BYKdb

Dataset for cluster orphancd of phylum actinobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

275 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A7K0NRJ7      -----------------------------------------------------------M
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A7K0NTR2      ------------------------------------------------------------
A0A1H6WL79      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A0A4Y3NEG0      ------------------------------------------------------------
A0A1Q2CI19      ------------------------------------------------------------
A0A512T3M3      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A543PXP1      ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A6I2XCV4      ------------------------------------------------------------
A0A5R8VLL6      --MGPRHCLINREPGRRVACCRYPQFPHSSPRAPTSSRLYQTSTFGRVLAWQHAEAAPDT
A0A3L7ADK2      ------------------------------------------------------------
A0A538JQF8      ------------------------------------------------------------
A0A1H6YPK1      ------------------------------------------------------------
A0A0Q9TBP0      ------------------------------------------------------------
A0A0G3V3M7      ------------------------------------------------------------
A0A6I3DD56      ------------------------------------------------------------
A0A5Q2FA83      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A346XTB0      ------------------------------------------------------------
A0A6I1G2U1      ------------------------------------------------------------
A0A351ETF8      ------------------------------------------------------------
A0A542FTE6      ------------------------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A7J5B4S5      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A6L5R0V7      MPASVASETIREASCSAECAETTRCSGSFDSLPLPMLAVSVIVGSARSSTRSIQWPRIRS
A0A2S5UYV0      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A653YMF0      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A346Y185      ------------------------------------------MEAVCLFCWQLWQGSQLE
A0A4V1VGV9      ------------------------------------------------------------
A0A7G8U6P0      ------------------------------------------------------------
A0A259S8H9      ------------------------------------------------------------
A0A2W1Z497      ------------------------------------------------------------
A0A0Q5L115      ------------------------------------------------------------
A0A7G6YY64      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
A0A4U0RJZ4      ------------------------------------------------------------
A0A4R1FGL9      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A7D7WDT9      ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A6P1F176      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A4R6Q3C6      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A7I7UD03      ------------------------------------------------------------
A0A7I7MI62      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      ------------------------------------------------------------
A0A7I9ZLK4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A7H2BCD6      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A7G6YA19      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A7K0PFV4      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A7K0MUQ7      ------------------------------------------------------------
A0A7K0U619      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A6J4MTQ2      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A6V8KDX4      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A6L6AM03      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A6G8FYB9      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A7K0NRJ7      TPRDATTTPTAIAKAVGRSRLARLKPRSRGFWSRPTMSPDTTRGTEGLERRVSCPHMDLA
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ----------------------------------------------MPIDEDQRQGEGLR
A0A3E2DN22      --------------------------------------------------------MTIV
A0A3Q9ULZ9      --------------------------------------------------------MTVI
A0A3S9JFL2      --------------------------------------------------------MTVI
A0A7K0NTR2      --------------------------------------------------------MRPA
A0A1H6WL79      -----------------------------------------MERTTQLLQDDKPQGMSGN
A0A101LAM5      --------------------------------------------------------MSGN
A0A4Y3NEG0      -----------------------------------------------MLQDDKPQGMSGN
A0A1Q2CI19      --------------------------------------------------------MSLK
A0A512T3M3      --------------------------------------------------------MTLR
W6JTW4          --------------------------------------------------------MPLR
A0A0A0JTY0      --------------------------------------------------------MTLQ
A0A0A0JXF2      --------------------------------------------------------MTLQ
E6S8H2          --------------------------------------------------------MTLS
A0A0A0JGH0      --------------------------------------------------------MTLQ
N0E4U7          --------------------------------------------------------MTLR
A0A0A0IYK2      --------------------------------------------------------MTLQ
A0A0Q9L0H3      --------------------------------------------------------MTLQ
A3TMK0          --------------------------------------------------------MTLQ
A0A543PXP1      --------------------------------------------------------MTLK
A3TMH6          --------------------------------------------------------MTLN
A0A6I2XCV4      ------------------------------MSTPETPQDFSRANSSPNQPDLFGSSTALR
A0A5R8VLL6      GNHEKGEVMAEEEFFRTGPVAPGPFAMPAHSARQPAGGIGSLSNPEIGGSEASAAGMGVS
A0A3L7ADK2      ------------------------------------------MDAETNPDIVNDNDRSLR
A0A538JQF8      -----------------------------------------------------------M
A0A1H6YPK1      --------------------------------------------------------MEFR
A0A0Q9TBP0      ------------------------------------------------------------
A0A0G3V3M7      --------------------------------------------------------MRPA
A0A6I3DD56      --------------------------------------------------------MRPA
A0A5Q2FA83      --------------------------------------------------------MQFR
A0A2R7MGI0      ----------------------------------------------------------MQ
A0A2T7WQY4      --------------------------------------------------------MDMQ
A0A1G6GTN3      ----------------------------------------------------------MQ
A0A1N7DLV3      ----------------------------------------------------------MQ
A0A1V2NSB5      ----------------------------------------------------------MQ
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ----------------------------------------------------------MQ
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A2W6DK08      --------------------------------------------------------MGIK
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A346XTB0      ---------------------------------------------------MEEQLRRGP
A0A6I1G2U1      ------------MGFVRDKPVHRVGIDSRVGGRSVDAAHERFEHELMGDARGADTTMNAR
A0A351ETF8      -----------------MSAAVVGVRPVNVAELQHVRGSFCMAEQPSNQDSSSLAVLDLR
A0A542FTE6      --------------------------------------------MASTVDEQITPTLDLR
A0A349B7N2      ------------------------------------------------------------
A0A7J5B4S5      --------------------------------------------------------MTVL
A0A4Q2JUT1      ----------------------------------MDPTRSWSTAPRMGRWHDPEVSMELR
A0A6L5R0V7      RTSSGTEASKSTRTTESRTRTSKAVDIPWTLLAHGSPHRGWN------RWHDPEVSMELR
A0A2S5UYV0      --------------------------------------------------------MTVL
A0A2S5X9U6      --------------------------------------------------------MTVL
A0A2S5ULV5      --------------------------------------------------------MTVL
A0A653YMF0      --------------------------------------------------------MTVL
A0A3Q9IY80      --------------------------------------------------------MELR
A0A0F0LP73      --------------------------------------------------------MTVL
A0A346Y185      RTSRWRGGSSWGQRRKACGSSLRVVRVSAEVRGGVHLLEAHRSGRLNPMDSLQAPATSVE
A0A4V1VGV9      --------------------------------------------------------MTAL
A0A7G8U6P0      --------------------------------------------------------MTAL
A0A259S8H9      ----------------------------------------------------------ML
A0A2W1Z497      --------------------------------------------MAPDARPDERTSRTLA
A0A0Q5L115      -------------------------------------------MDRPDTEPRPRTL-DLQ
A0A7G6YY64      -------------------------------------------MDRPDTEPRTRTL-DLQ
A0A1F1X071      --------------------------------------------------------MTIE
A0A3R8RWC7      --------------------------------------------------------MTIE
A0A4U0RJZ4      --------------------------------------------------------MTIL
A0A4R1FGL9      --------------------------------------------------------MTIL
E3B8H1          --------------------------------------------------------MTIL
