRE-QK----------
A0A1E4BP96      VLSRVTDGALLVTSAGRTTHEMLQRSLENIAKVNGRLLGVVLNKATR-RG----------
A0A7V9FXS6      TVVPMAKAVLLVVSRG-TLARYVEEAVATVDALKRPLLGIVVNRI---RG----------
A0A7W0PY69      ALAPIADGVLIVVAAG-SVASPVNEAILAVESLKAPLLGIIGNRI---KE----------
A0A7W8YB99      VLAKASDGALIVVKAGKPTIDELAKATENLDRVGANRLGVILNQVPT-KG----------
A0A1L2ZMQ6      VLAKASDGALIVVKAGKPTIDELAKATENLDRVGANKLGVILNQVPT-RG----------
A0A7W8TR75      VLAKVSDGALIVVKAGKPTIDELAKATENLDRVGANKLGVILNQVPT-RG----------
A0A151BT98      ELEKLTGNLILVARGGQVSRRELQITLKALETVDANLSGTVLNYADH-------------
A0A2Y8ZRF8      ELEKLAGNLILVARGGQVSRRELQVTLKALETVDANLSGTVLNYADS-------------
A0A2R9UAT1      VLTHSADGAIVVVGAGRTTIDVLKKAMNNLERAGGRALGVVLNRVPR-------------
A0A3E2DN22      LLGAIADGTIYVAVVGKTHRDQVSLVAKRLEQVGAPLLGSVLTRVPR-KK----------
A0A3Q9ULZ9      LLATSTDGVIMVHVVGGTHKEQVTLCTKRLEQVGAVLLGSVLTRAPR-KA----------
A0A3S9JFL2      LLATSTDGVIMVNVVGGTHKEQVTLCTKRLEQVGAVLLGSVLTRAPK-KA----------
A0A3L8NYD3      LLSGIVDGSILVLAVGKTYKEQARLAAKVLQQVGGHVLGSVLNRAPL-GG----------
A0A1M6K628      LVSAVSDGVLLVVQHGKTLREQIALATRNLDNVDAALLGFVMNQVPK-KD----------
A0A561E8R3      LLARSADGALLVMHVGRTRAEHIRLCARILTQVGGRLFGGVMNLTPP-KN----------
A0A4Q5J5D7      VLTAVADGAFVVISSGRTVDTELRDALANLDAVRGRALGVILNRVAR-RD----------
A0A1Y4CKD6      MLANWVDEVLFVVRFDKVGRHNVQDALSMLDGERASVLGYVLNGCPQTAG----------
A0A0Q7KBQ4      ILMREVDGALMLVRHGSTTREQLRLAVARIETVGGKLFGTILNRTPR-RA----------
A0A5Q5BFU2      ILAAGADGVLIMARFGHTTHEQLTHAVGSLESVGAALLGAVFTMIPT-RN----------
A0A439DNZ6      ILAAASDGVLIVARYGETKREQLAHAVGNLRSVGAPILGAVFTITPT-RG----------
A0A7I7UD03      ILAAAADGVLIMARFGSTKREQLAHAVGNLESVGAPLLGAVFTLMPT-RG----------
A0A7I7MI62      ILAAGADGVLIMARYGHTRREQLIHAVESLESVGAPVLGAVFTMVPT-RG----------
A0A0J6YE86      ILAAGADGVLIMARFGQTKREQLAHAVGSLESVGAPLLGAVFTMVPT-RG----------
A0A7I7K1R9      ILAAGADGVLLMARFGHTRREQLIHAVGSLESVGAPLLGAVFTLMPT-RG----------
A0A7I9ZLK4      ILAAAADGVLIIARFGQTKREQLVHAAENLASVGAPLLGAVFTMMPT-RG----------
A0A1F1IHY9      ILARRFDGCLLVVSAGRTTYDEFSKAVSSIRKIDGEVLGAVLNRVPA-SG----------
A0A7H2BCD6      LLSKAVDGTVLVATIGGTQREHLREATENLHQVKANLIGLVLNQTPR-GG----------
A0A3S0V9U6      LLSTSVDGAILVTKVGSTRRDQAEGAKAMIDKVQGNVLGAVMNMAPA-KG----------
A0A7T4T4U7      LLSANVDGAILVSVCGRTRKDQAQAAAQALGRVNGHLLGTVMNMTPE-KG----------
A0A1S2N0P2      LLSANVDGAILVSVCGRTRKDQAQAAAQALGRVNGHLLGTVMNMTPE-KG----------
A0A0Q3BEY5      LLSANVDGAILVNVCGRTRKDQAQAAAQALGRVNGHLLGTVMNMTPE-KG----------
A0A4R6Q3C6      LLSANVDGAILVNVCGRTRKDQAQAAAQALGRVNGHLLGTVMNMTPE-KG----------
A0A7T3CHP7      LLSANVDGAILVSVCGRTRKDQAQAAAQALGRVNGHLLGTVMNMTPE-KG----------
A0A7Y5U6C1      GLSARVDAMLVVVRLNEIKRTELKELGRMLDAALAPKLGFVVTGADEEPD----------
A0A542HCT5      VLTASADGALVVVSAGQTLDTQLRDALANLAAVNGHTLGVVLNRVSP-KS----------
A0A537WNY9      VIARFADASVIVVSAGSATRRQLRTAIERLSVISVRPTAVVLNDAPI-------------
A0A5B8M469      LVGAVADGTLFVVAVGQTRKAEVTAARRLLEQAKSRLLGVVLNKVPVNDR----------
A0A2S8WHZ8      ILSTSADGILVVVRAGSTTGDELGKAIENLKKVDANILGAILNQVPT-KG----------
A0A1Y4CTD2      LWMRQVDTVVLVVRQDMTDVRVINDTVDVAWKSAGDFSGFVLNAF---QG----------
A0A3N3ZPU0      VLAKGADGVVIVTQANKTNLDDLTKAVARLHTVGATILGAVLNQVPR-KG----------
A0A359IQX7      LLTAAADGAILVMATGRTYKEQLRVCARILKQVNGRLLGSVMNLAPL-RG----------
A0A7W9IKV0      TLAVICDGALLVARHGKTRREHIAHAAQMLASINARVVGTVLNFAPS-RG----------
A0A1N7E3F1      ALGAICDGALLVVRHGKTRNEQVLRAGELLSSINARLVGTVLNFVPA-KH----------
A0A544ZKQ1      ALGAICDGALLVVRHGKTRREQVLRAGELLSSINARLVGTVLNFVPA-KH----------
A0A5D0Q2X0      ALGAICDGALLVVRHGKTRREQVLRAGELLSSINARLVGTVLNFVPA-KH----------
A0A5R8Z2E7      ALGAICDGALLVVRHGKTRREQVLRAGELLSSINARLVGTVLNFVPA-KH----------
A0A0Q9LZR0      VLTASADGALVVVSAGHTLDTQLRDALANLATVNGHTLGVVLNRVSP-KS----------
A0A1F1J417      LLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPR-KG----------
A0A2A8D6P2      LLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPR-KG----------
A0A1F0THV9      LLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPR-KG----------
A0A5F0M6Y0      LLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPR-KG----------
E3H5W1          LLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPR-KG----------
A0A1F1QKB0      LLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPR-KG----------
A0A509JY23      LLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPR-KG----------
A0A448USF4      LLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPR-KG----------
A0A7Z9A2N0      LLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPR-KG----------
A0A433EDP2      LLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPR-KG----------
A0A231VTW0      LLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPR-KG----------
A0A433ECD0      LLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPR-KG----------
A0A7T9UPU8      LLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPR-KG----------
U7V3Z1          LLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPR-KG----------
A0A6I3F378      AVSRHADGTILVVRSGRTRSQQLQRTLGEFDRIGSPVLGIVL------NG----------
A0A838H0S5      AIASQVDGIVIVVTRG-TPLRQLEEVRERLQFIGTPVLGYVFNRSDVGRG----------
A0A1S1CQC5      LLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPR-KG----------
A0A1E9T6I0      LLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPR-KG----------
A0A1F1GHA7      LLSHSVDGVILVGSIGRSHREQMAEASSILKKVNANLFGLVLNRAPR-KG----------
A0A1S1CAD0      LLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPR-KG----------
G5ET14          LLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPR-KG----------
A0A1E9DXX2      LLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPR-KG----------
A0A1E8S156      LLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPR-KG----------
A0A1E8S5S2      LLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPR-KG----------
A0A1S1DFA8      LLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPR-KG----------
A0A2I1Z490      LLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLLGMVLNRAPR-KG----------
A0A1F0DAA9      LLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAPR-KG----------
A0A1F0PHK9      LLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAPR-KG----------
A0A1F0VZG6      LLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAPR-KG----------
A0A1E9G8X4      LLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPR-KG----------
A0A1E9IAW2      LLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPR-KG----------
A0A1E9ZBC9      LLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPR-KG----------
A0A1E9ZDP4      LLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPR-KG----------
A0A1F0R6B5      LLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPR-KG----------
A0A1F0Z7N5      LLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPR-KG----------
A0A1F1D897      LLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPR-KG----------
D2NP38          LLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPR-KG----------
A0A1F1FV74      LLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPR-KG----------
A0A1E9M791      LLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPR-KG----------
A0A291DEI8      LLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPR-KG----------
A0A1S1D5T1      LLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPR-KG----------
A0A1E8TRD6      LLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPR-KG----------
A0A1F0XT88      LLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPR-KG----------
A0A1F1EVP5      LLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPR-KG----------
C6R548          LLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPR-KG----------
A0A0K2RXS2      LLSHSVDGVILVGSIGRSHREQMTEAASILKKVNAKLLGMVLNRAPR-KG----------
A0A1F0KX60      LLSHSVDGVILVGSIGRSHREQMTEAASILKKVNAKLLGMVLNRAPR-KG----------
A0A542I3V2      VLSRAADGVIVVAKAGRTTRDEFERSLRALQKVQAPVLGAIFNCVPT-KG----------
A0A2T0UZ65      LLSGAADGTILVFAVGKTHKDQVEACAKMIQQVGGRILGIVLNMAPK-RG----------
A0A0Q5M6Z7      IMGTIADGVVITVGAKQVTGEQLEKAYRSVVRVNGKVLGVVLNKIPP-RG----------
A0A7G6YA19      ILGTIADGVVITVGAKQVTAEQLQKAYRSVSRVNGKVLGAVLNKIPP-NG----------
A0A853CXS3      ILGTIADGVVIAVGAKQVTAEQLQKAYRSVTRVNGKVLGAVLNKIPP-NG----------
A0A7W8YB56      VLSTSADGVLVVAKAGKTSIEDLKKATDRLQRVNGHVLGVVLNHVPR-KG----------
A0A1L2ZMV4      VLSTSADGVLVVARAGSTSIEALKKATDRLDRVNGHVLGVVLNQVPR-KG----------
A0A7W8TSW5      VLSTSADGVLVVARAGSTSIEALKKATDRLERVNGHVLGVVLNQVPR-KG----------
A0A1R4JTI6      ILAAKYDGCVLVVTAGRTTRDELAKSLGNLEKVNGDVLGTVLNRVPT-RG----------
A0A4R7TM52      VLAHNADGAMIVASVGKTTVERLQKAIQNLDRAGARCLGVVINRVPV-RG----------
A0A542XE74      LLSAAADGTILVTRLGRTHRAALEQSTKLLDQTKARLLGVVLNAASK-RS----------
A0A0Q7QDF6      LLSVISDGAILVVRHGRTGHDQVRAASERITTVGGRLLGTIISMSPK-KE----------
A0A7X7XPM3      LINRLVGGMLLVVTAGQTTKRDLGAALRALDTVDSEVAGFALNQLEG-GG----------
A0A5R8L819      VLSRQADGAIIVVTAGKTTYDLLKRALANIEKVGGRALGVVLNRVPK-RG----------
A0A7K0PFV4      PLLGDVDDVLVVGRPGSTDDRALGAMAGYLRRAGVAPTGWIVT-----------------
A0A0G3V3F3      AVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVN-----------------
A0A7K0MUQ7      AVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVN-----------------
A0A7K0U619      AVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVN-----------------
A0A6I3DFP2      AVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVN-----------------
A0A7K0SI36      AVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVN-----------------
A0A7K0V140      AVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVN-----------------
A0A261FQA1      VFAKEGGTLLMVVGQGVAQKKTLKASAEEFELVGVKPAGAVVDMVKE-QR----------
A0A1Q2CJ92      LLSASADGAVVVVQSGTTRREQLEVAAHKLRQVDGNLLGVVLNKVAK-KD----------
A0A2T0S3C8      VVAARADGALLLARSHKTTSSQIQTAARALQSVDARLLGCVFNMVSA-KG----------
A0A810MDE3      VVAARADGALLLARSHKTTSSQIQTAARALQSVDARLLGCVFNMVSA-KG----------
A0A4Y8WZJ3      ILARRFDGCLLVVSAGRTTYDEFSKAVSSIRKIDGEVLGAVLNRVPA-SG----------
A0A7X0KT97      VLTHQADGALLVLTIGKTTYELLDRSLDALRKSSGRALGLVLNRAPV-RG----------
A0A853DGU7      LLAAAADGAVLVAVMGRTAKEQLRVSVSMLERINARLLGSVINRAPA-RG----------
A0A7Z0A2Z7      VAAELSDGVLFVIRHGRTTRATVTDSVRSLKSVEARLVGTVLNMRKL-SR----------
A0A285VUW0      VMSRLTGGLLMVVSAASTRRRHLQEALRTLEAAEAEVSGFVLTKTPA-ER----------
A0A849PJI9      LLSAHCDGAILVLQVGKSRVEHAQLSAKMMDHVKARLYGVVLNMAPR-RG----------
A0A2R7Z032      LLSAFCDGALLVQATGQTYIEQSEHCRRILDQVGSRLLGIVLNKAPL-KG----------
A0A6J4MTQ2      LLTAFCDGALLVQTTGKTQIEQSQHCRRILDQVGGRLLGVVLNKAPV-RG----------
A0A1I0W453      LLSAFCDGALLVQAAGKTQIEQSQSCRRILDQVGSRLLGVVLNKAPV-KG----------
A0A0Q6VV12      LLSAFCDGALLVQAAGRTQIEQSQQCRRILDQVGSRLLGVVLNKAPV-KG----------
A0A495NTA9      LLSAFCDGALLVQAAGRTQIEQSQHCRRILDQVGSRLLGVVLNKAPV-KG----------
A0A1H4LCS9      LLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGGRLLGVVLNKAPI-KG----------
A0A4Q2RZP8      LLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGSRLLGVVLNKAPV-KG----------
A0A0Q9QB08      LLSAFCDGALLVQAAGKTQIEQSQQCRRILDQVGSRLLGVVLNKAPV-KG----------
A0A7Y9H290      LLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGSRLLGVVLNKAPI-KG----------
A0A4Q2SA86      LLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGSRLLGVVLNKAPV-KG----------
A0A4Z1C3Z0      LLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGSRLLGVVLNKAPV-KG----------
A0A6V8KDX4      VLTAMADGAVMVARSGKTSTAQIRTGLARLRAVDARVLGCVLNMQAT-KA----------
A0A444BL03      VLSASCDGSLLVFAVGRTHKEQAELAARMMGQVGGRVLGVVLNMAPK-RR----------
A0A7V9PCQ0      FVLSVAHHVILVVDAASVKLIELEQAVERLRGSGLVLLGVVINRVRS-QG----------
A0A4Y8X357      LLANAVDGTILVVRHGTTRKEHVEVARDMLARVHARVLGVVLNGVPA-SG----------
R4LD52          VVAARADGALLLARSHKTTTAQVSNAVTALQSVDARLLGCVLNMVAA-KG----------
A0A4T2CD79      ILAAISDGAIIVVSAGRTTTDELERALAGISMGGGRTLGVVLNRVPT-KG----------
A0A6L6AM03      LLSAFCDGALLVQAAGKTQIEQSQQCRRILDQVGSRLLGVVLNKAPV-KG----------
A0A4Q2RU39      LLSAFCDGALLVQASGKTHIEQSQHCRRILDQVGSRLLGVVLNKAPV-KG----------
A0A4Q2SK58      LLSAFCDGALLVQASGKTQIEQSQHCRRILDQVGSRLLGVVLNKAPI-KG----------
A0A2N3YJR1      VLSASCDGALFVFAVGKTHREQARLAARMMGQVGGRVLGVVLNLAPK-GR----------
A0A6G8FYB9      VLAGFCDGTLLVFAVGRTHKEQARLAARMMSQVGGRVLGVVLNLAPQ-RK----------
A0A4Q4D742      ILLTEVDGALLLVRHGSTTREQLRLAVERVETVGGQLFGCVLNRTPR-RA----------
A0A1C6T1J1      VVAVQSDGALLVSQQGRTSRTQVAAAARALHAVSVRLLGCVLNMAKV-PK----------
A0A2W2CFC8      VVAVQADGALLISQHGRTARTQVAAAARALNAVSVRLLGCVLNMAKL-AK----------
A0A2W2A4B0      LVSRAVQNMLLVVASGRVRRAEVSSSIESLATVGASVQGVVVTMARS-RG----------
A0A4Y9MDA5      ILSRSVDGVLLLANVTRVRRAQLTEALRSLAQVEAGVQGVVLNQVHR-EA----------
A0A1H7N9P7      VLSRSVDGLVVLADVTRVRRAQLSQSLHSLAQVQATVLGVVLNQVRR-EA----------
A0A1M7V0F8      ILSRSVDGLLVLANATRVRRPQLTETLRSLAQVGGTVLGVVLNQVRR-DE----------
A0A1M3LEY6      LLSKQVRGALLIVAAGRTHRGQVHGSVEALQNVGAHVAGVVLTMLPT-------------
A0A538AJI7      TIATMAKGILLVVTRGTLAR-SVNEAVVAIEALQAPLMGIVANRFKE-------------
A0A538AM15      VIAHWIDGFLLVVAAHHTPR-RLVEEALNVVE-RGKMLGLVFNGGDH-------------
A0A520EHH5      TLATQCDGTILVTRYGDTRREELTRAAANLENVGASLLGVVMSMVPA-TG----------
A0A4R0U4F1      VFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGLAMNYGET-EK----------
A0A1V8PLV6      VFGAKSNGIVLVSGRDMTMKRDLKEIAVQLDNLNVPVMGFVFNFAKE-RK----------
A0A357ZCV8      IIGTLVDGVIFVVRPKHTKRKEMAFAYDQLGKADVHILGACANYRES-------------
A0A419GS64      IISTMVDGTILVLDLKGGHRNMSVRAKKTLEKVNANILGLVMNNLKI-D-----------
A0A4R1CW45      LSTRALDGYIMVVDSGRTSRRQLADAMEMLNPVPC--LGTVLNRYAG-------------
A0A4R5Z7B0      ILANKVDASVFVVFSGKTEIDQAKKAKELLENAQSKLVGVVLNHKEV-------------
A0A542H054      VLSNKCDGTVLVLSSGTTEVDSAKKAKELLDTTKGKLLGVILNNREM-------------
A0A6M8GFV5      IISQICEGTILVVRRGYTSKEKIKKAKELLTLVNANILGVVLNRAEQ-------------
A0A7G8U6J2      IVANKCDGVIMVVASGKTNKQSAVKAKDLLLKANTSLLGVVLNGVET-------------
A0A2S8MDM2      IMAAGADGVLVIARHGSTKKDQLTHAVSSLHSVGAPVLGAVFTMMPT-------------
A0A357ZDL3      IVGALVDGVVMVVRPRHTKRKDLLFAYDQLKKSESRILGACASYNDR-------------
A0A1I6GVG4      VLAHSADGAIIVGTVGKTTFEVLGKAIGNLERAGARALGLVLNKVPR-RG----------
A0A1I6IST1      VLAHSADGAIIVGTVGKTTFEVLGKAIGNLERAGARALGLVLNKVPR-RG----------
A0A412JBM5      ILSPLVDGVILVALSQKSTRGELNAAIDSVSRAGGNLCGVVINGMDM-KA----------
A0A6J4SUA1      ALGVAAGSVVLVFREGKTDRRMAQAKLGVLDRLPVHMLGAVLNCVPA-SG----------
A0A1C2B334      VVSQWVPNAILVVRADSTKRPELAAAWQQWKATNVRLVGVVVNDASD-RA----------
R7Y679          VVSQWVDGGIIVVRAGGTTRQELVASLAQLHASRVSILGVVLNGVNL-KA----------
A0A4Y8ZIU8      LLSTAVDGTVLVVRHGKARKEHVEVARDMLAGVNARVLGVVLNGTPA-SG----------
A0A0F0KYJ9      VLAHSADGAIIVGTVGKTTYEVLGKAIGNLERAGARALGLVLNKVPR-RG----------
A0A838H149      VLSSFLDATILVIDAGHSRRGTVRRAREALARAGGSVLGAVLNRIPA-------------
A0A7M2YYB9      TLASHVGADVVFVVAHGTKKRRVTRAIGKLDLVGVNVLGFVANRE---------------
A0A7K0LE65      AVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTEV-------------
A0A838JYQ6      VLSVHADGSLLVIDSQNTRKVAVRRSVRDLEAVGGDVIGVVMNKAQ--------------
A0A510HHA8      ILATQADGVLVVLDGQRTRKGSLRKALHDLRSVKANVLGTVMNNFD--------------
A0A6G8Q9J3      ILATQADGVLLAMDAQKTRKIALRRAVRGLQLVGANVLGVVVNNVE--------------
A0A538BBM6      VVGRFAAGALLVIEARATPVPSISRAKDALTRNQTRILGLVLNRLK--------------
A0A5Q2F9A3      ILSGMTTGALLVVGSGEVRAPQLAAALESLESVEGRLLGIVLNKLRG-------------
A0A0K8Q3D9      VLSRIADGAIVVIRAGKTTQVELENSLGNLQKVRGRVLGAVLNYVPT-------------
A0A2R7RCA1      VLSRAADGAIVVIRTGRTTQEQLAQSLGNLDKVKGRILGAVLNYVPT-------------
A0A1Q7WJN6      VLGTVTGALVLVLRAGMSDRDVATAKLDVLDRLPVRLLGAVVNDVRS-G-----------
A0A1E2SNF6      VLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTGVVLNRVPR-------------
Q6ADE8          VLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTGVVLNRVPR-------------
A0A1Q7CZ24      VITKSVDGFLVVVTVHRTPWGVLTEALDLIDP--AKVVGLVVNGDDT-------------
A0A2W6VLC6      VLAKQTRGALVLVGAGRVTRNQLQESLEGLRAVGATVAGVVLSMAPT-------------
A0A519G798      IMARDVDGAILVVRHGKTTKEQLKQATMRLEQVDANLLGVMVNMTPK-RG----------
A0A7V8X3I0      EICRRAAGAILVVEVRRTEIGAAQRAKDALIQNQTRLLGVIVNKVPR-SE----------
A0A7V8YPJ0      VIGRFVAGAVLVVEARRTPVPAVKRAKDALTRNQTRLLGVVLNKFQA-KD----------
A0A7X7Q7T7      ILAAQTGGAIVVSRSGLLRRQQLETSLGMLESADATVLGIVLNDVPV-------------
A0A6G8QDQ0      ILATQGDGVLLVLDAQKTRKASLRKAKRTLDAVGASVLGTVMNNVKG-------------
A0A023X491      IVAAQADGVILVFDAQSTRKLSVRRSIRTIESVGAKVLGTVMNNARP-------------
A0A4R1BMZ2      VISTQGDGVMLVLDAHSTGKGALRKSLHSLEAVGANIIGTVMNNVRG-------------
A0A838JNW7      TVAAQADGVLLVFDAQNTRKGAVRRSVRNLESVGATVLGTVMNNVKA-------------
                                                      .                     