A0A7D7WDT9      ----------------MRQHRVATSGLRYDGVVYERLRAQGQGAPLSVSSVRGFARVTVL
A0A0Q5AWK6      --------------------------------------------------------MTVV
A0A6P1F176      --------------------------------------------------------MTVV
A0A3N1NLD3      --------------------------------------------------------MTVV
A0A3N2FVI8      --------------------------------------------------------MTVV
A0A2S5XDQ6      --------------------------------------------------------MTVV
A0A2S5XNN6      --------------------------------------------------------MTVV
A0A3L8NYD3      ------------------------------------------MEAAR---------VTVV
A0A1M6K628      ------------------------------------------MAIARRKPRTGRDILDLV
A0A561E8R3      --------------------------------------------------------MTVT
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A151BT98      --------------------------------------------------------MTIR
A0A2Y8ZRF8      --------------------------------------------------------MTIR
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A3S0V9U6      --------------------------------------------------------MTLL
A0A1S2N0P2      --------------------------------------------------------MTLL
A0A0Q3BEY5      --------------------------------------------------------MTLL
A0A4R6Q3C6      --------------------------------------------------------MTLL
A0A2X3GKL3      --------------------------------------------------------MTLL
A0A1Y4CKD6      ---------------------------------MNDRRYGLDLSPVRDEEQGLDMAELAS
A0A0Q7KBQ4      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A7I7UD03      ------------------------------------------------------------
A0A7I7MI62      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      ------------------------------------------------------------
A0A7I9ZLK4      ------------------------------------------------------------
A0A1F1IHY9      --------------------------------------------------------MSLS
A0A7H2BCD6      --------------------------------------------------------MTVL
A0A542HCT5      -----------------------MPQTNPKGAERPLASVLLHFALLGGALRGEFIGVELT
A0A0Q5M6Z7      ----------------------------------------------------------MR
A0A7G6YA19      ------------------------------------------MTTPTDNTENQSKGRDLR
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      --------------------------------------------------------MDLR
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ---------------------------------------------------MVLDGVTVR
A0A3N3ZPU0      -------------------------------------MPQQDTSDEQYLDAPVHIAHRLR
A0A359IQX7      --------------------------------------------MLRVGTLETGRPMTLL
A0A433EDP2      --------------------------------------------------------MTIL
A0A231VTW0      --------------------------------------------------------MTIL
A0A433ECD0      --------------------------------------------------------MTIL
U7V3Z1          --------------------------------------------------------MTIL
A0A1F1J417      --------------------------------------------------------MTIL
A0A2A8D6P2      --------------------------------------------------------MTIL
A0A1F0THV9      --------------------------------------------------------MTIL
A0A5F0M6Y0      --------------------------------------------------------MTIL
E3H5W1          --------------------------------------------------------MTIL
A0A1F1QKB0      --------------------------------------------------------MTIL
A0A509JY23      --------------------------------------------------------MTIL
A0A448USF4      --------------------------------------------------------MTIL
A0A0Q9LZR0      --------------------------------------------------------MELT
A0A1N7E3F1      --------------------------------------------------------MELL
A0A544ZKQ1      --------------------------------------------------------MELL
A0A372P1T1      --------------------------------------------------------MELL
A0A5D0Q2X0      --------------------------------------------------------MELL
A0A5R8Z2E7      --------------------------------------------------------MELL
A0A1L2ZMV4      -------------------------------------------MEYTAENQPQALNHQVR
A0A6I3F378      ------------------------------------------------MEPQLTPARTLG
A0A1S1CQC5      --------------------------------------------------------MTIL
A0A1E9T6I0      --------------------------------------------------------MTIL
A0A1F1GHA7      --------------------------------------------------------MTIL
A0A1S1CAD0      --------------------------------------------------------MTIL
G5ET14          --------------------------------------------------------MTIL
A0A1E9DXX2      --------------------------------------------------------MTIL
A0A1E8S156      --------------------------------------------------------MTIL
A0A1E8S5S2      --------------------------------------------------------MTIL
A0A1S1DFA8      --------------------------------------------------------MTIL
A0A2I1Z490      --------------------------------------------------------MTIL
A0A1F0DAA9      --------------------------------------------------------MTIL
A0A1F0PHK9      --------------------------------------------------------MTIL
A0A1F0VZG6      --------------------------------------------------------MTIL
A0A1E9G8X4      --------------------------------------------------------MTIL
A0A1E9IAW2      --------------------------------------------------------MTIL
A0A1E9ZBC9      --------------------------------------------------------MTIL
A0A1E9ZDP4      --------------------------------------------------------MTIL
A0A1F0R6B5      --------------------------------------------------------MTIL
A0A1F0Z7N5      --------------------------------------------------------MTIL
A0A1F1D897      --------------------------------------------------------MTIL
D2NP38          --------------------------------------------------------MTIL
A0A1F1FV74      --------------------------------------------------------MTIL
A0A1E9M791      --------------------------------------------------------MTIL
A0A291DEI8      --------------------------------------------------------MTIL
A0A1S1D5T1      --------------------------------------------------------MTIL
A0A1E8TRD6      --------------------------------------------------------MTIL
A0A1F0XT88      --------------------------------------------------------MTIL
A0A1F1EVP5      --------------------------------------------------------MTIL
C6R548          --------------------------------------------------------MTIL
A0A0K2RXS2      --------------------------------------------------------MTIL
A0A1F0KX60      --------------------------------------------------------MTIL
A0A542I3V2      -----------------------------------------MTGKHEVNSDESAAGMGVR
A0A2T0UZ65      --------------------------------------------------------MTFL
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      --------------------------------------------------------MELQ
A0A542XE74      --------------------------------------------------------MTIL
A0A0Q7QDF6      --------------------------------------------------------MTSR
A0A5R8L819      ----------------------------------------------------MRSVVELG
A0A7K0PFV4      ------------------------------------------MSSFSDPETPDASDRALW
A0A0G3V3F3      --------------------------------------------------------MDLA
A0A7K0MUQ7      ------------------------------------MSPDTTRGTEALERRVSCRHMDLA
A0A7K0U619      ------------------------------------MSPDTTRGTEALERRVSCRHMDLA
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      --------------------------------------------------------MSIA
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      --------------------------------------------------------MDVR
A0A4Y8WZJ3      -------------------------------------------------MAPAPPVMSLS
A0A285VUW0      --------------------------------------------------------MSVR
A0A2R7Z032      --------------------------------------------------------MTFA
A0A6J4MTQ2      --------------------------------------------------------MTFG
A0A1I0W453      --------------------------------------------MVGGGAPPRLAGMTFG
A0A1H4LCS9      --------------------------------------------------------MTFG
A0A4Q2RZP8      --------------------------------------------------------MTFG
A0A0Q6VV12      --------------------------------------------------------MTFG
A0A495NTA9      --------------------------------------------------------MTFG
A0A0Q9QB08      --------------------------------------------------------MTFG
A0A4Q2SA86      --------------------------------------------------------MTFG
A0A4Z1C3Z0      --------------------------------------------------------MTFG
A0A6V8KDX4      ------------------------------------------------------------
A0A444BL03      --------------------------------------------------------MTLL
A0A4Y8X357      --------------------------------------------------------MNLL