A0A519GXS6      ------------DSYYYTSDR---------------------------------------
A0A6N6NKS9      ------NNDYYYVYYNSEGKRVSHKDREKQLMENPNARDLAADDIGQWARKAGIDPKQAE
A0A538BYZ4      ------PLSLYYGGAEYYGEADGRLARGAGIARW--------------------------
A0A348NU28      ------KESAYYTANTDA------------------------------------------
A0A2N4T4Q5      ------ADAGFYGYYGKSYYASDDSGGDAPEAPLRP------------------------
A0A4Q5APW3      ------SLEHSNYYYYYSDSSKKGRFSLK-------------------------------
A0A4Q5B0V3      ------SLEHGNYYYYYSDSSKKGRFSLK-------------------------------
A0A022KX11      -------SDYRYGYHRY-------------------------------------------
A0A4Q5A868      ------KSLEYSNYYYYYSDSNKKRSKKGRFSLK--------------------------
A0A6N4VXX3      ------RNHSSYAGSYYYY---YGKSRRDTRTS---------------------------
A0A1H4I042      ------RSRSAYGGAYYYYGDNRGSNSRHSRKT---------------------------
A0A4R7A6D9      ------RSRSAYGGAYYYYGDKRGSNSRHSHKT---------------------------
A0A345NSU7      ------QPSAYYSYYGGEHA----------------------------------------
A0A222TG79      -------------YYANSYALEYGQVGVRDSAER--------------------------
A0A0W8I9Y2      ------ADAGYYGYYGKSYYANSDDQPAPKTGAQ--------------------------
A0A7C6LSF9      ------GKGYGYG-YGYGSA----------------------------------------
A0A255G8R8      ------GDAYGYYAYGSEP-----------------------------------------
A0A6G7Y423      ------GQE-AYYGRDHRPAGPGAAGARRARRRRLTYRR---------------------
A0A4Q4D4T1      ------KETARYG-YGYGYDDGKGRRRR--------------------------------
A0A1Q2CRV2      ------------EAYGYRHSYYSDHPRAAPKKGD--------------------------
A0A261FE22      ------ERSRKGNYYYYEES----------------------------------------
A0A7K0NRJ7      -------------RSAY-----YEA-----------------------------------
K6WHS4          -------------PYRFRY---YG------------------------------------
A0A7K0NTR2      ------AG-----YYGYYGYYGYGYGYAHPGEVPKMSRLFP-------------------
A0A1H6WL79      ------QG-----DLNYGYYGAYVSADESR------------------------------
A0A101LAM5      ------PG-----DLNYGYYGAYGSAEDLK------------------------------
A0A4Y3NEG0      ------PG-----DVNYGYYGAYGSAENPQ------------------------------
A0A1Q2CI19      ------GDIGYGSGYGYG----YGETKGKA------------------------------
A0A512T3M3      ------GH-----GYGYG----YGYGESGR------------------------------
W6JTW4          ------SR-----SYGYG----YGYG-SPR------------------------------
A0A839J1M0      ------AD------YGYG----YGDGPSRG------------------------------
A0A8A4Z8K4      ------AD------YGYG----YGDGPSRG------------------------------
A0A0A0JTY0      ------AD-----AYGYG----YGDDRMSK------------------------------
A0A0A0JXF2      ------GD-----AYGYG----YGETRKAK------------------------------
E6S8H2          ------SA-----GYGYG----YGYGYG--------------------------------
A0A0A0JGH0      ------AD-----GYGHS----YGYGDTAR------------------------------
N0E4U7          ------AD-----GYGYG----YGHGDT-K------------------------------
A0A0A0IYK2      ------AD-----AYGYG----YGENRQSK------------------------------
A0A0Q9L0H3      ------AD-----AYGYG----YGENRQSK------------------------------
A3TMK0          ------GD-----TYGYG----YGDARKTK------------------------------
A0A543PXP1      -------------RSTYG----YGRGYGYG------------------------------
A3TMH6          ------AG-----RYGYG----YGSGYGQG------------------------------
A0A6I2XCV4      GYYGSGYY-----GSGYYGSGYYGSGYYSSGEGQ--------------------------
A0A5R8VLL6      ----------------------YSYYSPEPDSLD--------------------------
A0A3L7ADK2      ------AH-----QYGYYGGTYYANEETPATTAT--------------------------
A0A538JQF8      ------RV-----RSPYGRPPQYQLNLPSWKSPAG-------------------------
A0A1H6YPK1      ----------------------YGYGNTS-------------------------------
A0A0Q9TBP0      ------RA-----TYSYT------------------------------------------
A0A0G3V3M7      ------AG-----YYGYYGYYGYGYGYAHPGEVPKMSRLFP-------------------
A0A6I3DD56      ------AG-----YYGYYGYYGYGYGYAHPGEVPKMSRLFP-------------------
A0A5Q2FA83      ------ND-----DSASRYGGYYAYGRS--------------------------------
A0A2R7MGI0      ------SS-----YYGARYGGHYGYGESHA------------------------------
A0A2T7WQY4      ------SS-----YYGARYGGAYGYSEPDA------------------------------
A0A0Q5Q5L3      ------SG-----YYGMQYGGYYGYGIGRT------------------------------
A0A0Q6DVM4      ------SG-----YYGMQYGGYYGYGIGRT------------------------------
A0A1N7DLV3      ------SN-----YYGSQYGGYYGYGAPSS------------------------------
A0A1V2NSB5      ------SN-----YYGSQYGGYYGYGAPGS------------------------------
A0A1R3WWR6      ------ST-----YYGGRYGGYYGYGAPRG------------------------------
A0A1G6GTN3      ------SG-----YYGAQYGGYYGYGAERS------------------------------
A0A7W5GFA5      ------SG-----YYGSQYGGYYGYGAPGS------------------------------
A0A2S5WZJ5      ------AD-----G--------YEYRRNRSYYVTADRKGMPVMKSIKRGHEQ--------
A0A0Q5JKD6      ------SG-----YYGSQYGGYYGYGVPSSS-----------------------------
A0A2W6DK08      ----------------YRNLMSYSNGSRGSDRDARFAA----------------------
A0A346XTB0      ------AG-----AYGYG----YGVAEDDD------------------------------
A0A542FTE6      ------GA-----DAQY-----YGYYGQKAYYTP--------------------------
A0A7Y9QM02      ------GA-----DAQY-----YGYYGQRAYYTP--------------------------
A0A6I1G2U1      ------SD-----GYGYG----YGSASEDPA-----------------------------
A0A351ETF8      ------PD-----KYSY-----YGQYAEQTAETADA------------------------
A0A349B7N2      ------VG-----SGDTPATKRYYYSKD--------------------------------
A0A4Q2JUT1      ------AD-----AATYS----YEYRRDYTSSGS--------------------------
A0A6L5R0V7      ------AD-----AATYS----YEYRRDYTSSSG--------------------------
A0A2S0LQ32      ------SV-----YYGYG----YGSYGHHYYYGERPRGWRRL----LPG-----------
A0A7T8DZN6      ------SV-----YYGYG----YGSYGHHYYYGERPRGWRRL----LPG-----------
A0A2N6V1R5      ------SV-----YYGYG----YGGYGQNYYYYEEDEKRKLLGFIPLPGHRKRKRENQIV
G9PHS6          ------SV-----YYGYG----YGGYGQNYYYYEEDEKRKLLGFIPLPGHRKRKRENQIV
U1PLM7          ------SV-----YYGYG----YGGYGQNYYYYEEDEKRKLLGFIPLPGHRKRKRENQIV
A0A4V1VGV9      GNYG--GA-----TYGYG----YGSSEDPSAATAPT----------PSPEV---------
A0A2S5UYV0      ------AD-----G--------YEYRRNRSYYVTAD----------KKGM----------
A0A7W4UQ09      ------AD-----G--------YEYRRNRSYYVTAD----------KKGM----------
A0A2S5X9U6      ------AD-----G--------YEYRRNRSYYVTAD----------KKGM----------
A0A2S5ULV5      ------AD-----G--------YEYRRNRSYYVTAD----------KKGM----------
A0A653YMF0      ------AD-----G--------YEYRRNRSYYVTAD----------KKGM----------
A0A7V9H755      ------TQ-----VPRYGAYYRYDYAGSEG------------------------------
A0A3Q9IY80      ------GG-----YHDYRYAGDYYRSKGGEDGFD--------------------------
A0A0F0LP73      ------NS-----ANGYG----YYRKNSHYYA----------------------------
A0A346Y185      ------AG-----YGDYA----YRYGYSYAYGYG--------------------------
A0A7W0HGW1      ------SA-----YYGY-----YGAG----------------------------------
A0A259S8H9      ------GD------NGYG----YYRKNSRYYMKSHR----------AATAEDGDDAVDAF
A0A2W1Z497      ------QD-----ARDYG----YYGGAYY-------------------------------
A0A0Q5L115      ------RD-----AREYG----YFGGSYYYYEGDVG----------TGGA----------
A0A7G6YY64      ------RD-----AREYG----YFGGSYYYYEGEVG----------TGGA----------
A0A7J5B4S5      ------AD-----G--------YEYRRNRSYYVTAN----------KKGM----------
A0A852U976      ------AD-----G--------YEYRRNRSYYVTAN----------KKGM----------
A0A1F1X071      ------DA-----VYGYSAYGKYGYGALGGYDES--------------------------
A0A3R8RWC7      ------DA-----VYGYSAYGKYGYGALGGYDES--------------------------
A0A4U0RJZ4      GNYATAGY-----GYGYG----YGYGHTDESDEA--------------------------
A0A4R1FGL9      GNYATAGY-----GYGYG----YGYGHTDESDEA--------------------------
E3B8H1          GNYATAGY-----GYGYG----YGYGHTDESDEA--------------------------
A0A7D7WDT9      ------AD-----GYGYG----YGYRQNRNYYVT--------------------------
A0A0Q5AWK6      ------GD-----T-GY-----YYYDRKNSYYTQ--------------------------
A0A6P1F176      ------GD-----A-GYS----YYYDRKNPYYAE--------------------------
A0A3N1NLD3      ------GD-----A-GYS----YYYDRKNPYYAE--------------------------
A0A3N2FVI8      ------GD-----A-GYS----YYYDRKNPYYAE--------------------------
A0A2S5XDQ6      ------GD-----T-GY-----YYYDRKNAYYAE--------------------------
A0A2S5XNN6      ------GD-----T-GY-----YYYDRKNAYYAE--------------------------
A0A5C8C085      ------------------------RDAYTSAYYY--------------------------
A0A4Y5YMQ6      ------KEKYLYT-----------------------------------------------
A0A1E4BP96      ------RPDYGYA-YG--------------------------------------------
A0A7V9FXS6      ------TETLYDY-----------------------------------------------
A0A7W0PY69      ------ARSLYYSS----------------------------------------------
A0A7W8YB99      ------ADASRYGYYGKYYSKTETKAKVANNKRS--------------------------
A0A1L2ZMQ6      ------AEASRYGYYGKYYSKKETKAKAAADLQE--------------------------
A0A7W8TR75      ------AEASRYGYYGKYYSKKETKAKTTAEVPG--------------------------
A0A151BT98      ----------FSDDYGYGSK-----------YGY--------------------------
A0A2Y8ZRF8      ----------FSDDYGYGHK-----------YGY--------------------------
A0A2R9UAT1      ------SGGGYYD-YRYTGD---YYQADQTPYDE--------------------------
A0A3E2DN22      ------MGDVLYG-YGAANYGYGSYYGDYGKRG---------------------------
A0A3Q9ULZ9      ------MGDVLYG-YGAGSFGYSSYNSYYTDKNG--------------------------
A0A3S9JFL2      ------MGDVLYG-YGAGSFGYSSYNAYYTDENG--------------------------
A0A3L8NYD3      ------IGGVVYG-YGHATHSQDYYSAYDRTGGD--------------------------
A0A1M6K628      ------LGAAAFG-YGYSGA---S-PRYYYAEDD--------------------------
A0A561E8R3      ------MGSAVYG-YGYSGK---KYNGYGYGYGD--------------------------
A0A4Q5J5D7      ------AAAGYYG-GTYELS---DKDKVPAAVGA--------------------------
A0A1Y4CKD6      ------SYGYGYGRYGYGKY---GYGSYGDGYGG--------------------------
A0A0Q7KBQ4      ------GDVYGYG-YGYGY-------GQEQHEPI--------------------------
A0A5Q5BFU2      ------NASYSYG-YYGYGE---EATGQ----QA--------------------------
A0A439DNZ6      ------GASDNYS-YYGYSY---GDGTSNSAVAT--------------------------
A0A7I7UD03      ------GSSYSYN-YSYYGS---DSGVIAPKVLR--------------------------
A0A7I7MI62      ------SASYGYG-YGYYGE---DAARR----QQ--------------------------
A0A0J6YE86      ------TGSYSYN-YGYYGE---DEGRRGGNSST--------------------------
A0A7I7K1R9      ------SLSYSYD-YSYYGL---PEPKRSSRGKT--------------------------
A0A7I9ZLK4      ------TSSYSYS-YSYYGT---EGGERAASRRQ--------------------------
A0A1F1IHY9      ------TAASAYQ-YYGATY----------------------------------------
A0A7H2BCD6      ------FGGGYYG-FGYAS-----TRGYKSYYGY--------------------------
A0A3S0V9U6      ------IGSQYYG-FGYGGY----RSEYKSYYGR--------------------------
A0A7T4T4U7      ------LGSHYYG-FGYGGY----RSGYQAYYGQ--------------------------
A0A1S2N0P2      ------LGSHYYG-FGYGGY----RSGYQAYYGQ--------------------------
A0A0Q3BEY5      ------LGSHYYG-FGYGGY----RSGYQAYYGQ--------------------------
A0A4R6Q3C6      ------LGSHYYG-FGYGGY----RSGYQAYYGQ--------------------------
A0A7T3CHP7      ------LGSHYYG-FGYGGY----RSGYQAYYGQ--------------------------
A0A7Y5U6C1      ------YG----------------YTGYASYY----------------------------
A0A542HCT5      ------SSAGYYS-GSYAAL----------------------------------------
A0A537WNY9      ------GDSSYYH-MGPEKT---SMPRRG-------------------------------
A0A5B8M469      ------DGGYSY------------YHNNRSYYTR--------------------------
A0A2S8WHZ8      ------AGAAQYG-Y-YGKY---YYSNTEQDP----------------------------