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A6L6AM03      --------------------------------------------------------MTFG
A0A4Q2RU39      --------------------------------------------------------MTFA
A0A4Q2SK58      --------------------------------------------------------MTFA
A0A2N3YJR1      --------------------------------------------------------MTLL
A0A6G8FYB9      --------------------------------------------------------MTLL
A0A4Q4D742      ----------------------------------------------------MGVHVELR
A0A1C6T1J1      --------------------------------------------------------MDLY
A0A2W2CFC8      --------------------------------------------------------MDPL
A0A2W2A4B0      ----------------------------------------------------------MT
A0A4Y9MDA5      --------------------------------------------------------MSLS
A0A1H7N9P7      --------------------------------------------------------MSLS
A0A1M7V0F8      --------------------------------------------------------MTLS
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      --------------------------------MD------TYQG----------------
A0A4R7A6D9      --------------------------------MD------TYQG----------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A7K0NRJ7      AHFRIIARAWKQILIAGVLVAVAMFFWSNRA-ER------VYEATALLAVTPSDTG----
K6WHS4          --------------------------------------SASYQN----------------
A0A1L2ZMQ6      ILMAVVRRFWPVLLIATLVGALCGFGWAALQ-PK------MYQSTSSGLIVTPKSS----
A0A3E2DN22      DVVRILRRNLALLVICTLAGGLLGAVYQLTR-SE------TFTAKATGMVVAGDST----
A0A3Q9ULZ9      DFVRLLRRNLLLLVICGVVGMGAAAAYVFTR-PV------QYVAQSTAMVVAGDSS----
A0A3S9JFL2      DLVRLLRRNLALLLVCGLVGIAAAAAYVFTR-PV------QYVAESTAMVVAGDSS----
A0A7K0NTR2      DYLRIIRRRWWVLLVTVVIAMTFVMLMRPSS-SD------AVERNKPGLSFKATAT----
A0A1H6WL79      DLLSVVRSHWLGILVITVLMTGGSLGWYALQ-PK------VYAAESSGIVVAAGAE----
A0A101LAM5      DLLSVVRSHWLGILFITVLMVGGSLGWYALQ-PK------VYSAESSGIVVAAGAE----
A0A4Y3NEG0      DLLSVVRSHWLGILLITVFMVGGSLGWYTLQ-PK------IYSAESSGIVVTAGAE----
A0A1Q2CI19      DFLSILRHRWLVIVLCVLIAAGVVFAITPAE-RDVSPRIGSYTATSTLLVGSV-GA----
A0A512T3M3      DYLIVFRHYGALIVATILAAATLTWVLTPAH-AQGPVT--SYTATATLLAAS--SE----
W6JTW4          EYLRILLHRAPLIAGATVVAGLLSWFLVPAG-TQNAPR--SYTATAQMTVDG--GE----
A0A0A0JTY0      DYFKVFRHRWIIIVICALVAGAITWFITPAS-SDTTKKVGSYTATATMLVTAKASS----
A0A0A0JXF2      DYIKVFRHRWIVIVLCAVIAAGVTWLVTPAS-ADTTKKVGSYTATATILV----GS----
E6S8H2          EYLKVFRQRWLIIAITTLVAGAVMWVTSPAV-ADTSQKASSYTATATLLV----TS----
A0A0A0JGH0      DYIRIIRQRWIVIVICAAVAGLVTWFLTPAN-ASSVKDAPSYTATATVLV----SA----
N0E4U7          DYLTIARRRWPIIVACALVAAAVTWFLTPAQ-TDEAEVAPSYTATATLLV----GS----
A0A0A0IYK2      DYIKVFRHRWMVILVCALVAGAVTWFVTPAS-ADTTKKVGSYAATATILV----GS----
A0A0Q9L0H3      DYIKVFRHRWPVILICALVAGAATWFITPAS-SDTTKKVGSYTATATLLV----GS----
A3TMK0          DYIKVFRHRWPVILICALVAGAATWFITPAS-SDTTKKVGSYTATATILV----GS----
A0A543PXP1      DYLKVFRHRWPVIVACALSAAAIMWLVTPAQ-TATAQKASSYTATATLLV----GT----
A3TMH6          DYLKAFRRRWLVIALCAVVAGAVMWTVTPAH-PEVTRSTGSYTATATLLV----ER----
A0A6I2XCV4      HYAAVVRRRWRWIAAGLVLGMVGGLISTVIA-TS--------TAPKSSYFKATNTI----
A0A5R8VLL6      DYARVARTYWKHITVITLIVTVLATAWSAFR-PR------VFAAEATAIVLAVGTD----
A0A3L7ADK2      DFVRMIRTYWMGALLIIALSIASGAVWTLFQ-PQ------VFEAKATGIVQAPRGN----
A0A538JQF8      PFPRSVRAAHTLILANNTLA----------------------------------------
A0A1H6YPK1      DYLDVLRSRWLSIAVCTLVVGAVAYLWSDMQ-PR------VYSTSAEALVTPAGSL----
A0A0Q9TBP0      -----------MALLVLLAAVAVSCAYSLAA-TP------LYIATADVLIEPSGAD----
A0A0G3V3M7      DYLRIVRRRWWVLLVTVVIAMTFALLTRPSS-AA------TAKASRPGVSFRATTT----
A0A6I3DD56      DYLRIIRRRWWVLLVTVVIAMTFALLTRPSS-SE------TIRANRPGVSFRATTT----
A0A5Q2FA83      EFLAILGSRWKTVLVSLLLVVAATVATTLRI-TP------TYEATTRVFFSAEATA----
A0A2R7MGI0      RVVRILRAYWKTIGALLALGALAGLGWSALQ-PR------VYTADASGYVATVSSD----
A0A2T7WQY4      RVVRILRAYWMTIGALFALGALVGLGWSALQ-PR------VYTADASGYVATVSSD----
A0A1G6GTN3      RVVRILRAYWKAIVALIATGALAGLGWSSLQ-PR------VYTADASGYVAAVASD----
A0A1N7DLV3      RVARILRAYWKAIVALTLAGGLAGLGWSALQ-PR------VYTADASGYVASVSSD----
A0A1V2NSB5      RVARILRAYWKAIVALTLAGGLAGFGWSALQ-PR------VYTADASGYVASVSSD----
A0A0Q5Q5L3      --MRILRAYWKAIVVMTVLGGLAGLGWSATQ-AR------VYSADASGYVAAVASD----
A0A0Q6DVM4      --MRILRAYWKAIVVMTVLGGLAGLGWSATQ-AR------VYSADASGYVAAVASD----
A0A1R3WWR6      RVVRILRAYWKAIVALTIAGGLVGLAWSAVQ-PR------VYTADASGYVAAVASD----
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      -MVRVVRAYWKAIVALIVVGGLAGLGWSSLQ-PR------VYTADASGYVAAVASD----
A0A2W6DK08      DYLTALQRRWPVVVVAGLLGLLIGYLVAPGA-ANQLSGKGSYVATATVLQAPDVKE----
A0A2S0LQ32      -----MKVNAVFIICCVVVGGLLGFGYAKTQ-PK------LYQSSAQATIVIAGT-----
A0A2N6V1R5      ----MTRVNLGFLILCVLLGLAGGFGYASAQ-PW------TYTATSQAMVVVPGT-----
G9PHS6          ----MTRVNLGFLILCVLLGLAGGFGYASAQ-PW------TYTATSQAMVVVPGT-----
U1PLM7          ----MTRVNLGFLILCVLLGLAGGFGYASAQ-PW------TYTATSQAMVVVPGT-----
A0A346XTB0      SLLESLWRYRVVVAGVTLFMGLLGYVVGLQE-DV------RYVAQGTLFLADPNLG----
A0A6I1G2U1      EYWKVIRRKWPVIVATSLAAAVVMFLITPAE-PPPVERVTSYTATATLIVETPARS----
A0A351ETF8      AHLAIVRKYWWFTVLVVVCAVAVAFLLTQRQ-ER------IYSTSAQVLLRSSENS----
A0A542FTE6      EFLRAVRAYWVGALGILLICIAIAALWTLTQ-PR------VWTSVATGVVQTTGGG----
A0A349B7N2      ------------MVLGLTLGWVTTPSSAGPD-EP------DYYRATHTLVAETGTS----
A0A7J5B4S5      DFLRLTGRSWRTLLIGVAIGLLGAFGYTQVQ-PH------VFTANSSGFVTAGPSE----
A0A4Q2JUT1      DYLRGLRRHWVAILLLTLVGVGAGYGWTVLQ-TP------VYVASTSGIVQSTGVG----
A0A6L5R0V7      DYLRGLRRHWVAIVLLTLVGVGAGYGWTVLQ-TP------VYVASTSGIVQSTGEG----
A0A2S5UYV0      DFLRLTGRSWRTLLIGVAIGLLAAFGYTQVQ-PH------VFTANSSGFVMAGPAA----
A0A2S5X9U6      DFLRLTGKSWKILAVGAIVGLLAAFGYTQIQ-PK------EYEANSAGFVVASGNA----
A0A2S5ULV5      DFLRLTGKSWKILAIGVIVGLLAAFGYTQIQ-PK------VYEADSAGFVIAGSSG----
A0A653YMF0      DFLRLTGKSWKILAVGVIIGLLAAFGYTQIQ-PK------VYEADSAGFVIAGGSA----
A0A3Q9IY80      TYLRILRAHWLGLIVLVVVGVVSAFGWTLLQ-PK------VYSADASGIVAPVRTE----
A0A0F0LP73      DFLVLIRRGWFFLALGLLFGALGGFVTAQLT-PP------VYTAQATGFIAGTGG-----
A0A346Y185      ALVGVLRSSIGRILLVGVAAGLLGFGLSALQ-SL------RYTAEADLLLADPRNT----
A0A4V1VGV9      DLVRIMRANLKLLALAALIGTLLAAGYTLTR-PT------LYSASSTAQVIAGNSI----
A0A7G8U6P0      DLVRIMRANLKLLVLAALIGTLLAAGYTLTR-PT------LYSASSTAQVIAGNSI----
A0A259S8H9      DLFTILRRGWLYLAAGLLLGALAGFGYAQTL-AP------VYTSQATGF--IAATG----
A0A2W1Z497      DYVRMFRTYWFGAVLIVLACVAAAGAWTLTQ-PR------VYTSGASGFVRVAGNG----
A0A0Q5L115      DYLRIVRSYWLGAFLIVLLGVTAGAGWTLTQ-TR------VYESSASGVVQVAAGG----
A0A7G6YY64      DYLRIVRSYWLGAFLIVLLGVTAGAGWTLTQ-TR------VYESSASGVVQVAAGG----
A0A1F1X071      DFLRLLLRNLLLLVAGLVLGAATGYGLSFTQ-ST------TYSASALGYVSASAQS----
A0A3R8RWC7      DFLRLLLRNLLLLVAGLVLGAAAGYGLSFTQ-ST------TYSASALGYVSASAQS----
A0A4U0RJZ4      DLVRIIRTNLKLLLLSMLLGIVVAAGYTLTR-PV------EYQATSTAQIMAGASN----
A0A4R1FGL9      DLVRIIRTNLKLLLLSMLLGIVVAAGYTLTR-PV------EYQATSTAQIMAGASN----
E3B8H1          DLVRIIRTNLKLLLLSMLLGIVVAAGYTLTR-PV------EYQATSTAQIMAGASN----
A0A7D7WDT9      DFLVLTRRGWRILTLMIVLGALGGAAYGFLA-PK------SYQAQSTGFIATAGDA----
A0A0Q5AWK6      DFIAFIRRNWKALVVAVLVGVTAMAAFSFVT-PK------VYESSSAGFVIAATDG----
A0A6P1F176      DFIAFIRRNWKILAIAVVVGVAAVAAFSAVT-PR------VYESKSAGFVIAATDG----
A0A3N1NLD3      DFIAFIRRNWKILVVAVLVGVSAMAAFSAVS-PK------VYDSSSAGFVIAATDG----
A0A3N2FVI8      DFIAFIRRNWKIIVVAVLVGVSAMAAFSAVT-PK------VYDSSSAGFVIAATDG----
A0A2S5XDQ6      DLIAFIRRNWRTLVGAVLVGALAMAAFSFLT-PK------VYESSSAGFVIAASDG----
A0A2S5XNN6      DLIAFIRRNWRTLVVAVLVGALAMAAFSFLT-PK------VYESSSAGFVIAASDG----
A0A3L8NYD3      DFVRLTRVNWRVIFATFSLGLVAALLYTLHQ-PV------VYTATSKGYVAVDSGD----
A0A1M6K628      QLWALARRNWLTLLLATILGVAVGAGISYLQ-PT------LYSATSVGYVVVGNSS----
A0A561E8R3      DFVRFSRTNALLLLLFTIVGGALMFGYTFTK-PT------LYSATAQGLVSAGGAD----
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      -----------------------------------------------MYVTSGDD-----
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      -----------MLLGALGLGAAALVLSGQTT---------RYDGSAEVLIQPTSP-----
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      ----------------------------------------MYTASASGYVSG--------
A0A151BT98      DFLRIMRQRWRWLLGTLLVVLAVAAVSTLMQ-PK------TYEASARFYLAGSNG-----
A0A2Y8ZRF8      DFLRIMRQRWRWLLGTLLIVLIAAAVSTMLQ-PK------TYEASARFYLAGSNG-----
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      -----------------------------------------------------MS-----
A0A3S0V9U6      DFIRLTRANIILLVVGILVGALVGYGTTLIQ-PK------TYAATSSGYVTLGKSEDPTT
A0A1S2N0P2      DFLRLTRANLKYLIIFTVAGALLGLGVAALQ-PK------VYSATSSGYVTAGGG-----
A0A0Q3BEY5      DFLRLTRANLKYLIIFTVAGALLGLGVAALQ-PK------VYSATSSGYVTAGGG-----
A0A4R6Q3C6      DFLRLTRANLKYLIIFTVAGALLGLGVAALQ-PK------VYSATSSGYVTAGGG-----
A0A2X3GKL3      DFLRLTRANLKYLIIFTVAGALLGLGVAALQ-PK------VYSATSSGYVTAGGG-----
A0A1Y4CKD6      NYLRIARRMWWLFLACVAIGVGCLYVASYVSYTP------LYRSEATFTITSGDG-----
A0A0Q7KBQ4      -----MRSRWVFSVSTFVVGAVATILLVLSM-SP------VYGSSAKLFITSPVG-----
A0A5Q5BFU2      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A7I7UD03      ------------------------------------------------------------
A0A7I7MI62      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      ------------------------------------------------------------
A0A7I9ZLK4      ------------------------------------------------------------
A0A1F1IHY9      KAMSMLQRHWMILVAAPLIGVLLAGLWVLTQ-NP------RYASTANALVVVGNS-----
A0A7H2BCD6      DFIRLTRANLRYLLAGLLIGALLGLGYSLLQ-PR------VYASTSTGYVTVAGS-----
A0A542HCT5      DYLRVARAYWRGIVAFVLLGVAVAAGVSLVT-PK------VYQADASGFVSAGGA-----
A0A0Q5M6Z7      DFVQLLRRYWVGELAIVMLTVGLVAALTAVQ-PR------VYESTASGLTQAATG-----
A0A7G6YA19      DFVRMIRRYWLGEAIIVLATIGLVAGFTALQ-PR------VYQSTATGLTQAATG-----
A0A2S8WHZ8      --MQVVRAYWRGIIGIFLICILLAFLWTLTQ-PR------IYAATSSGLVIAGDS-----
A0A537WNY9      DLLNLLWRRRILFVATILAVIGTAFGSVQVV-TP------EYEATSTLALTPKT------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      EAARQVAQNWWVVLALALATFLGMTGVGKLTYVP------EYTSAATLVIRVKGA-----
A0A3N3ZPU0      AVARAAGWYWKVALALIVLSVAAGAAIALLM-PK------VYSSTNTVMVVTGNS-----
A0A359IQX7      DFVRMTRHNAWLLLASVVLGLVAAAGYSLTQ-PT------LYGSVSTGIVVAGNS-----
A0A433EDP2      DFVRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTIGSG-----
A0A231VTW0      DFVRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTIGSG-----
A0A433ECD0      DFVRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTIGSG-----
U7V3Z1          DFVRTTRANLVLLILGIIIGALLGVGYSLTQ-PK------VYAASASGYVTIGSG-----
A0A1F1J417      DFVRTTRANLVLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTVGQS-----
A0A2A8D6P2      DFVRTTRANLVLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTVGQS-----
A0A1F0THV9      DFVRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTVGQS-----
A0A5F0M6Y0      DFVRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTVGQS-----
E3H5W1          DFVRTTRANLLLLIAGIVIGAIAGLSYSLLQ-PK------VYAASASGYVTVGQS-----
A0A1F1QKB0      DFVRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTVGQS-----
A0A509JY23      DFVRTTRANLLLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTVGQS-----
A0A448USF4      DFVRTTRANLVLLIAGIVIGAIAGLGYSLLQ-PK------VYAASASGYVTVGQS-----
A0A0Q9LZR0      DYLRVARTYWRGLVAFMLLGVAVAGGLSLVT-PK------VYQADASGFVSAGAS-----
A0A1N7E3F1      RYARLMRRYWPLLLLSVLAGVGTAHVVTVNT-AP------RYLASITMLVS---A-----
A0A544ZKQ1      YYARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------RYLASITMLVS---A-----
A0A372P1T1      YYARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------KYLASITMLVS---A-----
A0A5D0Q2X0      YYARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------KYLASITMLVS---A-----
A0A5R8Z2E7      YYARLMRRYWPLLLLSVLAGVGTAHVVTVNT-PP------KYLASITMLVS---A-----
A0A1L2ZMV4      RLAHVVLNNWKGAIAIFLLAVLASVGLFLIS-PK------TYAATNTVMVVAGGG-----
A0A6I3F378      DYLSAVWRRKYLALSTTVLCACLAAGWSVTQ-TS------VYRASTEVVIDV--S-----
A0A1S1CQC5      EFFRTTRANLWLLIIGIIIGAAVGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1E9T6I0      EFFRTTRANLWLLIIGIIIGAAVGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1F1GHA7      EFFRTTRANLWLLIIGIIVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1S1CAD0      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
G5ET14          EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1E9DXX2      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1E8S156      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1E8S5S2      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1S1DFA8      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A2I1Z490      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1F0DAA9      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1F0PHK9      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1F0VZG6      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1E9G8X4      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTVGES-----
A0A1E9IAW2      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTVGES-----
A0A1E9ZBC9      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTVGES-----
A0A1E9ZDP4      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTVGES-----
A0A1F0R6B5      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTVGES-----
A0A1F0Z7N5      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTVGES-----
A0A1F1D897      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTVGES-----
D2NP38          EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTVGES-----
A0A1F1FV74      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1E9M791      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTVGES-----
A0A291DEI8      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PR------VYAASSSGYVTVGES-----
A0A1S1D5T1      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1E8TRD6      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1F0XT88      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1F1EVP5      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
C6R548          EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A0K2RXS2      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A1F0KX60      EFFRTTRANLWLLIIGIVVGAAAGFGYASLQ-PK------VYAASSSGYVTVGES-----
A0A542I3V2      DYVRVARLYWRSIAVVTVIVTALVMLWAALQ-PR------TYAAESSALVLT--V-----
A0A2T0UZ65      DFVRLSRANLLRIVLLVLIGAGLAFAYAQTL-PK------VYAADASGYVVT--G-----
A0A1R4JTI6      --------------------------------------------------MVTAG-----
A0A4R7TM52      TYWRIARTGWWMMLIGLVVGVLLAVGWVVLQ-KP------VYTADAGGFVSASAG-----
A0A542XE74      DLIRLLRRSWLSVAVGLMIGLILAAAYTLTR-PT------TYVAESRGVVVA--G-----
A0A0Q7QDF6      SGWTAVARRWPLVVLLGALGLGAAALVLSGQ-TT------RYDGSAEVLIQPT-------
A0A5R8L819      VYLRVFRAHWVAIVVATIVGGALAYGWAVLQ-PK------TYTAEASGYVAAT-V-----
A0A7K0PFV4      PLLAALRTRWWLVVGLVVLAGVTAAFAVRAK-AP------SYTAEAQVLVTPFAG-----
A0A0G3V3F3      AHFRIIARAWKQILIAGVLVAVAMFFWSNRA-ER------VYEATALL------A-----
A0A7K0MUQ7      AHFRIIARAWKQILIAGVLVAVAMFFWSNKA-DR------VYEATSLL------A-----
A0A7K0U619      AHFRIIARAWKQILIAGVLVAVAMFFWSNKA-DR------VYEATSLL------A-----
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      DILQMIKKHWIVGLAVLVVSLAVTVCVVQTT-VP------EYSASV--------T-----
A0A1Q2CJ92      -MWGLLRRGWLVIVASLAVGLALAFALSLTQ-PV------LYSATSAGYVVA--G-----
A0A2T0S3C8      DYLRVLRKRWWMLLAGIGVACGLAGILTSQM-TP------QYATSVTFFVT---T-----
A0A4Y8WZJ3      KAMSMLQRHWMILVAAPLIGVLLAGLWVLTQ-NP------RYASTANALVVV--G-----
A0A285VUW0      DLFLAIARRWRGAVAILLLVVAATAFATSRQ-PQ------VFESRTTVYFAATDE-----
A0A2R7Z032      EFVRLTRAYWWFLVLLTALGAGVMIAKTSRE-PE------LYSAGASGIVKV--G-----
A0A6J4MTQ2      ELWRLTRAYKWVLAGFVVLGVLVMIALTSQK-PV------LYSASSKGVVQV--G-----
A0A1I0W453      DFVRLSRAYVWVLIGCTILGAALMLAKTTRD-PV------LYSATSSGLVRV--G-----
A0A1H4LCS9      DFVRLSRAYVWLLIGCTILGALLMVAKTTQD-PV------LYAANASGFVKV--G-----
A0A4Q2RZP8      DFVRLSRAYVWLLIGCTILGSLLMIAKTSRE-PV------LYAANASGFVKV--G-----
A0A0Q6VV12      DFVRLTRAYVWVLIGCTVLGALLMMAKTTRD-PV------LYSATSSGLVVV--G-----
A0A495NTA9      DFVRLTRAYVWVLIGCTVLGALLMMAKTTRD-PV------LYSATSSGLVVV--G-----
A0A0Q9QB08      DFVRLSRAYVWVLIGCTVLGAALMVAKTTQD-PV------LYSATANGLVKV--G-----
A0A4Q2SA86      DFVRLSRAYVWVLIGCTVLGAVLMAAWTTRE-PV------LYSATSSGLVTV--G-----
A0A4Z1C3Z0      DFVRLTRAYVWVLVGCTVLGAAVMAAWTTRE-PV------LYSATSAGLVQV--G-----
A0A6V8KDX4      ------------MALITGLAAGTMGLLTILA-VP------QYATSVTFFVT---T-----
A0A444BL03      DFVRLTRTHLLFLVVLTLAGGAAAYGLTLRM-PS------VYLADASGYVRID-G-----
A0A4Y8X357      DFLRVLRNNKLLLLGGIVLGVVAGLVYSLLQ-PT------LYTATSTGFVTVQGE-----
R4LD52          ----------------MLAALVLGALVTVQT-AP------RYATSVTFFVT---T-----
A0A4T2CD79      ----------MTVVAITLLGAAAAFGWTFTQ-TR------VYTANSSGIVTL--M-----
A0A6L6AM03      DFVRLSRAYVWVLIGCTILGALLMIGKTTRD-PV------LYSATSSGLVRVG-T-----
A0A4Q2RU39      DFVRLSRAYVWVLIGCTILGALLMIAKTTRD-PV------LYSATASGLVRVG-------
A0A4Q2SK58      DFVRLSRAYVWVLIGCTILGALLMIAKTTRE-PV------LYSATSSGLVRVG-------
A0A2N3YJR1      DFVRLSRTHLLSLVLLTLLGGAAAFGLTTRL-PQ------VYQADASGYVRVT-A-----
A0A6G8FYB9      DFVRLTRAHLLSLVFLTLVGGAVAYGLTLRM-PE------VYLADASGYVRVA-G-----
A0A4Q4D742      QFFGTLQARWRFALVTFVLGAIATVVLVTSM-AP------QYGSTVKIFMS---T-----
A0A1C6T1J1      RQLRLVRRHWWIVLVTLMVALGTTALVTIRS-EP------RYVASVTFFVT---T-----
A0A2W2CFC8      RQLRLVRRHWWIVLVTLMVSLGVTALVTVRA-QP------RYLATVTYFVT---T-----
A0A2W2A4B0      PLTRALVLRWYFAVGGALLGFVVAIALSSTV-TP------QFRATSKIWISISGD-----
A0A4Y9MDA5      VFLGTLRRRWSLLLAGVLVGLTVAGIGSLTA-ER------LYTAESRLFFAL--E-----
A0A1H7N9P7      VFLGLIRRRSSWLVAGVVLAVAVAGVGSLTA-TR------LYTAEARLFFTL--E-----
A0A1M7V0F8      AFLGVLRRRSSWLLVSVLVGLTVAGAGSAAA-TR------LYTAEASLFFAL--E-----
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      --------------------------------MA--------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ---------------------------------------------------MSTFFSARE
A0A348NU28      ----------MAR-----------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ---------------------------------------------MSQIKSYPVLTTTQS
A0A4Q5B0V3      ---------------------------------------------MSQIKSYPVLTTTQS