A0A1Y4CTD2      ------EWSLTHG-RGYSAY----------------------------------------
A0A3N3ZPU0      ------SGANEYG-YYSDAY---YYSSSSRH-----------------------------
A0A359IQX7      ------IGAVVYG-YGYGT-----YTYSSKYYRY--------------------------
A0A7W9IKV0      ------GRYYGYG-YGYGYG----YEAET-------------------------------
A0A1N7E3F1      ------GSY--YG-YGYGYE----ADPVEQET----------------------------
A0A544ZKQ1      ------GSYYGYG-YGYGYG----YDSAAQET----------------------------
A0A5D0Q2X0      ------GSY--YG-YGYGYG----YDAAAQEA----------------------------
A0A5R8Z2E7      ------GSY--YG-YGYGYG----YDAAAQEA----------------------------
A0A0Q9LZR0      ------SSAGYYS-GNYGPL---QETPQ--------------------------------
A0A1F1J417      ------LGNSYYG-FGYANS----YVGYASYYGY--------------------------
A0A2A8D6P2      ------LGNSYYG-FGYANS----YVGYASYYGY--------------------------
A0A1F0THV9      ------LGNSYYG-FGYANS----YVGYASYYGY--------------------------
A0A5F0M6Y0      ------LGNSYYG-FGYANS----YVGYASYYGY--------------------------
E3H5W1          ------LGNSYYG-FGYANS----YVGYASYYGY--------------------------
A0A1F1QKB0      ------LGNSYYG-FGYANS----YVGYASYYGY--------------------------
A0A509JY23      ------LGNSYYG-FGYANS----YVGYASYYGY--------------------------
A0A448USF4      ------LGNSYYG-FGYANS----YVGYASYYGY--------------------------
A0A7Z9A2N0      ------LGNSYYG-FGYANS----YVGYATYYGY--------------------------
A0A433EDP2      ------LGNSYYG-FGYANS----YVGYATYYGY--------------------------
A0A231VTW0      ------LGNSYYG-FGYANS----YVGYATYYGY--------------------------
A0A433ECD0      ------LGNSYYG-FGYANS----YVGYATYYGY--------------------------
A0A7T9UPU8      ------LGNSYYG-FGYANS----YVGYATYYGY--------------------------
U7V3Z1          ------LGNSYYG-FGYANS----YVGYATYYGY--------------------------
A0A6I3F378      ------LDRKHTR-YGYGAY---GYDASK-------------------------------
A0A838H0S5      ------RAGYGYG-YGYGPD---APPQNGSALPA--------------------------
A0A1S1CQC5      ------LGNSYYG-FGYAST----YVGYATYYGY--------------------------
A0A1E9T6I0      ------LGNSYYG-FGYAST----YVGYATYYGY--------------------------
A0A1F1GHA7      ------LGNSYYG-FGYAST----YVGYATYYGY--------------------------
A0A1S1CAD0      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
G5ET14          ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1E9DXX2      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1E8S156      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1E8S5S2      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1S1DFA8      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A2I1Z490      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1F0DAA9      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1F0PHK9      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1F0VZG6      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1E9G8X4      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1E9IAW2      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1E9ZBC9      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1E9ZDP4      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1F0R6B5      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1F0Z7N5      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1F1D897      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
D2NP38          ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1F1FV74      ------LGNSYYG-FGYAST----YVGYATYYGY--------------------------
A0A1E9M791      ------LGNSYYG-FGYAST----YVGYATYYGY--------------------------
A0A291DEI8      ------LGNSYYG-FGYAST----YVGYATYYGY--------------------------
A0A1S1D5T1      ------LGNSYYG-FGYASS----YVGYSTYYGY--------------------------
A0A1E8TRD6      ------LGNSYYG-FGYASS----YVGYSTYYGY--------------------------
A0A1F0XT88      ------LGNSYYG-FGYASS----YVGYSTYYGY--------------------------
A0A1F1EVP5      ------LGNSYYG-FGYASS----YVGYSTYYGY--------------------------
C6R548          ------LGNSYYG-FGYASS----YVGYSTYYGY--------------------------
A0A0K2RXS2      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A1F0KX60      ------LGNSYYG-FGYASA----YVGYATYYGY--------------------------
A0A542I3V2      ------VDSYAYY-GAYTA-----------------------------------------
A0A2T0UZ65      ------MGSVMYG-DGYSTY---YSHGSYEYY----------------------------
A0A0Q5M6Z7      ------IDSHDYG-YYRSNY---YTSNADESGEA--------------------------
A0A7G6YA19      ------VDSHDYG-YYRNDY---YTSNEAAA-----------------------------
A0A853CXS3      ------VDSHDYG-YYRNDY---YTSHADAAPVP--------------------------
A0A7W8YB56      ------SSAGQYG-YYSDTY---YYSSTTGERTR--------------------------
A0A1L2ZMV4      ------SSAGQYG-YYSDSY---YYTSTDGQRTR--------------------------
A0A7W8TSW5      ------SSAGQYG-YYSDSY---YYTSTDGQRTR--------------------------
A0A1R4JTI6      ------KEAGYYG-YYGKSY---YSSSATPDQ----------------------------
A0A4R7TM52      ------RGKGYDE-YRYSGD---YYAAPAATTV---------------------------
A0A542XE74      ------LTDSAYS-YTG-------YTGYYKDYYA--------------------------
A0A0Q7QDF6      ------TARYGYG-YGYDD-----------------------------------------
A0A7X7XPM3      ------TY------YAYGS-----KEGYGHNQ----------------------------
A0A5R8L819      --------------GGYYGG---HYG----------------------------------
A0A7K0PFV4      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A7K0MUQ7      ------------------------------------------------------------
A0A7K0U619      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      ------GKGDYY------------YSDKAAKH----------------------------
A0A1Q2CJ92      ------LGEATFG-YGYGSY---TSKYY--------------------------------
A0A2T0S3C8      ------PEGYY-------------YEQYGMTSQH--------------------------
A0A810MDE3      ------PEGYY-------------YEQYGMTSQH--------------------------
A0A4Y8WZJ3      ------TAASA-------------YQYYGATY----------------------------
A0A7X0KT97      ------ADASRYS-YDY-------RKSYGEPV----------------------------
A0A853DGU7      ------IGAAYYG-YGYGG-----YRRASQRYYS--------------------------
A0A7Z0A2Z7      ------GER-----REYAAD---GYSSRGMAVDP--------------------------
A0A285VUW0      ------SGSYN-------------YQYYGRET----------------------------
A0A849PJI9      ------LGSVIYG-YGYGGK---AYGGYGYGYGS--------------------------
A0A2R7Z032      ------VGAIAYG-DGY-G-----YGGYG-A-----------------------------
A0A6J4MTQ2      ------VSAVAYG-YGYAS-----YGSYG-AY----------------------------
A0A1I0W453      ------ASAIAYG-GGYGG-----YGGYG-GY----------------------------
A0A0Q6VV12      ------ASAIAYG-GGYSG-----YGGYG-GY----------------------------
A0A495NTA9      ------ATAIAY--GGYGG-----YGGYG-GY----------------------------
A0A1H4LCS9      ------AAAIAYG-GGYGG-----YGGYG-GY----------------------------
A0A4Q2RZP8      ------AAAIAYG-GGYGG-----YGGYG-GY----------------------------
A0A0Q9QB08      ------AASIAYG-GGYGT-----YGGYG-GY----------------------------
A0A7Y9H290      ------AAAIAYG-GGYEG-----YGGYG-AY----------------------------
A0A4Q2SA86      ------AAAIAYG-G---G-----YGGYG-GY----------------------------
A0A4Z1C3Z0      ------AAAIAYG-G---G-----YGGYG-GY----------------------------
A0A6V8KDX4      ------SDGY----YAYYG-----QQHDGKHR----------------------------
A0A444BL03      ------AGGVMYG-YGYGG-----YASYASDT----------------------------
A0A7V9PCQ0      ------QNTA------YDS-----YLTKPEAR----------------------------
A0A4Y8X357      ------VGSDYYG-GGLGS-----HEDEYHAY----------------------------
R4LD52          ------PDAY----HYYDE-----YSTRGRGS----------------------------
A0A4T2CD79      ------AGGRGYG-YYHGS-----YSEDAPVV----------------------------
A0A6L6AM03      ------AAAIAYG-GGYGS-----YGGY-GGY----------------------------
A0A4Q2RU39      ------ANAIVYG----GG-----YGGYGGGY----------------------------
A0A4Q2SK58      ------ANAIVYG-GGYGG-----YGGYGGGY----------------------------
A0A2N3YJR1      ------AGAVMYG-YGYGG-----YATYASDT----------------------------
A0A6G8FYB9      ------VGGVVYG--GY-G-----YSSYSSDY----------------------------
A0A4Q4D742      ------SDDA----YGYGY-----GHGYGYGS----------------------------
A0A1C6T1J1      ------A-DA----YQYEA-----YRVVAGLG----------------------------
A0A2W2CFC8      ------A-EA----YQYEA-----YQVL--------------------------------
A0A2W2A4B0      ------ARDA----YAVYG-----ADVPPETQ----------------------------
A0A4Y9MDA5      --------DV----YGYAA-----DAAAEARR----------------------------
A0A1H7N9P7      --------EV----YGYAA-----DVVAGTDR----------------------------
A0A1M7V0F8      --------DV----YGYAA-----EAQPPA-R----------------------------
A0A1M3LEY6      ------RGPDAYGYGRYGYGAYGYGYGYGR------------------------------
A0A538AJI7      ------SSVPYYY-----------------------------------------------
A0A538AM15      ------APASFYGYYGY-------------------------------------------
A0A520EHH5      -----------RGRDQYGYDFEPGRVPTPPTQSAPVRTNRH-------------------
A0A4R0U4F1      -----------PQKGGYYYYGDESDDNGRKRQIQHKKSEKMKKD----------------
A0A1V8PLV6      ------V----SANGNYYYYYDEGGKKSRKKSKHKS------------------------
A0A357ZCV8      -----------VASESYYAYYSADGKRVKDRPAADAASQL--------------------
A0A419GS64      -----------KDARPYQY-----------------------------------------
A0A4R1CW45      -----------GMLDSYGYGSANYDSYYSE------------------------------
A0A4R5Z7B0      -----------KSNDYYYYYGAK-------------------------------------
A0A542H054      -----------KETS-YYYYGKN-------------------------------------
A0A6M8GFV5      -----------EKDGYYYYYGNEN------------------------------------
A0A7G8U6J2      -----------DNSNYYYYKSQSK------------------------------------
A0A2S8MDM2      -----------RGSSSYGYSYSYYGTETPRHAPP--------------------------
A0A357ZDL3      -----------ASADSYYAYYTVTGHRVRDKYNEDGAYEFLGGEQESVKVEGLSAAVALD
A0A1I6GVG4      -----------SGAAYYGYQYHGDYYRSDEQELPSGTVRGDS--------PRRRGESEAA
A0A1I6IST1      -----------SGAAYYGYQYHGDYYRSDEQELPSGTVRGDSLAPTRPRMPRRASKTRVG
A0A412JBM5      -----------TK---YSYRYKYEDKYGGAKDYGYGYGYGYGNSGHRRQARGRSGQS---
A0A6J4SUA1      -----------GA---YQYYSYLDGYEAEDDP-------ALPEAQRSRLTAGPVGTR---
A0A1C2B334      -----------GA---YHNTYYGD----TDTP-------RMASQRSRSHDIAQVGLRR--
R7Y679          -----------RD---NRYGYYAQ----ASRE-------GVTA-----------------
A0A4Y8ZIU8      ------VGSDYYGGGYASKGDDYHAYYQAPRDAESRSAGETTPEAGAGR-----------
A0A0F0KYJ9      -----------SGAAYYGYQYHGDYYRNDGQELPTGTVRGDNANIYAKSK----------
A0A838H149      -----------RANSEYAQYYRGYYESEGTGKQASGAGTSETGSAV--------------
A0A7M2YYB9      -----------GDLSEYGYS----------------------------------------
A0A7K0LE65      -----------VNRSAYYEA----------------------------------------
A0A838JYQ6      ---------------GFGIND-YYG-----------------------------------
A0A510HHA8      -----------GGRGGYAYHQ-GYTR----------------------------------
A0A6G8Q9J3      -----------DSGEGYPL-A-GYASG---------------------------------
A0A538BBM6      -----------AQDSGYSYGYYGYGEPEPNGERPAGE-----------------------
A0A5Q2F9A3      ----------------KDVGYSAYRNRSGQGPEPRRVARRAAGEEPADRQRVIA------
A0A0K8Q3D9      -----------KGTDAYAYHGTYTSAVAPSVLGEDADLLQRDSDASGS-WVGENYEVDHA
A0A2R7RCA1      -----------KGTDAYSYYGTYTSAPTSA----PGPVAEAEPDLTGPFWEGPGESVQ--
A0A1Q7WJN6      -----------GDYRQYSYYLAGYEVADEDELREPAQSLLRDPQ----------------
A0A1E2SNF6      -----------RGADAVNYGYYGAKYGYGYYHDASLTAGPEAAPAPAATPVPTPAEPDAA
Q6ADE8          -----------RGADAVNYGYYGAKYGYGYYHDASLTAGPEAAPAPAATPVPTPAEPDAA
A0A1Q7CZ24      -----------RRSSYYD----VYAGSSRGARGRGAWSRA--------------------