A0A022KX11      -----------------------------------------------MAGEFSTLLKSSG
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      -----------------------------------------------------------M
A0A1H4I042      -----------------------------------------NLLSQERVRSYTILLTGEA
A0A4R7A6D9      -----------------------------------------NLLSQERVRSYTILLTGEA
A0A1Q2CRV2      ---------MQAG----------------------------SNYAANQVQSFAKVAKSGF
A0A7K0NRJ7      LGIN-------------------------------------ADQATFLAKSYALYAETPR
K6WHS4          -----------------------------------------SLASAQRVASYAELVDSDV
A0A1L2ZMQ6      TVG-----EAIAG----------------------------NSLAQDRAGSYAVMASSQR
A0A3E2DN22      SVG-----EAMSG----------------------------NAIAQQRAATYTKLVETRT
A0A3Q9ULZ9      SVG-----GAMSG----------------------------NTIAQQRASAYSTLIGTEA
A0A3S9JFL2      SVG-----GAMSG----------------------------NTIAQQRASAYSTLVGTAA
A0A7K0NTR2      LINNFGD-TSVRGRDYDRLALLMTTGEVPQRVADAIDKVRWPQIQAAESAACATTGERSK
A0A1H6WL79      NLG-----LSLAG----------------------------DSLAKSKAKGYQSVGESIL
A0A101LAM5      NLG-----MSLAG----------------------------DSLAKSKAKGYQSVGESIL
A0A4Y3NEG0      NLG-----MSLAG----------------------------DNLAKSKAKGYQSVGESIL
A0A1Q2CI19      PD---------------------------------------AGAGYASLGRVALFITTGE
A0A512T3M3      NP---------------------------------------QLPPSLPLGRIALYVTTGV
W6JTW4          ER---------------------------------------V---TVGLPRIAFFITTGD
A0A0A0JTY0      AA----------------------------------------TAVAPNLDRVALYLKTGE
A0A0A0JXF2      TD----------------------------------------PERTGNMGRIPLYMTTGE
E6S8H2          TE----------------------------------------TDSESPMGRIALYLTTGE
A0A0A0JGH0      AT----------------------------------------ADEQVSVDRVVLYAKTGA
N0E4U7          GG----------------------------------------PPELVSIDRLALFIKTGE
A0A0A0IYK2      TD---------------------------------------PENPNPNMGRIPLYMTTGE
A0A0Q9L0H3      ND---------------------------------------PETGSTNLGRIALYMTSGE
A3TMK0          KD---------------------------------------PEATGSNLGRIALYLTTGE
A0A543PXP1      S-----------------------------------------ADSTAQMGRIALYLTTGE
A3TMH6          T-----------------------------------------EDVNSQLGRIALFLTTGD
A0A6I2XCV4      VEA--------------------------------------DGSGTANLSQVAFLLQSAE
A0A5R8VLL6      NVS-----SLLAG----------------------------DTLAKAKAKTYKSLAESRL
A0A3L7ADK2      DPS-----NAYSS----------------------------EALSKSQAASYATVATSLA
A0A538JQF8      -----------------------------------------PEDTQKPLNVYALFIKVGE
A0A1H6YPK1      DEVGD------------------------------------AATVESRMAVYTRLATSDQ
A0A0Q9TBP0      I-------SASSG----------------------------TKIDADEVATQVQVVTSLP
A0A0G3V3M7      LISSGSANTSVNGRDYDRLALLMITGEVPKRVAEAIDEVRWPQIQNANANKCTETGADAT
A0A6I3DD56      LISNGSANTSVNGRDYDRLALLMTTGEVPKRVAEAIDEVRWPQIQSATANKCAETGADSS
A0A5Q2FA83      KTGTN---TGGGG----------------------------YVLTTNDLGTYEQLVSSPV
A0A2R7MGI0      GSTG----SALAG----------------------------DQLALSKVKSFVDMGYWRS
A0A2T7WQY4      GSTG----SALAG----------------------------DQLALSKVKSFVDMGYWRS
A0A1G6GTN3      GSTG----AALAG----------------------------DQLALSKVKSFIDMGYWRS
A0A1N7DLV3      GSTS----SALAG----------------------------GTLALSRVKSFIDMGYWKS
A0A1V2NSB5      GSTG----SALAG----------------------------GTLALARVKSFIDMGYWKS
A0A0Q5Q5L3      GSTG----AALAG----------------------------DQLALSKVKSFIDMGYWRS
A0A0Q6DVM4      GSTG----AALAG----------------------------DQLALSKVKSFIDMGYWRS
A0A1R3WWR6      GSTG----AALAG----------------------------DQLALSKVKSFIDMGYWRS
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      GSTG----AALAG----------------------------DQLALSKVKSFIDMGYWRS
A0A2W6DK08      AVA-----------------------------------------------STTLLVTAEP
A0A2S0LQ32      --------DAWSA----------------------------NSVAQQKAGVFAKLAGSAA
A0A2N6V1R5      --------DAFSQ----------------------------NSISGQKASVYAVLAGSQN
G9PHS6          --------DAFSQ----------------------------NSISGQKASVYAVLAGSQN
U1PLM7          --------DAFSQ----------------------------NSISGQKASVYAVLAGSQN
A0A346XTB0      DELQGIVSARISA----------------------------EEYVPRQAARIQSRAVLQE
A0A6I1G2U1      VDE--------PA----------------------------GAVSLDRVVLYMTTGEVPA
A0A351ETF8      FLF-----PFPAT----------------------------GPLALNREGEIETLYVTSP
A0A542FTE6      DAG-----LALAA----------------------------ENLAKSKAKTYVELAKSQA
A0A349B7N2      APP--------------------------------------------NLAQLSLLLRVGD
A0A7J5B4S5      G-------GLIGG----------------------------SEAAVAKAQSYLPLITSRP
A0A4Q2JUT1      DVS-----NVSLG----------------------------DSVARSRVPSYLVMAGWTD
A0A6L5R0V7      DVV-----NASLG----------------------------DSVARSRVPSYLVMAGWTD
A0A2S5UYV0      EGG------YIGG----------------------------SEAAIAKAQSYIPLITSQP
A0A2S5X9U6      ELG------YING----------------------------SEAAIAKANSYIPLITSQP
A0A2S5ULV5      EFS------SIDG----------------------------SEQAITKANSYLPLITSQP
A0A653YMF0      ELG------YING----------------------------SEAAIAKANSYLPLITSQP
A0A3Q9IY80      LSGNDAG-SALVA----------------------------ENLAKAKVGSYLDLGSWRA
A0A0F0LP73      --------AVIAG----------------------------TNIAIDRAGAYMPLVDTAQ
A0A346Y185      GLFGETGVNFLDP----------------------------SRYVRNQA----EFAQSNA
A0A4V1VGV9      DAN-----SAVLS----------------------------QQLSTGRAGYYAQLASSSG
A0A7G8U6P0      DAN-----SAVLS----------------------------QQLSTGRAGYYAQLASSSG
A0A259S8H9      TAV-----IAGSD----------------------------EAVAR--AGAYMPLINTSQ
A0A2W1Z497      DAN-----LDYAA----------------------------DQLSKSQAETYVELGGSLA
A0A0Q5L115      DAN-----LAFAA----------------------------DQLAKSQAQSYVELGGSLA
A0A7G6YY64      DAN-----LAFAA----------------------------DQLAKSQAQSYVELGGSLA
A0A1F1X071      DENGDPIQQASGN----------------------------MEFQYSKAQSYLPLFNTRA
A0A3R8RWC7      DENGDPIQQASGN----------------------------MAFQYQKAQSYLPLFNTRA
A0A4U0RJZ4      DAS-----AAMVN----------------------------QQLANQRSGAYAQLASGSG
A0A4R1FGL9      DAS-----AAMVN----------------------------QQLANQRSGAYAQLASGSG
E3B8H1          DAS-----AAMVN----------------------------QQLANQRSGAYAQLASGSG
A0A7D7WDT9      ---------VIAG----------------------------SDAAVARAGSYTPLIDSAQ
A0A0Q5AWK6      SSA-----DAISG----------------------------AQTAVTRANAYLPLISSSA
A0A6P1F176      SSA-----DAISG----------------------------AQTAVTRANAYLPLISSSA
A0A3N1NLD3      SSA-----DAISG----------------------------AQTAVTRANAYLPLISSSA
A0A3N2FVI8      SSA-----DAISG----------------------------AQTAVTRANAYLPLISSSA
A0A2S5XDQ6      SSA-----DAISG----------------------------SQTAVTRANAYLPLISSSA
A0A2S5XNN6      SSA-----DAISG----------------------------SQTAVTRANAYLPLISSSA
A0A3L8NYD3      SVS-----DVYSA----------------------------TSLAQQKLSVYVGLVSSTA
A0A1M6K628      TEN-----AGAR------------------------------NPAAEKAATYLPLAESRS
A0A561E8R3      NTG-----SALNG----------------------------VSLAQTKAQEYAALASSAP
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      SNVQAA----YQG----------------------------SLASQQRIASYAQLASSDA
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ------------A----------------------------TSLSGRAVESYAHVLGGTA
A0A261FE22      MAKNSDGAMTTGA----------------------------SNGGSSPLASYAQLVQSDA
A0A5C8C085      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------MLSFASLATSGA
A0A1E4BP96      ASLAAETGSPLVG----------------------------DQLARSKVTSYLDIGSWRA
A0A151BT98      -----------QG----------------------------TPVQRDDLATYAQVVSAPA
A0A2Y8ZRF8      -----------QG----------------------------TPVQRDDLATYAQVVSAPA
A0A2R9UAT1      ----------MLA----------------------------NNLALSKVVSYVDIGSWRS
A0A4Q5J5D7      AGNDTNPALGSVA----------------------------DTLAKSRAKSYVDIARSRA
A0A3S0V9U6      GSAGEI----LSG----------------------------DAAAQSKAKAYLPLITSAP
A0A1S2N0P2      SAVGDI----LSG----------------------------DSAAQAKASAYLPLVTSGP
A0A0Q3BEY5      SAVGDI----LSG----------------------------DSAAQAKASAYLPLVTSGP
A0A4R6Q3C6      SAVGDI----LSG----------------------------DSAAQAKASAYLPLVTSGP
A0A2X3GKL3      SAVGDI----LSG----------------------------DSAAQAKASAYLPLVTSGP
A0A1Y4CKD6      SSL-------YSS----------------------------VSSASQLSKTFPYVLDSSY
A0A0Q7KBQ4      QQVTD-----PTA----------------------------AYFASQRLASYADLAREPS
A0A5Q5BFU2      ------MADTYQG----------------------------NRFSQERVISYAELLMGET
A0A439DNZ6      ------------------------------------------------MISYTELLMGET
A0A7I7UD03      ------------------------------------------------MVSYAELIMGQT
A0A7I7MI62      ------------------------------------------------MVSYAELIEGET
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      --------------------------------------------------------MGQT
A0A7I9ZLK4      --------------------------------------------------------MGET
A0A1F1IHY9      ESLGVA----LTA----------------------------DNLAKSKAQQYALLGESRA
A0A7H2BCD6      AGIGDV----ISG----------------------------NSAAKDKATGYLALTNSRA
A0A542HCT5      TNPGEA----SVL----------------------------DSLAKSRATSYVDLAQGRA
A0A0Q5M6Z7      ESLSMA----FAG----------------------------ESLAKSRAESYVRVANSDA
A0A7G6YA19      ESLSMA----FAG----------------------------ESLAKSRAESYVRVAKSDA
A0A2S8WHZ8      ENIGNA----LAG----------------------------DNLAKSKAVGYKSIAGTRT
A0A537WNY9      ----------LND----------------------------PNSAYVFFGTLDAIVPVYA
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      DA--------YSS----------------------------LAQASQMTAVYSEVFQSSA
A0A3N3ZPU0      NTLGDY----MTA----------------------------DSVSLSKADSYMQLGGSPE
A0A359IQX7      NSIGDA----TAG----------------------------MVLAEQKAAAYTILTGTRQ
A0A433EDP2      GTIDV-----LSG----------------------------SSAAKDRARSYSAIVSSEA
A0A231VTW0      GTIDV-----LSG----------------------------SSAAKDRARSYSAIVSSEA
A0A433ECD0      GTIDV-----LSG----------------------------SSAAKDRARSYSAIVSSEA
U7V3Z1          GTIDV-----LSG----------------------------SSAAKDRARSYSAIVSSEA
A0A1F1J417      GTIDV-----LSG----------------------------SNAAKERARSYSAIVSSEA
A0A2A8D6P2      GTIDV-----LSG----------------------------SNAAKERARSYSAIVSSEA
A0A1F0THV9      GTIDV-----LSG----------------------------SNAAKERARSYSAIVSSEA
A0A5F0M6Y0      GTIDV-----LSG----------------------------SNAAKERARSYSAIVSSEA
E3H5W1          GTIDV-----LSG----------------------------SNAAKERARSYSAIVSSEA
A0A1F1QKB0      GTIDV-----LSG----------------------------SNAAKERARSYSAIVSSEA
A0A509JY23      GTIDV-----LSG----------------------------SNAAKERARSYSAIVSSEA
A0A448USF4      GTIDV-----LSG----------------------------SNAAKERARSYSAIVSSEA
A0A0Q9LZR0      SNPGEA----SVG----------------------------DSLAKSRATSYVDLAKSRA
A0A1N7E3F1      DAGDGGLSTALQA----------------------------GALSQQRVQSYAALLTSRQ
A0A544ZKQ1      DTREGGLSTALQA----------------------------GALSQQRVQSYATLLTSRQ
A0A372P1T1      DARDGGLSTALQA----------------------------GALSQQRVQSYATLLTSRQ
A0A5D0Q2X0      DARDGGLSTALQA----------------------------GALSQQRVQSYATLLTSRQ
A0A5R8Z2E7      DARDGGLSTALQA----------------------------GALSQQRVQSYATLLTSRQ
A0A1L2ZMV4      NNLGSY----LSA----------------------------ETLANTKAETYLALGNAPE
A0A6I3F378      RNTSLFGP--VAG----------------------------AGDARRRLLNEIAIVTGVE
A0A1S1CQC5      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1E9T6I0      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1F1GHA7      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1S1CAD0      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
G5ET14          GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1E9DXX2      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1E8S156      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1E8S5S2      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1S1DFA8      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A2I1Z490      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1F0DAA9      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1F0PHK9      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1F0VZG6      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1E9G8X4      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1E9IAW2      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1E9ZBC9      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1E9ZDP4      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1F0R6B5      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1F0Z7N5      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1F1D897      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
D2NP38          GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1F1FV74      GTVDV-----LSG----------------------------SSAAKERARSYAAIVSSEA
A0A1E9M791      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A291DEI8      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1S1D5T1      GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A1E8TRD6      GTVDV-----LSG----------------------------SSAAKERARSYAAIVSSEA
A0A1F0XT88      GTVDV-----LSG----------------------------SSAAKERARSYAAIVSSEA
A0A1F1EVP5      GTVDV-----LSG----------------------------SSAAKERARSYAAIVSSEA
C6R548          GTVDV-----LSG----------------------------STAAKERARSYAAIVSSEA
A0A0K2RXS2      GTVDV-----LSG----------------------------SSAAKERARSYAAIVSSEA
A0A1F0KX60      GTVDV-----LSG----------------------------SSAAKERARSYAAIVSSEA
A0A542I3V2      GSDSVNTL--LTG----------------------------DALAKSKIKNYESIAESRL
A0A2T0UZ65      GGQNTGDV--FAG----------------------------STLAGSKAESYLPLINSRA
A0A1R4JTI6      VNENLGIA--LTA----------------------------DNLAKSKATQYQELATSRA
A0A4R7TM52      SGSDTGGA--LIA----------------------------DNLAKSKVKSYLDVGTWRS
A0A542XE74      STISVGDT--MSG----------------------------DTVTVSRASMYASLVNTSA
A0A0Q7QDF6      ----------SPA----------------------------TSLSGRAVESYAHVLGGTA
A0A5R8L819      GGSDAGSA--LIG----------------------------ENLAKAKVKSYIDLGSWRA
A0A7K0PFV4      EDSTLSGVRLLRN----------------------------SGDPTRDVETAITLLRGAG
A0A0G3V3F3      VTPSDTGL--GIN----------------------------ADQATFLAKSYALYAETPR
A0A7K0MUQ7      VTPSDTGL--GIN----------------------------ADQATFLAKSYALYAETPR
A0A7K0U619      VTPSDTGL--GIN----------------------------ADQATFLAKSYALYAETPR
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      AVTNAQSA--AAD----------------------------GSTSDSRMGVVSRVATSSA
A0A1Q2CJ92      NSATVGDA--FAG----------------------------STLAAEKAGTYLPLVQSRS
A0A2T0S3C8      PNNGVTDA--YQG----------------------------GLFSQQRVKSYATLLTGDR
A0A4Y8WZJ3      NSESLGVA--LTA----------------------------DNLAKSKAQQYALLGESRA
A0A285VUW0      AGESSGNL--Y-------------------------------QMPAGERSTLARIARSPL
A0A2R7Z032      FSSSAGEE--MSN----------------------------QSLASDKAALYVALANTTP
A0A6J4MTQ2      NATSAGEE--AGN----------------------------LALARDKAELYVTLVPTTP
A0A1I0W453      NAATAGEE--QGN----------------------------AQLAEDKANLYAFLVSKTP
A0A1H4LCS9      NATTAGEE--QNN----------------------------AQLAEDKANLYAFLVSKLP
A0A4Q2RZP8      NATTAGEE--QGN----------------------------AQLAEDKANLYAFLVSKLP
A0A0Q6VV12      NATTAGEE--QGN----------------------------AALAEEKAGLYAFLVSSMP
A0A495NTA9      NATSAGEE--QGN----------------------------SALAEEKAGLYAFLVNSEP
A0A0Q9QB08      EAGSAAEE--QGN----------------------------ASLAEDKANLYAFLVPTTP
A0A4Q2SA86      NATTAGEE--QGN----------------------------AQLAEDKAVLYAFLVSTTP
A0A4Z1C3Z0      NAASAAEE--QGN----------------------------AQLAEDKAVLYAYLVSTTP
A0A6V8KDX4      PSQGLSDA--YQG----------------------------GLFSAQRVTSYATLLEGDR
A0A444BL03      AGASTGES--IAA----------------------------NSLGGSKADSYLPLVTSRA
A0A4Y8X357      AS--------ISG----------------------------TETAQTRAQSYVPLINSRT
R4LD52          PNTGVTDA--YQG----------------------------GLFSQQRVKSYASLLVSDR
A0A4T2CD79      SDGSIGDT--VAS----------------------------DALAKSKATTYVAVGESRA
A0A6L6AM03      NVQSAGEE--QGN----------------------------ATLAEDKANLYAFLVSTTP
A0A4Q2RU39      NAESAGEE--QGN----------------------------NQVAEDKANLYAFLVSKTP
A0A4Q2SK58      AASTAGEE--QSN----------------------------SQLAEDKANLYAFLVTKTP
A0A2N3YJR1      AGSSTGEG--IAA----------------------------NALSGSKADSYLPLVTSRA
A0A6G8FYB9      SGTSTGDS--LAA----------------------------NSLGGSKADSYLPLVTSRA
A0A4Q4D742      PGGGQTE---YVA----------------------------AYTLQQRVASYADLAVDPA
A0A1C6T1J1      PSEGVAAA--YQG----------------------------GLFLQQRIKSYADLLVSDR
A0A2W2CFC8      PSQGVSDA--YQG----------------------------GLFLQQRVKSYEQLLTSDR
A0A2W2A4B0      AESSALDL--AQG----------------------------TNAAQQRIHSYLDLVPQPI
A0A4Y9MDA5      SGNSAGDL--AQG----------------------------SNYLQGQVTSFALLAETPT
A0A1H7N9P7      YGDSAGDL--AQG----------------------------SNYLQSQVASFALLAETPT
A0A1M7V0F8      YGDSAGDL--AQG----------------------------SNYLQSQVSSFALLAGTPT
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ---------------------------------------------STIEKVIDSNIATDT
A0A538AM15      -----------------------------------------------MSKFFKALEQAER
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      -----------------------------------------IGLVSGIVLGVMVALIKDL
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------MMGMAM
A0A6J4SUA1      ---------------------------------------------------------LDR
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------MFGRSR
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A7K0LE65      -----------------------------------------RSAVVAFLLTCILVGELIV
A0A510HHA8      --------------------------------------------------------MVRL
A0A6G8Q9J3      --------------------------------------------------------MARP
A0A5Q2F9A3      -------------------------------------------------------MLRNS
A0A4R1BMZ2      -----------------------------------------------------------M
A0A023X491      -----------------------------------------------------------M
A0A6G8QDQ0      -------------------------------------------------------MQQPK
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ----------------------------------------------------------TI
                                                                            