A0A2W6VLC6      -----------RGPDAYGYGYGSYGTYSASVPDTGWSVSHAAAEASAGVAGAARTESTAG
A0A519G798      -----------GKGYGYGYGY-GYGY------------GPDKPRN---------------
A0A7V8X3I0      ------LSYGYGDAAVVEVA--------------PSANGSEAGGS---------------
A0A7V8YPJ0      ------VTYGYGDSFGYGYGY-GYGYGSRRPGDEARGNGSDGPGT---------------
A0A7X7Q7T7      -----------SKADAYA----GYYSSHAQESSERAHRVQADAAV---------------
A0A6G8QDQ0      -----------GQKGLYS----AYSY----------------------------------
A0A023X491      -----------ARNGTYG----GYTYSYGEAAGS--------------------------
A0A4R1BMZ2      -----------GKGGYYRYGYGGYTYK---------------------------------
A0A838JNW7      -----------SGRGYYGYSY-GYKYG---------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      RRESGERPRRQGSGAGVGAGASPNANAGAGMPPAASPQRATRASADEQFPRGAFKPAVPR
A0A538BYZ4      ----------LQWAKRGGDALRRQRSRRGP------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ----------AKEVPDAGTAAPASRAPDTGSTAALETESPADAAVSDLPADESERFDLAA
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ----------EEEMTRRARKAARTEPRAKQRARG--------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      ----------STRPDGPRKRKRRQGKRDKRMSKSRPHAEAAASARAERAVDGGEALEFRS
A0A222TG79      ------------------------------------------------------------
A0A0W8I9Y2      ----------PVVAAPAAKQPWGTAPRAESSDAHQPAGASTRQEPTVPSAEDAAPAPRAE
A0A7C6LSF9      ----------SDDPAAQRRASRKKRRSKEREPRPPSLPPAVQPRPTSEPDNDFSADPVDD
A0A255G8R8      ----------------------GRQRSSSAATGRRAA-----------PSGQRPDDLVL-
A0A6G7Y423      ----------GGPSRPSRIRPVGRSNTATAAPSRAAVSVVTAAARSTQPATPAPEGTSAA
A0A4Q4D4T1      ------------------------------------------------------------
A0A1Q2CRV2      -----------------------RKSKKRRARAEVAA-----------------------
A0A261FE22      ----------ETKAKKSSKRSSRKASASAPATQARPQVQAQAPRSARTAVSGK-------
A0A7K0NRJ7      ------------------------------------------------------------
K6WHS4          ----------VNVENNADDMSVDKVGTSSAS-----------------------------
A0A7K0NTR2      ----------WRKPTRGEGTVRRQPDSKQVGVGASIQGESSSSEAFDDTSA---------
A0A1H6WL79      ----------------------DTIPPRSGMNPTSQPGHAGVSVDGNGFEAHSPWQGPAK
A0A101LAM5      ----------------------DHQPPAPSTTTTSASRRS--------------------
A0A4Y3NEG0      ----------------------DDTPPVPGTVLSAPAGAL--------------------
A0A1Q2CI19      ----------KGKRGGARAVADE--KPEASLV----------------------------
A0A512T3M3      ----------RRSEKPVD----H--RAQRGAFDPAADEDGQSSDIDT--------HGSSG
W6JTW4          ----------STSKKPRSGGHGP--RSAHGTSASRRDRLGRAEAPSTIRGGGEARHDAAG
A0A839J1M0      ----------KSRRSLAATSASL-------------------------------------
A0A8A4Z8K4      ----------KSRRSLAATSASL-------------------------------------
A0A0A0JTY0      ----------RKAKRARKGARSRQSGPVGP------------------------------
A0A0A0JXF2      ----------KKVKRERKLAEKR--GPVAPATPSTSSRPTTGPAEETRSRDAV-------
E6S8H2          --------------------YGD--KKKGKARKRLPSSAVQGPPELSE------------
A0A0A0JGH0      ----------PQRDSPSPKMELD--PRQQPSAPSVAVPQHASAPEVDR------------
N0E4U7          ----------KRKGARSARVEAD--RSLRPTRADAST-QFAGSEDGAR------------
A0A0A0IYK2      ----------RKAKRARK-RAQS--RSARSAAEQETTFVDSRTPGASPVHSAESRDTSRN
A0A0Q9L0H3      ----------KKARRGRK-RQQL--RAAEPVA----------------------------
A3TMK0          ----------KKVKRGRRLADQR--RPAAPVV----------------------------
A0A543PXP1      ----------YGVSKQKR-GRSI--GGAQGAR----------------------------
A3TMH6          ----------YDAERSKGIRRVL--PGRRGTTDG--------------------------
A0A6I2XCV4      ----------PAQTGQPAQLGQRVRPTPVAPMDAPQTPTSTNGSAEGDAQS---------
A0A5R8VLL6      ----------STSSPEKAAARDKTASPDKAARPQPANSRETRSPVSEVGRDKFSKSSTSF
A0A3L7ADK2      ----------AQPSDESTVVEGDSATPIAAATPLAAPEEATSRRTVRRSGH---------
A0A538JQF8      ----------GGIRRATKARSAKKAAKKSSARAPAKTGPDTTNASADEPVV---------
A0A1H6YPK1      ----------PGLSSLGGAPAQHDEDDSWEHDEALRKVFPEDVLHRADDVPVLAERDDEL
A0A0Q9TBP0      ----------SRERAVTGTDAAPDSAPTRAGKDQAGDPVPSAGTPPPSGDT---------
A0A0G3V3M7      ----------WRKPTNGAGTVRRKPDPEQVGVSASNQGANSSSEAFDDPSF---------
A0A6I3DD56      ----------WRKPTNGAGTVRRKPDPEQVGASASNQGAPASTEAFDDTSA---------
A0A5Q2FA83      ----------KKDKSKREAVASRHGSLEEAVPVTSAAIPGSPSGTEQDEET---------
A0A2R7MGI0      ----------TGA--EGIKRSTRR-GARGVAAKSGPAETGPRRRSNAAPDD---------
A0A2T7WQY4      ----------DTR--KGAKRTRGR-DRRPSSVMGAPGATGPRRRSGTASDD---------
A0A0Q5Q5L3      ----------EKS--TWWRRVLRK----SSTEPGAAEEHGKRRTSADLPAE---------
A0A0Q6DVM4      ----------EKS--TWWRRVLRK----SSTEPGAAEEHGKRRTSADLPAE---------
A0A1N7DLV3      ----------GVDRPRWWRRPWRR--ATVEKKDAGEQAPGPRRRSAELPPS---------
A0A1V2NSB5      ----------GAERTRWWRRPWRR--QVGDAGDAGASAPGPRRRSAELPPS---------
A0A1R3WWR6      ----------TTR--SWWR--FGRRPRTADSENTT--DTGPRRQSADPPPE---------
A0A1G6GTN3      ----------STK--AWWR--FRRRGQTTPVAAAEDREAGSRTQPADPPPE---------
A0A7W5GFA5      ----------PAK--GWWRLGLRRRGKKADAVDAE-QEAGPRRRSGGLPPE---------
A0A2S5WZJ5      ----------PEAFAVQTDASAAQTPQPTFAAVAPAAAPARESLAPTRPSA---------
A0A0Q5JKD6      ----------PNGRWRLGLRRRGKKAEVVDAEQEATPRRRSGGLPPENVSG---------
A0A2W6DK08      ----------VISANDRAHSDRHWRRAEMSELIWHPSTPAPNGFLPERRP----------
A0A346XTB0      ----------GQRRLLPGSRRRNGGNEGTRGSHRDADRDADRDADPDGEGA---------
A0A542FTE6      -------------------TQRPKVEDDAPPPQAPPIANTTNLRPEDLPRR---------
A0A7Y9QM02      -------------------SQRPKVEDDAPAPQTAPIANSTSLRPEDLPRR---------
A0A6I1G2U1      ----------AKASGRRGRRGARAAGDQPRPRTRREAKERAADGGLSSADL---------
A0A351ETF8      ------------------------------------------------------------
A0A349B7N2      ----------PTSEPLPPPTDGQEQRGIESDELDALDAEGELPEVHPADR----------
A0A4Q2JUT1      ------------------------------------------------------------
A0A6L5R0V7      ------------------------------------------------------------
A0A2S0LQ32      --------------------GRRHTRHQEPAETQEHVPAAS-------------------
A0A7T8DZN6      --------------------GRRHTRHQEPAETQEHVPAAS-------------------
A0A2N6V1R5      SIQEEEVHPLPKDKQSNRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAASPRVST
G9PHS6          SIQEEEVHPLPKDKQSNRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAASPRVST
U1PLM7          SIQEEEVHPLPKDKQS-RRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAASPRVST
A0A4V1VGV9      ----------RDLTLTEGRSSADLPGKEDAARLRQPAPQAPTPPEPATAVR---------
A0A2S5UYV0      ----------PVFKSSKGHVDLLEPQPEKNASAAISLAPRPNSQSSEQPPQ---------
A0A7W4UQ09      ----------PVLKSVKGKAT-DDPAEAFGLQAEAPSAPARQSLAPSRPKI---------
A0A2S5X9U6      ----------PKFKAVKGHA---DPSEQFRAQNDA-VPAQRESLAPSQPAQ---------
A0A2S5ULV5      ----------PKFKAVKGHT---DPSEHFGAQPDV-AAPQRESLSPSRPAQ---------
A0A653YMF0      ----------PKFKAVKGHT---DPSEHFGAQPDV-VAPQRESLSPSRPSQ---------
A0A7V9H755      ------------------------------------------------------------
A0A3Q9IY80      ----------IDLTEDTAGTMVSAGAPGAASTPSPSSATRPASGVTGSPAA---------
A0A0F0LP73      ----------QTSRNDDAAGDDEVAALISEAELSPAAFDGEPPAPEESGAE---------
A0A346Y185      ------------------------------------------------------------
A0A7W0HGW1      ----------PTDSGPAGSTDGDKSA----------------------------------
A0A259S8H9      AAMANLSPAPLGDAAATAEAPRDGGATVEEGTFTTSSGPADIITDGDAADA---------
A0A2W1Z497      ----------AGDDDGSEPAPGTDGG----------AEHGTDGDAEARAAR---------
A0A0Q5L115      ----------VGAGAGSGTAPASREAVTAPAPVVAPTPPAAPTPAPVPAPA---------
A0A7G6YY64      ----------VGAGAGSGTAPASREAVTAPAPVVAPTPPAAPAPAPVPAPA---------
A0A7J5B4S5      ----------PVFKSAKGHVDLLEPQPD----------TNAPATISLAPRA---------
A0A852U976      ----------PVFKSSKGHVDMLEPQPQPQPQAQPQPAKDGPGAISLAPRA---------
A0A1F1X071      ----------AVVPDAEEVDVEQAGGPAEPGPASAPA-----------------------
A0A3R8RWC7      ----------AVVPDSEEVDVEQAGGPAEPGPVSAPAAAVAAPDAPRPADT---------
A0A4U0RJZ4      ----------SALTPAHELADITLHAPESSPAAGPQADRGNAGAPFDTTRH---------
A0A4R1FGL9      ----------SALTPAHELADITLHAPESTPAAGPQVDRGNAGVPLDTTRH---------
E3B8H1          ----------SALTPAHELADITLHAPESTPAAGPQVDRGNAGVPLDTTRH---------
A0A7D7WDT9      ----------PK-GKSRGKRKKQASAVSAPAVARASLVPAATRADVVAGPR---------
A0A0Q5AWK6      ----------PQQAATENAAVGR------------SARRSPRTQALEP------------
A0A6P1F176      ----------PDAGRGRGRSNGRRSAGEEPARSLPAVRPSEPARAVEPERI---------
A0A3N1NLD3      ----------PDGGRSRGRSAGRRAAAEEPARSLPAVRPAEPARAVEPERT---------
A0A3N2FVI8      ----------PDGGRSRGRSTGRRAAAEEPARSLPAVRPAEPARAVEPERTRAAEPERAA
A0A2S5XDQ6      ----------PQPATGRKR-----------------------------------------
A0A2S5XNN6      ----------PQPATGRKR-----------------------------------------
A0A5C8C085      ----------SQDADPSAKKRPKADKEPKPKKGKKPAPDSFEPGPGPEPSDQTDNGPDDR
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      -----------------------SGAADTRPAFVPR------------------------
A0A7V9FXS6      ------------------------------------------------------------
A0A7W0PY69      ------------------------------------------------------------
A0A7W8YB99      ----------VAVAPQPIFSEFEGQAIPSLKDGTSAGNHAAPQQASRAVGGTDTATDQIQ
A0A1L2ZMQ6      ----------PSVTDNPPTEQIQTPASVASRSRHNEGTRGTSSQSMTV------------
A0A7W8TR75      ----------ASVTDNPPTEQIQTPATSASHSRHTEVTQGTSSQSMTA------------
A0A151BT98      ----------GEQEMAASGRTRSRRSDKRG------------------------------
A0A2Y8ZRF8      ----------GEQPPAARG--QSRRTGKRG------------------------------
A0A2R9UAT1      ----------AVHNPPNNVDGITRPVVETQPAATGDPQDQLAPLRRTRRRAG--------
A0A3E2DN22      ----------------------YSSYGSEEQESRESIAVVQEAQ--------------PA
A0A3Q9ULZ9      ----------KKKRRKKKMSLEEDYFGAVEPAPLGSHPTQDQPSSEGEQEDATSGGSQPS
A0A3S9JFL2      ----------KKKRRKKRMSLEEDYFGRVELAPVNSRPTEDEPT--------------PS
A0A3L8NYD3      ----------RSNGNTLRARFLYRRMRRREEREQAQREQTLRERTAARENEHGQPPVELT
A0A1M6K628      ----------GRRRPAAEVSGARQGRGRSQSTPRPRRVAADDQRVEVVDASADAVVMEPA
A0A561E8R3      ----------SPAPTPAQPSPPATPAAPTATMGTQPATAGDNITDQELGLSRRDRRSKQG
A0A4Q5J5D7      ----------TDEAD--------ATEVSSKHRRRTA------------------------
A0A1Y4CKD6      ----------LADEVDEGVKPVVEPEIVEEEVVPPRGKHFRV------------------
A0A0Q7KBQ4      ----------GEQARRMVGALGRGESRSSSGRRVSR------------------------
A0A5Q5BFU2      ----------RHGLPTETRVEKSSPSSATSAQGDSEVAEPAGTRQTRETD----------
A0A439DNZ6      ----------TPRMKVMRRLRRYRPAYQSPGTDPASENEN--------------------
A0A7I7UD03      ----------APDVAVQESSSSDSVKEVEVEDQDPTTSSSGRRRRRESSD----------
A0A7I7MI62      ----------PRELTGPATQDRSSVSDLLVTNVDVAESSGKRRKRADAD-----------
A0A0J6YE86      ----------RGGSAESSKTTSANASESRDRSAGDLPARPVTQRRYKTT-----------
A0A7I7K1R9      ----------PVSD-------RSDPAKINATSDVDRSGASYDKRKSAE------------
A0A7I9ZLK4      ----------PNVDPTPSPTPQSEKEKISGQNVPRVSGR---RRKRIE------------
A0A1F1IHY9      -----------------------YTASQQQDVAGRS------------------------
A0A7H2BCD6      ----------TSDKPTEGKGLKKLKRASKK------------------------------
A0A3S0V9U6      ----------SGQGSESAGTKK--------------------------------------
A0A7T4T4U7      ----------DGEGSGSGSSPADGGKHGAKGRGRRARTSHSS------------------
A0A1S2N0P2      ----------DGEGSGSGSSPAAGGKHGAKGRGRRARTSHSS------------------
A0A0Q3BEY5      ----------DGEGSGSGSSPAAGGKHGAKGRGRRARTSHSS------------------
A0A4R6Q3C6      ----------DGEGSGSGSSPAAGGKHGAKGRGRRARTSHSS------------------
A0A7T3CHP7      ----------DGEGSGSGSSPAAGGKHGAKGRGRRARTSHSS------------------
A0A7Y5U6C1      -----------------------LDQPREGGRV---------------------------
A0A542HCT5      -----------------------EEHSKQQQTHEPAGR----------------------
A0A537WNY9      -----------------------RRSSERLASRR--------------------------
A0A5B8M469      ----------PESGKRRRDAAKKVTPVPAPHEVASPATAAQARATAAAGRSGMPQARLVE
A0A2S8WHZ8      -----------------------KADAKPSRRLQDPVPVDQPVISSNRFGEIPGLGAHAG
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ----------ARDTAQQRGRRAGKPKADRPARAK--------------------------
A0A7W9IKV0      ----------------------------EVKTPAGV------------------------
A0A1N7E3F1      -----------------------SSRTPQPQTPMPV------------------------
A0A544ZKQ1      -----------------------VSETPQPQAPMPV------------------------
A0A5D0Q2X0      -----------------------TPETPQPQAPIPV------------------------
A0A5R8Z2E7      -----------------------TPETPQPQAPIPV------------------------
A0A0Q9LZR0      -----------------------RAVRSEAGTAATR------------------------
A0A1F1J417      ----------SKDG---------KKKVSSGAHGA--------------------------
A0A2A8D6P2      ----------SKDG---------KKKVSSGAHGA--------------------------
A0A1F0THV9      ----------SKDG---------KKKVSSGAHGA--------------------------
A0A5F0M6Y0      ----------SKDG---------KKKVSSGAHGA--------------------------
E3H5W1          ----------SKDG---------KKKVSSGAHGA--------------------------
A0A1F1QKB0      ----------SKDG---------KKKVSSGAHGA--------------------------
A0A509JY23      ----------SKDG---------KKKVSSGAHGA--------------------------
A0A448USF4      ----------SKDG---------KKKVSSGAHGA--------------------------
A0A7Z9A2N0      ----------SKDG---------TKKKVKSRKKAKK------------------------
A0A433EDP2      ----------SKDG---------TKKKVKSRKKAKK------------------------
A0A231VTW0      ----------SKDG---------TKKKVKSRKKAKK------------------------
A0A433ECD0      ----------SKDG---------TKKKVKSRKKAKK------------------------
A0A7T9UPU8      ----------SKDG---------TKKKMKSRKKAKK------------------------
U7V3Z1          ----------SKDG---------TKKKVKSRKKAKK------------------------
A0A6I3F378      ------------------------------------------------------------
A0A838H0S5      ----------A------------RSRAKAALTRRRS------------------------
A0A1S1CQC5      ----------GKDGD--------KKSSKSKSSAPKA------------------------
A0A1E9T6I0      ----------GKDGD--------KKSSKSKSSAPKA------------------------
A0A1F1GHA7      ----------GKDGD--------KKSSKSKSSAPKA------------------------
A0A1S1CAD0      ----------GKEGD--------KKSSKKSSTKK--------------------------
G5ET14          ----------GKEGD--------KKSSKKSSTKK--------------------------
A0A1E9DXX2      ----------GKEGD--------KKSSKKSSAKK--------------------------
A0A1E8S156      ----------GKEGD--------KKSSKKSSTKK--------------------------
A0A1E8S5S2      ----------GKEGD--------KKSSKKSSTKK--------------------------
A0A1S1DFA8      ----------GKEGD--------KKSSKKSSTKK--------------------------
A0A2I1Z490      ----------GKEGD--------KKSSKKSSTKK--------------------------
A0A1F0DAA9      ----------GKEGD--------KKSSKKSSTKK--------------------------
A0A1F0PHK9      ----------GKEGD--------KKSSKKSSTKK--------------------------
A0A1F0VZG6      ----------GKEGD--------KKSSKKSSTKK--------------------------
A0A1E9G8X4      ----------GKDGD--------KKSSKKSSAKK--------------------------
A0A1E9IAW2      ----------GKDGD--------KKSSKKSSAKK--------------------------
A0A1E9ZBC9      ----------GKDGD--------KKSSKKSSAKK--------------------------
A0A1E9ZDP4      ----------GKDGD--------KKSSKKSSAKK--------------------------
A0A1F0R6B5      ----------GKDGD--------KKSSKKSSAKK--------------------------
A0A1F0Z7N5      ----------GKDGD--------KKSSKKSSAKK--------------------------
A0A1F1D897      ----------GKDGD--------KKSSKKSSAKK--------------------------
D2NP38          ----------GKDGD--------KKSSKKSSAKK--------------------------
A0A1F1FV74      ----------GKDGD--------KKSSKKSSAKK--------------------------
A0A1E9M791      ----------GKDGD--------KKSSKKSSAKK--------------------------
A0A291DEI8      ----------GKDGD--------KKSSKKSSAKK--------------------------
A0A1S1D5T1      ----------GKDGD--------KKSSKKSSAKK--------------------------
A0A1E8TRD6      ----------SKDGD--------KKSSKKSSAKK--------------------------
A0A1F0XT88      ----------SKDGD--------KKSSKKSSAKK--------------------------
A0A1F1EVP5      ----------SKDGD--------KKSSKKSSAKK--------------------------
C6R548          ----------GKDGD--------KKSSKKSSAKK--------------------------
A0A0K2RXS2      ----------SKDGD--------KKSSKKSSTKK--------------------------
A0A1F0KX60      ----------GKEGD--------KKSSKKSSTKK--------------------------
A0A542I3V2      -----------------------APEAASSGSADRD---------------VERDRPGTE
A0A2T0UZ65      -----------------------KSGPKKGRRRAAK---------------KAKDRVGAG
A0A0Q5M6Z7      ----------QPVASIEAGGDTSVDGQANEQRSRRA---------------SRS------
A0A7G6YA19      ----------IEAPANEAAPEPVAEDVVPTRRSAQP---------------SRGRSRSDR
A0A853CXS3      ----------VEARSAEAGGAETGAAEPASTRREQR---------------SRKALRSGR
A0A7W8YB56      ----------R------------TQGKRRATASASN------------------------
A0A1L2ZMV4      ----------R------------QSGKRRAASSSSK------------------------
A0A7W8TSW5      ----------R------------QSGKRRAASSSSK------------------------
A0A1R4JTI6      -----------------------DFDVTSRNAGSTRE-----------------------
A0A4R7TM52      -----------------------PLDSPGAAASPSV---------------TEGEPRVLA
A0A542XE74      ----------AAEPEQQSPERSRADDVEDAEPTSSR---------------AARKRRRSK
A0A0Q7QDF6      ---------------------------------------------------GKGRRRR--
A0A7X7XPM3      -----------------------GLAAKRRTRRGTP---------------ARRVRRPVG
A0A5R8L819      -----------------------REYYASAEVQAVSAVPAVTPAAGDNPADGQGLRRRSR
A0A7K0PFV4      -----------------------GVDAALSPYYDAA---------------PRRRSGAVW
A0A0G3V3F3      -----------------------RTEVVNRSAYYEA------------------------
A0A7K0MUQ7      -----------------------RTEVVNRSAYYEA------------------------
A0A7K0U619      -----------------------RTEVVNRSAYYEA------------------------
A0A6I3DFP2      -----------------------RTEVVNRSAYYEA------------------------
A0A7K0SI36      -----------------------RTEVVNRSAYYEA------------------------
A0A7K0V140      -----------------------RTEVVNRSAYYEA------------------------
A0A261FQA1      -----------------------SSQGTSEKSHEPT---------------EKAEQ----
A0A1Q2CJ92      -----------------------RTDEAQKPHRRER---------------ARRVTKLVE
A0A2T0S3C8      ----------RRGAWRDRMRAPATTELRDLMACGEP---------------ESAPERRLD
A0A810MDE3      ----------RRGAWRDRMRAPATTELRDLMACGEP---------------ESAPERRLD
A0A4Y8WZJ3      -----------------------YTASQQQDVAGRS------------------------
A0A7X0KT97      -----------------------SGEAETKPQTDTA---------------DEVAKTRAE
A0A853DGU7      ----------SEVTEPKQQ----TESTPDVDAATGA---------------VDDGASVSS
A0A7Z0A2Z7      ----------VLGTVPASRNVPASDTKQAGDDHTTT---------------TRALHSAEQ
A0A285VUW0      -----------------------PVTAGETRGSRRQ---------------SGGARRLAR
A0A849PJI9      ----------KSKKAPQAPAVMPDSDPATRPAAAAAEATPAEEPK------SRAHRRRLS
A0A2R7Z032      -----------------------QAEYASREAYSTA---------------GKGKRRSK-
A0A6J4MTQ2      -----------------------KAEQKTAEAYASASTASTASTASTGGKLGKGRRVRAG
A0A1I0W453      -----------------------RAEYTSREAYSTA---------------GKGRRRKEA
A0A0Q6VV12      -----------------------RAEEATREAYSTA---------------GKGRRRKLV
A0A495NTA9      -----------------------KAEEETREKYSTA---------------GKG-RRKLV
A0A1H4LCS9      -----------------------KSEYASREAYSTA---------------GKGRRKLLK
A0A4Q2RZP8      -----------------------KAEYASREAYSTA---------------GKGRRKLTK
A0A0Q9QB08      -----------------------EADDTSREADATA---------------GGGRRRKHP
A0A7Y9H290      -----------------------KAEYASREAYSTA---------------GKGRRKLL-
A0A4Q2SA86      -----------------------QAEYASQEADATA---------------GKGWRKKAD
A0A4Z1C3Z0      -----------------------QAEYASLEAESSA---------------GKGWRKKAD
A0A6V8KDX4      -----------------------TRQRDAADLVRAA------------------------
A0A444BL03      -----------------------KTRKDYAKAASRG---------------KHAE-----
A0A7V9PCQ0      -----------------------RSAVDDGRARSLL---------------PLRAGEADL
A0A4Y8X357      -----------------------YRAPAESRKAEAP---------------LDGAGTDAA
R4LD52          -----------------------RRAGPVAPVRVAV---------------GRLPELMGA
A0A4T2CD79      -----------------------GALIANGRLTPTI---------------PVTAAESAD
A0A6L6AM03      -----------------------KAEYASREAYSTA---------------GKGRRRKQA
A0A4Q2RU39      -----------------------KSEYKSVEVYSTA---------------GKGRRRKPA
A0A4Q2SK58      -----------------------KSEYKSREAYSTA---------------GKGRRRREA
A0A2N3YJR1      -----------------------KSRRDYEKAS---------------------------
A0A6G8FYB9      -----------------------ASRKAYDTAPVAE---------------SDVVEPVVP
A0A4Q4D742      -----------------------ALPQAVRPEQPEK---------------SGDEASTLS
A0A1C6T1J1      -----------------------TPSVPADRATSGR---------------HAEHAAAGV
A0A2W2CFC8      -----------------------SSSLPVDRATAGR---------------HAEQTAADE
A0A2W2A4B0      -----------------------RSHRSAVPGSTSE---------------VTP------
A0A4Y9MDA5      -----------------------PLPAARVPAPAAE---------------PVGPVGVGA
A0A1H7N9P7      -----------------------PVPTAPAPLPAAR---------------SAEAADRPA
A0A1M7V0F8      -----------------------VGELPAVPVPAGR---------------IGQL-----
A0A1M3LEY6      ----------TAQAGFSQIISPAESPGRRQSSAVPPSGPARTTAQARQESV---------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------YGGAPQTAQTSPNGHDRGRLGRTVARVGHMLQRRRRGGR---------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      TAAPDPAADYVSLAGKGGKKKSKKSRRA--------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      S-----------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A838JYQ6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      MIEEYVPPRRRVKS----------------------------------------------
A0A2R7RCA1      -VPESVSAGRRARG----------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      DRDATDPHSTSGSVPEPVPAEPANRGRRAARHG---------------------------
Q6ADE8          DRDATDPHSTSGSVPEPVPAEPANRGRRAARHG---------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      REGTPHREAPFS------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A7V8X3I0      ------------------------------------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A838JNW7      ------------------------------------------------------------
                                                                            

A0A519GXS6      ------------------------------------------------------------
A0A6N6NKS9      RADGRAPRHKNTRI----------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      WQRPGKGTHRA-------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A345NSU7      RARQRLDRRNGSG-----------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A0W8I9Y2      RSNGQGSAEHESFGLEAWGRSGSSTGSTAQGH----------------------------
A0A7C6LSF9      AGKVGVVGGAGSVEEFDPYAGYDLDRDGLASSTPSEPPIESRRHRRRSSG----------
A0A255G8R8      -----------------------TPRQARE------------------------------
A0A6G7Y423      RAAAITPAPTRTASRRAAGAPPPSPRRPRQYHSRTAVR----------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A7K0NRJ7      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A7K0NTR2      ------------------------------------------------------------
A0A1H6WL79      AAEITSQAMLSGLGHAIAGPSNSLTNSSDTPSFLAPESQWRSPSDG-RGRRSAPPS----
A0A101LAM5      ---------------PDADAVNPVPDIREASPFLGSVSTWRAPQDGSRGRRSAPPS----
A0A4Y3NEG0      ---------------AD-NPATPLPEPREASTFLAPDSPWRAPQDGSRGRRSAPPRQV--