A0A6N6NKS9      ---------------------------------------------MAKKNRKRPSQFQNP
A0A538BYZ4      QAERDRA---------------LRG----QIE----------------------------
A0A348NU28      -----------------------------SIEVTIPLNTVILEIKSSSGDPESAAEIANG
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      VLQPVIE-----DLGLHTTVAQLKE----QVSVTNPTNTAFVNISVTDGNPAQAADIANA
A0A4Q5B0V3      VLQPVIE-----DLGLHTTVAQLKE----QVSVTNPTNTAFVNISVTDGNPAQAADIANA
A0A022KX11      QK----------------------------------------------------------
A0A4Q5A868      -------------------MAQLKE----QVSVTNPTNTAFVNISVTDGDPAQAADIANA
A0A6N4VXX3      LAQRTVD-----ALHLDMSAQALRK----EVTARSKAGTVLIDVDVLDPSPVRARDIANT
A0A1H4I042      LAQRTID-----ALHLDMSARALRQ----EVSARSKMGTVLIDVDVLDPSPVRARDIANT
A0A4R7A6D9      LAQRTID-----ALHLDMSARALRQ----EVSARSKMGTVLIDVDVLDPSPVRARDIANT
A0A1Q2CRV2      VLTPVIE-----DLQLSVTPEQLAR----RVAVTIPAQTATMDLAVTADSPEEAARIAHA
A0A7K0NRJ7      VTAAAAK--S---SGLNITANDAAS----LISASAVGDLGFLEVYAKGPSVSEAEQLSSA
K6WHS4          IVSRALE--S---TGVGLKQDEAKD----SLSVSTSPDTVLLVVTAENANPDLAARLASG
A0A1L2ZMQ6      TAERAVEKLEKQGVADVPDAGSLIS----SITAAVLEGSTELRVTASASDPVFAQQLANV
A0A3E2DN22      MAQKTSE--I---LKKHGMPEAANG----QVSASVPGDTAFIDIKATGGTAKNAQALANA
A0A3Q9ULZ9      VDNRVQK--T---LGSKGLSKAADG----TLAAKVVSGTSFIKITATGSSALNAQSLANA
A0A3S9JFL2      VDNRVRA--T---LNKQGLSKATDG----TLSAKVVTGTSFIRITATGSSAQNAQALANA
A0A7K0NTR2      SSNCPRSRRP---VKAGTSVVSLGYQGFIKASAVPDPATGSLAITAQVGDAKLAAKVANL
A0A1H6WL79      VAESVIR--T---LGLKESAPDITR----SISVSVPLDSVEIRITARSSDAQTAQNVADA
A0A101LAM5      VAESVIK--S---LGLKESAPDVTR----SISVSVPLDSVEIRVSARSSDPQTAQNVADA
A0A4Y3NEG0      IAESVIE--S---LGLKESAPDITR----SVSVSVPLDSVEIRISARSSDPQTAQNVADA
A0A1Q2CI19      VPRNAAA--A---LGYEGDPALLAK----QITVETQGESASVTITTTASDGERAANVVNT
A0A512T3M3      VPVRVAK--K---VGFVGQPTELAG----RIDVGQDSEAMALTITSSNTDSKRAGLIVNT
W6JTW4          IPQAAAD--K---LKYADGPFALAR----RIVVAPDPAASTISISATDPHATTAESIAQT
A0A0A0JTY0      VPKRAAK--K---VGYEGDPAVLAS----GLTVVTDPAAQAITVAATASDGKQAAAVANA
A0A0A0JXF2      IPRRAAA--V---VGYEGDPARLAA----GLTVTPDNAAEALTVSATASDGEEAAAVANA
E6S8H2          IPQRAAA--E---LGYTGDPAVLAS----GLTVTPDFSAGALTVAVTDAEGKRAASIANT
A0A0A0JGH0      IPTAAAK--A---LEFEGDPAILAS----QVTITSDPSGAALTIAASDRDGAKAAETANA
N0E4U7          IPSRAAK--V---LSFDGDPALLAS----QITVTPDPAAAALTIAASAPDGERAAATANA
A0A0A0IYK2      IPRRAAA--A---VGYDGDPALLAR----GLTVTPDVVAAAITVSATASDGSRAAAVANA
A0A0Q9L0H3      VPKRAAA--R---VDFTGDPALLAS----GLTVTPDTVAQALTVSATASDGKQAAAVANA
A3TMK0          VPKRAAA--V---VKFEGDPALLAR----GLTVTPDTVSQALMVSATASDGKQAAAVANA
A0A543PXP1      IPRRAAA--K---LGYTGDPAMLAS----GLTVTPDFNAAALTVAATAPDGQRAAAVANA
A3TMH6          IPRGAAK--R---LGYPGDPALLAA----GLTVKPEFIATALTVSATASDGARAAAVANA
A0A6I2XCV4      VQGQIAT-------AMNLPVETLRG----LIAAQDQSNVSAIDVTAISTDPQFAVTLADT
A0A5R8VLL6      VADKVSA--S---TGVNMTGESLLG----AVTVTVPRDTAEMRIKAESPNPTTAQRVADA
A0A3L7ADK2      VAERVEK--A---GVVKQSAGVLLG----RITALQPQDTVLIEITAKGPTGDSARTLADA
A0A538JQF8      VPKLAAE--R---LGYKKEAFELVR--SANVQARPNVEVGTLTITANDRDPKRAALIADT
A0A1H6YPK1      VAAVVAE-------SIGGDADALRS----RISVSGSTETAIMLFTGTGSAPESAQELVNA
A0A0Q9TBP0      VSRLVQERFS---LASPPDLSELVS-------VQAVGTSRILRVTAQDSSPDRAARTANI
A0A0G3V3M7      SPDCKKSGRR---VSAGSGQVELGTGGFIKASAIPDPATGSLAITAQVGDAELAAKVANL
A0A6I3DD56      SPDCKKSGRP---VSAGSGQVQLGTGGFIKASATPDPATGSLAITAQVGDAVLAAKVANL
A0A5Q2FA83      VMDPLRQ--Q---LKLAPSTPL-------NVTAKAATGSPMLDITATSSSPRVAADAANA
A0A2R7MGI0      VAEAARQ--T---LGVNDSPESLVQ----RVRVSNPVDTVNVRVDATGPTPESARDLAEA
A0A2T7WQY4      VAEAARE--S---LGVEDSPESLVQ----RVRVSNPVETVNVRVDATGSTPESARDLAEA
A0A1G6GTN3      VAETARQ--D---LGLSDPAESLVQ----RIRVSNPVDTVNVRVEATGPTPESARDLAEA
A0A1N7DLV3      VAETARD--E---LGLTDSPESLVQ----RIRVSNPVDTVNVRVDATGPTPEAARDLAQA
A0A1V2NSB5      VAETARD--E---LGLTDSPESLVQ----RVHVSNPVDTVNVRVDATGPTPEAARDLAQA
A0A0Q5Q5L3      VADTARQ--Q---LGLSDSPEALVE----RIRVSNPVDTVNVRVDATGATPESARDLAEA
A0A0Q6DVM4      VADTARQ--Q---LGLSDSPEALVE----RIRVSNPVDTVNVRVDATGATPESARDLAEA
A0A1R3WWR6      VAETART--E---LGITDSPEALVQ----RVHVSNPIDTVNVRVDATGPTPESARDLAEA
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      VAETARG--E---LGLSDSPESLVQ----RVRVSNPIETVNVRVDATGPTPESARDLAEA
A0A2W6DK08      VAERVSK--M---LNTHHAPQDLLL----KVTAVADKPSNAINITASDVDPQNAVALANA
A0A2S0LQ32      VAQSVSQ---------SLGLQDLGG----SLTGAAEPSSPIVTITAVSSDPSRARDLANA
A0A2N6V1R5      VANRVAK---------TLKTSNMEG----TLSGSADAVPGLFTLTATASTPERARDIANA
G9PHS6          VANRVAK---------TLKTSNMEG----TLSGSADAVPGLFTLTATASTPERARDIANA
U1PLM7          VANRVAK---------TLKTSNMEG----TLSGSADAVPGLFTLTATASTPERARDIANA
A0A346XTB0      AADLIDN---------RISVGELGS----NFDIESSAETLEIVLVAEDETAEGAAELVNA
A0A6I1G2U1      LAAQ-----Q---VGYTREPALLAN----QLTVTPNPSAQSLTVEMSGADAEYVAAVANA
A0A351ETF8      AFTEAAL-------------LKSPP----EVKVAAAGTGSTLTFNARGAVPEDLAAAANV
A0A542FTE6      VAESVAE------AIGSSSPGSLLA----ATTPYLADDSSLIQISASASTPEAARVLADA
A0A349B7N2      VPERVAA-------EFGVEPDVLVS----QVQVRQNPQVATLDITSVGTDPDRAVRIADG
A0A7J5B4S5      VYEKIAQNPD---SGLAEG-QTLTG----RLTASVAPNSNLIEVQASADSPAAAVALANG
A0A4Q2JUT1      VAQGVID--D---LDLSTTPEALIQ----RVTVENPTGTVILSVTAQAPTAEGARELAEA
A0A6L5R0V7      VAQGVID--D---LELTTTPEALIQ----RVTVDNPSGTVILSVTAEASTAEDARRLAEA
A0A2S5UYV0      VYAKIAENPA---LGLAEG-QALTG----RLSASVAPGSNLIQVQASADSPSSAVALANG
A0A2S5X9U6      VYAKIAENPD---SGLAEG-ETLNG----RLSATVAPNSNLINVQATASTPSSAVALANG
A0A2S5ULV5      VYAKIAENPN---SGLAAG-ETLTG----RLSATVAPNSNLIQVSASASTPSSAVALANG
A0A653YMF0      VYNKIAENPN---SGLAAG-ETLNG----RLSATVAPSSNLIQVSASASTPSSAVALANG
A0A3Q9IY80      VAEHAIA--E---LGLTSSPESLVN----RVQVSNPTDTVNIRVVASASSPEGARDLAQA
A0A0F0LP73      VREEIAK-------DAKVPLSKLNG----SLSAQVVPGSTMVRVTANAPDPQSALRLANG
A0A346Y185      VAERASV--L---LGGRLDSDQVRE----QSRIRPASDLDQLSISATDGTASGAAQIANA
A0A4V1VGV9      VANRIAEESK---GSLRAGEFSVVG--------ASSEGSATLTLTASAATPAKAQRAADL
A0A7G8U6P0      VANRIAEESK---GSLRAGEFSVVG--------ASSEGSATLTLTASAATPAKAQRAADL
A0A259S8H9      VRDEIAK--E---AG--VSAAELHG----SLSARVVPGSTLVEVTADAADPKSALKLANG
A0A2W1Z497      VAKRVVR--A---TGTSASPQELLG----RVQTRLPEGTAIIDVTASGATPRESADLADA
A0A0Q5L115      VAESAAA--A---LGGAASPASLLG----RVTTSLPEDTAIITVTSRGSTPADAAALTDA
A0A7G6YY64      VAESAAA--A---LGGAASPASLLG----RVTTSLPEDTAIITVTSRGSTPADAAALTDA
A0A1F1X071      VGQRIVD--E---LGLEASPDEVAG----SLQTTLDPNAPIITVEAVAPTAEEASAIANA
A0A3R8RWC7      VGQRIVD--E---LGLEASPDAVAG----SLQTTLDPNAPIITVEAVAPTAEEASAIANA
A0A4U0RJZ4      VADRVVALSN---GALSPGDFVLAG--------AGSEGTSNLSLTASSSSAAKAQQAANL
A0A4R1FGL9      VADRVVALSK---GALSPGDFVLAG--------AGSEGTSNLSLTASSSSAAKAQQAANL
E3B8H1          VADRVVALSK---GALSPGDFVLAG--------AGSEGTSNLSLTASSSSAAKAQQAANL
A0A7D7WDT9      VREAIAK--E---AGVDVSD--LSG----ALSADVVPGSTMIRVTATSSSPKAALELANG
A0A0Q5AWK6      VYERIQS--D---PEANPGGEALNG----RLTASVAPGSTLIQVTAEASTPENAAALANG
A0A6P1F176      VYERIEA--D---PEANPGGERLNG----RLTAAVAPGSTLIEVTAAASTPENAAALANG
A0A3N1NLD3      VYERIES--D---PEANPGGEPLNG----RLTAAVAPGSTLIEVTASASTPENAAALANG
A0A3N2FVI8      VYERIES--D---PEANPGGEPLNG----RLTAAVAPGSTLIEVTASAATPENAAALANG
A0A2S5XDQ6      VSERIEA--D---PEANPGGEALSG----RLTARVAPGSTLIEVTAAAGTAQNAAALANG
A0A2S5XNN6      VSERIEA--D---PEANPGGEALSG----RLTARVAPGSTLIEVTAEAGTAQNAAALANG
A0A3L8NYD3      VAQDVID--S---LKLDETPSDIAS----RFSAVGDADNPQLTIYATASSPSQARDLANA
A0A1M6K628      VAETVAQ--E---LG--VQSGEVSL----DAKNDGVI----FEITAQAPTAEGARLMADA
A0A561E8R3      VAERAAQ--A---LGPNAPGGSISA----SVSAVSSV----INFTAISSTPNGARELADA
A0A345NSU7      --------------MLQMSGSAVSA----E------------------------------
A0A222TG79      VISNAVS--ES---RKSISSEDVRK----KLSTSWDPDTVLLNVTVEDSDRSVAVVLANS
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------MTTTVPQKTVIVEVTVTDPDAASAARIANA
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      LEQRAVK--AL---GLEDAGD---A----EVRGEVVGNSSVVRVVVRTTDPERAAQLAGQ
A0A261FE22      VLEPVVN--NL---GLHTSVAGLRG----NVSASASDGSAFVSMTVTYSDPNDTVTILNE
A0A5C8C085      ----------------NESPASLIG----RISAEQPTDTVLIKITAKADSPHAAQALADA
A0A4Y5YMQ6      VLEPVVE--DLAEAGIDISLPQLRR----AVAVTIPQNTVILDITAASADPRDAAEIANS
A0A1E4BP96      VAEHAIE--DL---GLSASPESLVG----NVTVSNPLDTVVIHVAATAATPESARDLAEA
A0A151BT98      VQKVIRQ--QA------KLGPSVPV----TVSATLSDTANIMTATASSGSAQEAAAIANA
A0A2Y8ZRF8      VQEVIRK--QA------KVGPTAAV----NVNATLSDTANIMTGTASSGSAQEAAAIANA
A0A2R9UAT1      VAEYAIE--KL---RLDSSPEALVR----RVDVTNATGTVTIKVQASAPTPETARDLAEA
A0A4Q5J5D7      TAEGVID--EL---GLDDSPASLIG----KISVEQPLDTVLIKVTARDATPLGAQQLADA
A0A3S0V9U6      VAQKIAS--SS---KTSLDAAAIPS----HLEPSVEDGSTLIRVRATASSPEDAVALANA
A0A1S2N0P2      VAKKIAE--NN---SVGIDESAIPS----HLSASVEPNSTLIKVTATASSPQDAATLANN
A0A0Q3BEY5      VAKKIAE--NN---SVGIDESAIPS----HLSASVEPNSTLIKVTATASSPQDAATLANN
A0A4R6Q3C6      VAKKIAE--NN---SVGIDESAIPS----HLSASVEPNSTLIKVTATASSPQDAATLANN
A0A2X3GKL3      VAKKIAE--NN---SVGIDESAIPS----HLSASVEPNSTLIKVTATASSPQDAATLANN
A0A1Y4CKD6      FRGVLED--AL-------GTDSLDG----TIEAQTIDNSNMVTMWVDSASPENARAILEK
A0A0Q7KBQ4      LLQDVIN--RLN--LTGVTREELAG----QVTAQIIATTQTLQVDVTADSAELAQQIAEA