A0A1Q2CI19      --------------------------------------EPAEDVQAQRSK----------
A0A512T3M3      PR------------------------------------SAAVPGSGARSPRANRATG---
W6JTW4          PR------------------------------------PAVVEASPDDSV-SDRSGG---
A0A839J1M0      --------------------------------------PPREEEESEVDARPRRSRG---
A0A8A4Z8K4      --------------------------------------PPREEEESEVDARPRRSRG---
A0A0A0JTY0      --------------------------PTGHMGDFF---DDAEQPESRRSRRTSSSA----
A0A0A0JXF2      ----------------------GTADPTTTVDPVLGVDDDDVEPDSRRTRRRASSL----
E6S8H2          ----------------------ERVPESRS--------ARREASRKRSSRRTSSSA----
A0A0A0JGH0      ----------------------WSLPPRVD--------DPQDAAPSRRSRHSSH------
N0E4U7          ----------------------PFSPQADG--------APDDAALSRRARRTSSSA----
A0A0A0IYK2      PEDAPDDLQLDVTPGGEVPTATDEAHAATR--------GEVGEERRRSRRRSSSSA----
A0A0Q9L0H3      ----------------------DELHPPTT--------GDERPRESRHDRRTSSSL----
A3TMK0          ----------------------TESEPDDF--------LDDASRESRRTRRASSA-----
A0A543PXP1      ----------------------AKRPAHDV--------DSKSDPDSRQTRRTSSSSL---
A3TMH6          ----------------------SSTPPHPA--------ESEPGAESRRDRRTTSA-----
A0A6I2XCV4      ------------------------------------------------------------
A0A5R8VLL6      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A538JQF8      ----------------------------------------HEAPAAGPGSRVSDGKPRLR
A0A1H6YPK1      VFGQAPEGAEKGPGGHESIDETHSEERPPGEISFGHSVDAVEVAVSGRSAVRDTMHLRRL
A0A0Q9TBP0      ---------------HHGSAPTGHRDTPPVAPAGHGDSRKTAVAEPGDDVA---------
A0A0G3V3M7      ------------------------------------------------------------
A0A6I3DD56      ------------------------------------------------------------
A0A5Q2FA83      ---VRAARTALSSLFTEDPDDTQFSMPAITSEPVTQGTPLAAPAPASSPDETIDAPSPAL
A0A2R7MGI0      ---------------ARA----------------------------------LHAGEVFR
A0A2T7WQY4      ---------------ARV----------------------------------GASGEVRR
A0A0Q5Q5L3      ---------------NVSALRPLSHRRTKDRDAGEATSEVEVVRTSEPPVD-AGAPRRRR
A0A0Q6DVM4      ---------------NVSALRPLSHRRTKDRDAGEATSEVEVVRTSEPPVD-AGAPRRRR
A0A1N7DLV3      ---------------NVRGLRTLAPGRKGSPVPGDSGGEGVVPVAAPAADVPDDRTSRRR
A0A1V2NSB5      ---------------NVSGLRTLSARRNPVAASGDFTGEGAVAVAPPAAVVADERTPRRR
A0A1R3WWR6      ---------------NVRGLRTLSHGRTSASNQDDSSGENVASVTTAPSPV-G---RRRQ
A0A1G6GTN3      ---------------NVSGLRTLAPVTTPAVPGGEVTDEITVPATSGETAA-GTLPRRRT
A0A7W5GFA5      ---------------NVSGLRTLSQRRMSATAEGEAASEMTVAPIAEPGAV-DTMSRRRT
A0A2S5WZJ5      -------------------------------SSAPRATPAASQPTPPPQTPGSELPSRRS
A0A0Q5JKD6      --------------------LRTLSQRRMSATAEGEATSEIAVASTAEPDTVDTMSRRRA
A0A2W6DK08      ------------------------------------------------------------
A0A346XTB0      ------------------------------------------------------------
A0A542FTE6      --------------------------------------TRRNPPTIAPSDEMNDAPAERS
A0A7Y9QM02      --------------------------------------TRRNPPTIAPSDEAIDAP-ERA
A0A6I1G2U1      ------------------SSGSAEDAFDPYEGYDVRRDLATTDDSGDPPVLGQTRRQRRA
A0A351ETF8      ------------------------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A4Q2JUT1      ------------------EGTT--EASPETGKPDSKRRGRKR-AAKDAELVTEPPANERG
A0A6L5R0V7      ------------------PEAQPEEGAGETPKATPKRRGHKRNAAKDAELVTEPPADERG
A0A2S0LQ32      ------------------------------------------------------------
A0A7T8DZN6      ------------------------------------------------------------
A0A2N6V1R5      VVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGA
G9PHS6          VVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGA
U1PLM7          VVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGA
A0A4V1VGV9      ------------------------APSAPSRAGASEASGPNVAPHGRQSGEAPSPQGPRT
A0A2S5UYV0      --------------------------AV---VAQQQAPASETPSDLSSTPEVQGAPTRRS
A0A7W4UQ09      --------------------------GQAQGSAAPEVAPEQVPTAPAQTAPEAELPSRRS
A0A2S5X9U6      --------------------------VRSAPVVPAQLETQSAEP------VSEQPQSRRS
A0A2S5ULV5      --------------------------PAAEQAAPSQPQAGPVPSSAPTAVATEQPQSRRS
A0A653YMF0      --------------------------PATGQAVPEQAQAAPVQASAPTAVATEQPQSRRS
A0A7V9H755      ------------------------------------------------------------
A0A3Q9IY80      -------------------------------------------TGTATPTVVATDSTRRS
A0A0F0LP73      -------------DEGASRERRASRSRTVSDDAASSRATHARPRIAQTGQRSTPVRARRA
A0A346Y185      -----------------------------------------ETPDDRRPQKEVKPRRRPG
A0A7W0HGW1      -----------------------------------------------------GPRIHMP
A0A259S8H9      -------GEEASPAIVRPHGSNGRAAAARARRSVPPVEVAEPVGE----RVDGEDEAHDA
A0A2W1Z497      -------GARPSGGSRLTPSLPDRDASVPRSPVVSPYDPSLELPSRRSRRRAAAVGGTDD
A0A0Q5L115      -------GAAAAAAAAAAPGGEPAPARVPASPASPAAPTSPAVPA----SPVEAPGGALT
A0A7G6YY64      -------GAAAAAAAAAAPGVAPAPARVPASPASPAAPTSPAVPA----SPVEAPGGALT
A0A7J5B4S5      ---------------NVAPQNAGKKAQPQAAP--QQTAVAEPPLSNAAPSDSENAPTRRS
A0A852U976      ---------------NPVAPGAGRSAQAQAQPAVQQAPAPATTVNTSDPVDDQMAPTRRS
A0A1F1X071      ------------------------EPGPVVEP------------DGHEPEGDSAAAARTS
A0A3R8RWC7      -----------EAPRRAAQASPRPEAQPVAHPARAADESAPVEHDENEPEGDSAPAARTS
A0A4U0RJZ4      ------------------DPMRGASSEAPSASANVECAPREATPATSGSDGAPPSRRSRR
A0A4R1FGL9      ------------------DPMRGESSQAPSASANVERAPRQATPATSDSDGAPPSRRARR
E3B8H1          ------------------DPMRGESSQAPSASANVERAPRQATPATSDSDGAPPSRRARR
A0A7D7WDT9      ---------------RTVHDSPSTTNTVSPTPEPAGSSQPDVRDATPPTQSELPQLRRRS
A0A0Q5AWK6      -------------------------------------------VE---SRAERPTASRRT
A0A6P1F176      -------------------AEPERAVGPARTVEPARSTEHVVRAA---PKADVPASFRRP
A0A3N1NLD3      ---------------RAAEPERTRVAEPERAVEPARSLEHVVRAA---PKAEVPSSFRRP
A0A3N2FVI8      EPERAAEPERAAEPERAAEPERTRVTEPERAAEPARSLEHVVRAA---PKAEVPSSFRRP
A0A2S5XDQ6      ---------------AAAAPRRSELAPVESRALP-------------------PQTSRRA
A0A2S5XNN6      ---------------AAAAPRRSELAPVESRALP-------------------PQTSRRA
A0A5C8C085      PGRRVASWSN--------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A7V9FXS6      ------------------------------------------------------------
A0A7W0PY69      ------------------------------------------------------------
A0A7W8YB99      AVHPRQTAKPSSSASRRATHQESANGENFDDILFGGAHVRKPHDKK--------------
A0A1L2ZMQ6      -------TKPAP--------------DNFDEIVFRGTRAKRSDES---------------
A0A7W8TR75      -------TKPSS--------------DNFDEIVFRGTRAKRSDES---------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A3E2DN22      EGLVRVPKKDRADTDTEITP--------RRAK----------------------------
A0A3Q9ULZ9      RAVRTNGSDT-DQIPAGLRPVGPQPKPARRAR----------------------------
A0A3S9JFL2      RVTSSSASRSQENRPADLTPVGPRPRPARRAR----------------------------
A0A3L8NYD3      SIAGKRRSS---------------------------------------------------
A0A1M6K628      STQL--------------------------------------------------------
A0A561E8R3      K-----------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A7I7UD03      ------------------------------------------------------------
A0A7I7MI62      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      ------------------------------------------------------------
A0A7I9ZLK4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A7H2BCD6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A7T4T4U7      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A4R6Q3C6      ------------------------------------------------------------
A0A7T3CHP7      ------------------------------------------------------------
A0A7Y5U6C1      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      PQMPAPVAPAPAAPTPVTSPSAGPVEPKPVDSQQESPWPFTELDLPDPSLSDQASDPSQL
A0A2S8WHZ8      SSEPEFRRLRRRR-----------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A7W9IKV0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A7Z9A2N0      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
A0A7T9UPU8      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A838H0S5      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      KDGAEI------------------------------------------------------
A0A2T0UZ65      RRG---------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A7G6YA19      R-----------------------------------------------------------
A0A853CXS3      ------------------------------------------------------------
A0A7W8YB56      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A7W8TSW5      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      DQPSRRSRRTSALSQD--------------------------------------------
A0A542XE74      NTVG--------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A7X7XPM3      TDAPAGP-----------------------------------------------------
A0A5R8L819      RSA---------------------------------------------------------
A0A7K0PFV4      RTARRIVQGSG-------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A7K0MUQ7      ------------------------------------------------------------
A0A7K0U619      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      TDDQAAELAEPRRPVA--------------------------------------------
A0A2T0S3C8      EPIGSGR-----------------------------------------------------
A0A810MDE3      EPIGSGR-----------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A7X0KT97      AGPAEAETGNPVGAGARRSRG---------------------------------------
A0A853DGU7      RSERHVHLKRRAKV----------------------------------------------
A0A7Z0A2Z7      VGDKDGQTVSRSQLG---------------------------------------------
A0A285VUW0      RKGARAARR---------------------------------------------------
A0A849PJI9      RR----------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A6J4MTQ2      K-----------------------------------------------------------
A0A1I0W453      KAKAAKVDKVEKVDTAEKPSASEKAGTS--------------------------------
A0A0Q6VV12      RSSSDKA-----------------------------------------------------
A0A495NTA9      KSLKG-------------------------------------------------------
A0A1H4LCS9      VGKKD-------------------------------------------------------
A0A4Q2RZP8      LGRKS-------------------------------------------------------
A0A0Q9QB08      KKAAKNAAKKDAEAEAQTEADAGV------------------------------------
A0A7Y9H290      --------------------------KSNKS-----------------------------
A0A4Q2SA86      KGDKAADAEQAE--------AAAEAEKAARS-----------------------------
A0A4Z1C3Z0      KADKPDKADKPDKPAQAEQAEAGEAEKATRS-----------------------------
A0A6V8KDX4      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A7V9PCQ0      SSSRQRLGWRRAWRLG--------------------------------------------
A0A4Y8X357      AEARGSTVAEERRG----------------------------------------------
R4LD52          GRPGKERSKVGSAS----------------------------------------------
A0A4T2CD79      STARAESTELKDPTAAL-------------------------------------------
A0A6L6AM03      KSEAKAEAKAQSKAGSKTEATAAKNADAPEKAAKS-------------------------
A0A4Q2RU39      KAEKAEKAEKSEKAGKS-------------------------------------------
A0A4Q2SK58      KVDKADTPVTPDKPARPVKAGRTSKR----------------------------------
A0A2N3YJR1      ------------------RGRHGTD-----------------------------------
A0A6G8FYB9      AGPGVPVPVAKPASKVRRTAARKAD-----------------------------------
A0A4Q4D742      RS----------------------------------------------------------
A0A1C6T1J1      S-DRTQELTRLPR-----------------------------------------------
A0A2W2CFC8      PVDNAEELTRLSR-----------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      RKK---------------------------------------------------------
A0A1H7N9P7      SRR---------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A838H149      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A838JYQ6      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
A0A7V8X3I0      ------------------------------------------------------------
A0A7V8YPJ0      ------------------------------------------------------------
A0A7X7Q7T7      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A838JNW7      ------------------------------------------------------------
                                                                            

A0A519GXS6      -----------------
A0A6N6NKS9      -----------------
A0A538BYZ4      -----------------
A0A348NU28      -----------------
A0A2N4T4Q5      -----------------
A0A4Q5APW3      -----------------
A0A4Q5B0V3      -----------------
A0A022KX11      -----------------
A0A4Q5A868      -----------------
A0A6N4VXX3      -----------------
A0A1H4I042      -----------------
A0A4R7A6D9      -----------------
A0A345NSU7      -----------------
A0A222TG79      -----------------
A0A0W8I9Y2      -----------------
A0A7C6LSF9      -----------------
A0A255G8R8      -----------------
A0A6G7Y423      -----------------
A0A4Q4D4T1      -----------------
A0A1Q2CRV2      -----------------
A0A261FE22      -----------------
A0A7K0NRJ7      -----------------
K6WHS4          -----------------
A0A7K0NTR2      -----------------
A0A1H6WL79      -----------------
A0A101LAM5      -----------------
A0A4Y3NEG0      -----------------
A0A1Q2CI19      -----------------
A0A512T3M3      -----------------
W6JTW4          -----------------
A0A839J1M0      -----------------
A0A8A4Z8K4      -----------------
A0A0A0JTY0      -----------------
A0A0A0JXF2      -----------------
E6S8H2          -----------------
A0A0A0JGH0      -----------------
N0E4U7          -----------------
A0A0A0IYK2      -----------------
A0A0Q9L0H3      -----------------
A3TMK0          -----------------
A0A543PXP1      -----------------
A3TMH6          -----------------
A0A6I2XCV4      -----------------
A0A5R8VLL6      -----------------
A0A3L7ADK2      -----------------
A0A538JQF8      WSWSAGAEDFLGREGPA
A0A1H6YPK1      FRT--------------
A0A0Q9TBP0      -----------------
A0A0G3V3M7      -----------------
A0A6I3DD56      -----------------
A0A5Q2FA83      SRGRRFAE---------
A0A2R7MGI0      DLG--------------
A0A2T7WQY4      SRG--------------
A0A0Q5Q5L3      TTP--------------
A0A0Q6DVM4      TTP--------------
A0A1N7DLV3      QRG--------------
A0A1V2NSB5      RRG--------------
A0A1R3WWR6      R----------------
A0A1G6GTN3      RRG--------------
A0A7W5GFA5      RRG--------------
A0A2S5WZJ5      RRGA-------------
A0A0Q5JKD6      RRG--------------
A0A2W6DK08      -----------------
A0A346XTB0      -----------------
A0A542FTE6      HLA--------------
A0A7Y9QM02      HLA--------------
A0A6I1G2U1      SSG--------------
A0A351ETF8      -----------------
A0A349B7N2      -----------------
A0A4Q2JUT1      SRD--------------
A0A6L5R0V7      ARD--------------
A0A2S0LQ32      -----------------
A0A7T8DZN6      -----------------
A0A2N6V1R5      PQASVPTRRSLRERRNG
G9PHS6          PQASVPTRRSLRERRNG
U1PLM7          PQASVPTRRSLRERRNG
A0A4V1VGV9      RRARRRADLGE------
A0A2S5UYV0      RRGA-------------
A0A7W4UQ09      RRGA-------------
A0A2S5X9U6      RRGA-------------
A0A2S5ULV5      RRGA-------------
A0A653YMF0      RRGA-------------
A0A7V9H755      -----------------
A0A3Q9IY80      RRSKR------------
A0A0F0LP73      KDANDLDPDATA-----
A0A346Y185      GRHREKATTK-------
A0A7W0HGW1      ARGTVDRSTTKT-----
A0A259S8H9      AKPRYARRNARP-----
A0A2W1Z497      TRP--------------
A0A0Q5L115      RREIRERERTR------
A0A7G6YY64      RREIRERERTR------
A0A7J5B4S5      RRGA-------------
A0A852U976      RRGA-------------
A0A1F1X071      PRGRRAASTWGR-----
A0A3R8RWC7      PRGRRAASTWGR-----
A0A4U0RJZ4      FRANDDA----------
A0A4R1FGL9      FRANDDA----------
E3B8H1          FRANDDA----------
A0A7D7WDT9      STRA-------------
A0A0Q5AWK6      LR---------------
A0A6P1F176      AR---------------
A0A3N1NLD3      AR---------------
A0A3N2FVI8      AR---------------
A0A2S5XDQ6      AR---------------
A0A2S5XNN6      AR---------------
A0A5C8C085      -----------------
A0A4Y5YMQ6      --------------MEP
A0A1E4BP96      -----------------
A0A7V9FXS6      -----------------
A0A7W0PY69      -----------------
A0A7W8YB99      -----------------
A0A1L2ZMQ6      -----------------
A0A7W8TR75      -----------------
A0A151BT98      -----------------
A0A2Y8ZRF8      -----------------
A0A2R9UAT1      -----------------
A0A3E2DN22      -----------------
A0A3Q9ULZ9      -----------------
A0A3S9JFL2      -----------------
A0A3L8NYD3      -----------------
A0A1M6K628      -----------------
A0A561E8R3      -----------------
A0A4Q5J5D7      -----------------
A0A1Y4CKD6      -----------------
A0A0Q7KBQ4      -----------------
A0A5Q5BFU2      -----------------
A0A439DNZ6      -----------------
A0A7I7UD03      -----------------
A0A7I7MI62      -----------------
A0A0J6YE86      -----------------
A0A7I7K1R9      -----------------
A0A7I9ZLK4      -----------------
A0A1F1IHY9      -----------------
A0A7H2BCD6      -----------------
A0A3S0V9U6      -----------------
A0A7T4T4U7      -----------------
A0A1S2N0P2      -----------------
A0A0Q3BEY5      -----------------
A0A4R6Q3C6      -----------------
A0A7T3CHP7      -----------------
A0A7Y5U6C1      -----------------
A0A542HCT5      -----------------
A0A537WNY9      -----------------
A0A5B8M469      TSRRSGRRASGLPRGDQ
A0A2S8WHZ8      -----------------
A0A1Y4CTD2      -----------------
A0A3N3ZPU0      -----------------
A0A359IQX7      -----------------
A0A7W9IKV0      -----------------
A0A1N7E3F1      -----------------
A0A544ZKQ1      -----------------
A0A5D0Q2X0      -----------------
A0A5R8Z2E7      -----------------
A0A0Q9LZR0      -----------------
A0A1F1J417      -----------------
A0A2A8D6P2      -----------------
A0A1F0THV9      -----------------
A0A5F0M6Y0      -----------------
E3H5W1          -----------------
A0A1F1QKB0      -----------------
A0A509JY23      -----------------
A0A448USF4      -----------------
A0A7Z9A2N0      -----------------
A0A433EDP2      -----------------
A0A231VTW0      -----------------
A0A433ECD0      -----------------
A0A7T9UPU8      -----------------
U7V3Z1          -----------------
A0A6I3F378      -----------------
A0A838H0S5      -----------------
A0A1S1CQC5      -----------------
A0A1E9T6I0      -----------------
A0A1F1GHA7      -----------------
A0A1S1CAD0      -----------------
G5ET14          -----------------
A0A1E9DXX2      -----------------
A0A1E8S156      -----------------
A0A1E8S5S2      -----------------
A0A1S1DFA8      -----------------
A0A2I1Z490      -----------------
A0A1F0DAA9      -----------------
A0A1F0PHK9      -----------------
A0A1F0VZG6      -----------------
A0A1E9G8X4      -----------------
A0A1E9IAW2      -----------------
A0A1E9ZBC9      -----------------
A0A1E9ZDP4      -----------------
A0A1F0R6B5      -----------------
A0A1F0Z7N5      -----------------
A0A1F1D897      -----------------
D2NP38          -----------------
A0A1F1FV74      -----------------
A0A1E9M791      -----------------
A0A291DEI8      -----------------
A0A1S1D5T1      -----------------
A0A1E8TRD6      -----------------
A0A1F0XT88      -----------------
A0A1F1EVP5      -----------------
C6R548          -----------------
A0A0K2RXS2      -----------------
A0A1F0KX60      -----------------
A0A542I3V2      -----------------
A0A2T0UZ65      -----------------
A0A0Q5M6Z7      -----------------
A0A7G6YA19      -----------------
A0A853CXS3      -----------------
A0A7W8YB56      -----------------
A0A1L2ZMV4      -----------------
A0A7W8TSW5      -----------------
A0A1R4JTI6      -----------------
A0A4R7TM52      -----------------
A0A542XE74      -----------------
A0A0Q7QDF6      -----------------
A0A7X7XPM3      -----------------
A0A5R8L819      -----------------
A0A7K0PFV4      -----------------
A0A0G3V3F3      -----------------
A0A7K0MUQ7      -----------------
A0A7K0U619      -----------------
A0A6I3DFP2      -----------------
A0A7K0SI36      -----------------
A0A7K0V140      -----------------
A0A261FQA1      -----------------
A0A1Q2CJ92      -----------------
A0A2T0S3C8      -----------------
A0A810MDE3      -----------------
A0A4Y8WZJ3      -----------------
A0A7X0KT97      -----------------
A0A853DGU7      -----------------
A0A7Z0A2Z7      -----------------
A0A285VUW0      -----------------
A0A849PJI9      -----------------
A0A2R7Z032      -----------------
A0A6J4MTQ2      -----------------
A0A1I0W453      -----------------
A0A0Q6VV12      -----------------
A0A495NTA9      -----------------
A0A1H4LCS9      -----------------
A0A4Q2RZP8      -----------------
A0A0Q9QB08      -----------------
A0A7Y9H290      -----------------
A0A4Q2SA86      -----------------
A0A4Z1C3Z0      -----------------
A0A6V8KDX4      -----------------
A0A444BL03      -----------------
A0A7V9PCQ0      -----------------
A0A4Y8X357      -----------------
R4LD52          -----------------
A0A4T2CD79      -----------------
A0A6L6AM03      -----------------
A0A4Q2RU39      -----------------
A0A4Q2SK58      -----------------
A0A2N3YJR1      -----------------
A0A6G8FYB9      -----------------
A0A4Q4D742      -----------------
A0A1C6T1J1      -----------------
A0A2W2CFC8      -----------------
A0A2W2A4B0      -----------------
A0A4Y9MDA5      -----------------
A0A1H7N9P7      -----------------
A0A1M7V0F8      -----------------
A0A1M3LEY6      -----------------
A0A538AJI7      -----------------
A0A538AM15      -----------------
A0A520EHH5      -----------------
A0A4R0U4F1      -----------------
A0A1V8PLV6      -----------------
A0A357ZCV8      -----------------
A0A419GS64      -----------------
A0A4R1CW45      -----------------
A0A4R5Z7B0      -----------------
A0A542H054      -----------------
A0A6M8GFV5      -----------------
A0A7G8U6J2      -----------------
A0A2S8MDM2      -----------------
A0A357ZDL3      -----------------
A0A1I6GVG4      -----------------
A0A1I6IST1      -----------------
A0A412JBM5      -----------------
A0A6J4SUA1      -----------------
A0A1C2B334      -----------------
R7Y679          -----------------
A0A4Y8ZIU8      -----------------
A0A0F0KYJ9      -----------------
A0A838H149      -----------------
A0A7M2YYB9      -----------------
A0A7K0LE65      -----------------
A0A838JYQ6      -----------------
A0A510HHA8      -----------------
A0A6G8Q9J3      -----------------
A0A538BBM6      -----------------
A0A5Q2F9A3      -----------------
A0A0K8Q3D9      -----------------
A0A2R7RCA1      -----------------
A0A1Q7WJN6      -----------------
A0A1E2SNF6      -----------------
Q6ADE8          -----------------
A0A1Q7CZ24      -----------------
A0A2W6VLC6      -----------------
A0A519G798      -----------------
A0A7V8X3I0      -----------------
A0A7V8YPJ0      -----------------
A0A7X7Q7T7      -----------------
A0A6G8QDQ0      -----------------
A0A023X491      -----------------
A0A4R1BMZ2      -----------------
A0A838JNW7      -----------------
                                 

© 1998-2022Legal notice