A0A5Q5BFU2      LAQRTID--KL---GLDMTAQALQE----NVKAGAKPDTVLIDVAVLDQSPVRARDIANT
A0A439DNZ6      LAQRTID--KL---DLEMSAGELQN----KVKASSKLDTVLINVSVLDESPVRARDIADA
A0A7I7UD03      LAQRTID--KL---GLDMSAEDLQA----HVKASSKVDTVLINVDVLDESPVRARDIANT
A0A7I7MI62      LAQRTID--KL---GLDASAKDLQA----NVKASAKADTVLINVDVLDKSPVRARDIANT
A0A0J6YE86      -----------------MSADELQA----RITATAKPDTVLIDVAVLDESAVRARDIANT
A0A7I7K1R9      LAQRTVD--KL---GLNMSAAELQE----NVTASAKTDTVLIDVHVLDESPVRARDIANT
A0A7I9ZLK4      LAQRTID--KL---GLDMKADSLRQ----HVNASSKPDTVLIDVNVLDESPVRARDIANT
A0A1F1IHY9      VSDKAVE--EL---PFDLSSGEALR----NVEVASTSGSAQIVVRAEDSSPERAQQLASA
A0A7H2BCD6      VAERIAS--ENP--DLGMSAGEIAG----NLTASMDNQSALIRVQATANDPVKAQTLANS
A0A542HCT5      TAQDVIK--TL---GLDAQPAGLIG----RITVKQPLDTVGIKISARASTPRGAQQLADA
A0A0Q5M6Z7      VADRARK--IL---GTDRSIGDLLG----HIQASLPADTAVIEITARASTPDGAAKLANA
A0A7G6YA19      VAKRAQD--IL---NTDRSISDLLG----HITTTLPADTAIIEITARAGTPDGAAKLANA
A0A2S8WHZ8      IADLVRK--EL---KLDESSDVLLG----KVEVTVPTNTAEIRVTASSQGAEEARNLADA
A0A537WNY9      DAAAARS--TKE--RASALLGRSVA----AISVETFKGTGIIKITARSTSRSLAQQSAQA
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      LRNEISA--SV--------GEPVEG----SVSCSQVSGTNLLTLSVTSPTPRQAYLFIQS
A0A3N3ZPU0      VAQIAAE--SL--------DGTPVH----DVAFSVVPGTSQIKVEGRSDSPEGSAKVADA
A0A359IQX7      VSQDVAD--GL----RSKYGKDVPF----SLSPGVTGGSVLFTVTAIAPTPSEAKDAADL
A0A433EDP2      VAKIIQE--KNP--NMGMTVSGIRG----SVTASTDENSSLIKVSAHASTPEQAQVLANS
A0A231VTW0      VAKIIQE--KNP--NMGMTVSGIRG----SVTASTDENSSLIKVSAHASTPEQAQVLANS
A0A433ECD0      VAKIIQE--KNP--NMGMTVSGIRG----SVTASTDENSSLIKVSAHASTPEQAQVLANS
U7V3Z1          VAKIIQE--KNP--NMGMTVSGIRG----SVTASTDENSSLIKVSAHASTPEQAQVLANS
A0A1F1J417      VAKIIQE--QNS--D--LSIGTIRG----SLSATTEENSSLIKVRATASSPEQARVLANS
A0A2A8D6P2      VAKIIQE--QNS--D--LSIGTIRG----SLSATTEENSSLIKVRATASSPEQARVLANS
A0A1F0THV9      VAKIIQE--QNS--D--LSIGTIRG----SLSATTEENSSLIKVRATASSPEQARVLANS
A0A5F0M6Y0      VAKIIQE--QNS--D--LSIGTIRG----SLSATTEENSSLIKVRATASSPEQARVLANS
E3H5W1          VAKIIQE--QNS--D--LSIGTIRG----SLSATTEENSSLIKVRATASSPEQARVLANS
A0A1F1QKB0      VAKIIQE--QNS--N--LSIGTIRG----SLSATTEENSSLIKVRATASSPEQARVLANS
A0A509JY23      VAKIIQE--QNS--D--LSIGTIRG----SLSATTEENSSLIKVRATASSPEQARVLANS
A0A448USF4      VAKIIQE--QNS--D--LSIGTIRG----SLSATTEENSSLIKVRATASSPEQARVLANS
A0A0Q9LZR0      TAQDVIN--TL---GLGAQPAGLIG----SITVTQPVDTVLLKISARAATPRGAQQLADA
A0A1N7E3F1      VVGRIAG--GE-------DVADVQA----RITANAIPETTLLRATVADSVPTRAAARANA
A0A544ZKQ1      VIGRIAR--GE-------AVDDLQA----RITAGAVPDTTLLRATVADSVPARAAARANA
A0A372P1T1      VVGRIAR--GE-------DVTDLQA----RITADAIPDTTLLRATVADSVPVRAAARANT
A0A5D0Q2X0      VVGRIAR--GE-------DVTDLQA----RITADAIPDTTLLRATVADSVPVRAAARANT
A0A5R8Z2E7      VVGRIAR--GE-------DVTDLQA----RITADAIPDTTLLRATVADSVPVRAAARANT
A0A1L2ZMV4      VSQLVSK--HF----AEEGQAVSWK----GVTFTKDPSNSQIRVTATAENPEHARASADA
A0A6I3F378      VRLGVQQ-------QLHLSSPPPRA----KFNTSTTSD--VVTFFVESPDAQLAADVANA
A0A1S1CQC5      VAQKIKQ--NTP--ELSLTTGQIRS----SLTATAGDNAALITVSAQASSPKNAQLLANS
A0A1E9T6I0      VAQKIKQ--NTP--ELSLTTGQIRS----SLTATAGDNAALITVSAQASSPKNAQLLANS
A0A1F1GHA7      VAQKIKQ--NTP--ELSLTTGQIRS----SLTATAGDNAALITVSAQASSPKNAQLLANS
A0A1S1CAD0      VAQKIKQ--NTP--ELSLTTGQIRS----SITAAAGENAALITVSAKASSPKNAQLLANG
G5ET14          VAQKIKQ--NTP--ELSLTTGQIRS----SITAAAGENAALITVSAKASSPKNAQLLANG
A0A1E9DXX2      VAQKIKQ--NNP--ELSMTTGQIRG----SLTATAGENAALITVNAKASSPKNAQLLANS
A0A1E8S156      VAQKIKQ--NNP--ELSMTTGQIRG----SLTATAGENAALITVSAKASSPKNAQLLANG
A0A1E8S5S2      VAQKIKQ--NNP--ELSMTTGQIRG----SLTATAGENAALITVSAKASSPKNAQLLANG
A0A1S1DFA8      VAQKIKQ--NNP--ELSMTTGQIRG----SLTATAGENAALITVSAKASSPKNAQLLANG
A0A2I1Z490      VAQKIKQ--NTP--ELSLTTGQIRS----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1F0DAA9      VAQKIKQ--NNP--ELSLSTGQIRS----SLTATAGDNAALITVNAKASSPKNAQVLANS
A0A1F0PHK9      VAQKIKQ--NNP--ELSLSTGQIRS----SLTATAGDNAALITVNAKASSPKNAQVLANS
A0A1F0VZG6      VAQKIKQ--NNP--ELSLSTGQIRS----SLTATAGDNAALITVNAKASSPKNAQVLANS
A0A1E9G8X4      VAQKIKQ--NNP--ELSMTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1E9IAW2      VAQKIKQ--NNP--ELSMTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1E9ZBC9      VAQKIKQ--NNP--ELSMTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1E9ZDP4      VAQKIKQ--NNP--ELSMTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1F0R6B5      VAQKIKQ--NNP--ELSMTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1F0Z7N5      VAQKIKQ--NNP--ELSMTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1F1D897      VAQKIKQ--NNP--ELSMTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
D2NP38          VAQKIKQ--NNP--ELSMTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1F1FV74      VAQKIKQ--NNP--DLSLTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1E9M791      VAQKIKQ--NNP--ELSMTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A291DEI8      VAQKIKQ--NNP--ELSMTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1S1D5T1      VAQKIKQ--NTP--ELSLTTGQIRS----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1E8TRD6      VAQKIKQ--NNP--ELSLTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1F0XT88      VAQKIKQ--NTP--ELSLTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1F1EVP5      VAQKIKQ--NNP--ELSLTTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
C6R548          VAQKIKQ--NTP--ELSLTTGQIRS----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A0K2RXS2      VAQKIKQ--NNP--ELSLSTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A1F0KX60      VAQKIKQ--NNP--ELSLSTGQIRA----SLTATAGDNAALITVSAQASSPKNAQLLANG
A0A542I3V2      IADQVIA--TV---GLNTTADALLP----TVSVNVPVETAEIRITATSPDPVMAQRVADA
A0A2T0UZ65      VGKRAGE--II---GSDAPPEVLAA----RVAGSVAPGSVILKINATGPTPTDARDLADA
A0A1R4JTI6      VAEGAVK--QA---GLDISPEAASG----AVTATVPPDTAEVRLSVVQDSPDAARALADS
A0A4R7TM52      VADDAIS--QL---GLNTQPEALVR----QVKVTNPTDTVNLVVQASASTPEGARDLAQA
A0A542XE74      VAQRADR--TLA--SQGITRD---G----TVTATASEGSPFINVTAQAPTARDAQALANA
A0A0Q7QDF6      LEQRAVK--AL---GLEDAGDA-------EVRGEVVGNSSVVRVVVRTTDPERAAQLAGQ
A0A5R8L819      VAQHAID--EL---GLKVTPEYLVN----RVAVTNPLDTVNINVRAQASTPEGARDLAQA
A0A7K0PFV4      TDDTTAR--VL---GRGTTRKDVRE----RVALEAIGGGSVVAVRGTAASEAEAVRLTQT
A0A0G3V3F3      VTAAAAK--SS---GLDITANDAAS----LISASAVGDLGFLEVYAKGPSVSEAEQLSSA
A0A7K0MUQ7      VTAEAAK--SS---GLNITANDAAS----LISASAVGDLGFLEVYAKGPSVSDAEQLASA
A0A7K0U619      VTAEAAK--SS---GLNITANDAAS----LISASAVGDLGFLEVYAKGPSVSDAEQLASA
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------K--SS---GLNITANDAAS----LISASAVGDLGFLEVYAKGPSVSDAEQLGSA
A0A7K0V140      ----AAK--SS---GLNITANDAAS----LISASAVGDLGFLEVYAKGPSVSDAEQLASA
A0A261FQA1      VLEPVID--EL---DLDTSVDAMAS----SVSASVDASG-LMTVTATSSDSQQAADIANA
A0A1Q2CJ92      VANRIAE--EL---ALP-STGPVVG----NLEGSV--DGVIFRIRATADSPELAASLADA
A0A2T0S3C8      LAKVVAA--KTP--GLELTPAEVRE----RITAEALPETVLLQATVTDGSAERSRLIAGV
A0A4Y8WZJ3      VSDKAVE--EL---PFDLSSGEALR----NVEVASTSGSAQIVVRAEDSSPERAQQLASA
A0A285VUW0      MLDPVRE--TL---GLDASVPLSVE----AVPGG--DDTALFDFVVRSDSPDHASAVAEA
A0A2R7Z032      VAERVVE--KL---GLDVDPGAIAG----RFSASVDTDINLLTVQAIGTTPEEARDLASI
A0A6J4MTQ2      VAERVVE--EL---SLDLPPSAVAS----RFTASVDATGIVLTVQATGTSPVEARDLANA
A0A1I0W453      VAAQVVE--DL---DLDVPPEAIAG----RFSASVDADVNALTVTAIGTTPEEARDLANA
A0A1H4LCS9      VAQLVVD--DL---GLDVPPEAIAG----NFSASVDTTVNALTVTATASTPQDAQDLANA
A0A4Q2RZP8      VAQLVVD--DL---GLDVPPEAIAG----NFSASVDTSVNALTVTAVSTSPTDARDLANA
A0A0Q6VV12      VAEKVVD--DL---GLDVPPSEIAG----RFSATVNADVNALTITAIGSTPEQARDLANG
A0A495NTA9      VAEKVVE--DL---GLSTPPSEIAG----RFTATVNADVNALTVTAIGSTPEEARDLATS
A0A0Q9QB08      VAEQVVK--EL---GLDMPPSAIAS----RFSATVNSDVNAITISAVGTTPEEARDLANA
A0A4Q2SA86      VAEKVVE--DL---GLDVPPSAIAG----RFSASVDASVNALTVTAIGSTPEEARDLASA
A0A4Z1C3Z0      VAERVVE--DL---GLDVPPSAIAG----RFSASVDASVNALTVTAIGSTPQEARDLATA
A0A6V8KDX4      LAQAIAA--DA---SLGLSPRQVQE----RITARVVPDTVLLEATVTDSSKARSKALAEA
A0A444BL03      VAQRAIT--AT---GIDASPEDVAR----RVTGTVAENSVIMQVTATGPTPDESRRLADA
A0A4Y8X357      VRERISQ--G--------GVDTAGA----SLSAALVPGSNLITVSAIAPDAQQAAALANT
R4LD52          LAQLVAA--EP---GVGLDARHIRE----RVAAQAVPETVLLQATVTDTDRDRSARIATV
A0A4T2CD79      VAQLVIT--AL---GLTASPETVAG----EITVTNIKDTPTINVTARASSGIEAKKLADA
A0A6L6AM03      VAEQVVE--DL---DLAIPPSAIAG----RFSASVDAEVNSLTVSAVGSTPEEARDLANA
A0A4Q2RU39      VAQEVVD--EL---GLDVPPSAIAG----RFSATVDASVNSITISAIGTTPVEARDLANA
A0A4Q2SK58      VAAEVVD--DL---GLDVPPEAIAG----RFSASVDAAVNSLTVSAVGTTPEEARDLANA
A0A2N3YJR1      VAQRAIE--AT---GVKASPASVAS----RVTASVAPDSVILKVTATAPSPEEARVLADA
A0A6G8FYB9      VAERAIA--AT---GIDASPAEVAG----RVGASVAANSVILKVTATGPTPEESRVLADA
A0A4Q4D742      VLQTVVD--RL---NLDESPTQLAG----QISATVVTGTINIQIDVTADTAEQAQLIAGA
A0A1C6T1J1      LAQSVVA--EG---QVGLTAEQIQG----RVSTSTETGTVLLRASVTDTDQTRALKLTEL
A0A2W2CFC8      LARSVVA--DN---QLGLTAEQVRG----RISTSTETGTVLLRASVVDTDQTRALRVTEA
A0A2W2A4B0      VLQPVID--EL---HLDVKASELAR----SVSATSPTGSVVMQIAVTSPDRQRVAEITDS
A0A4Y9MDA5      VLGPAGE--AP---DVAA-TGSLAG----QVTATVVPDTVIVAITATDPSADRAAAIANA
A0A1H7N9P7      VLGPAGE--AP---DVAAGSRSLAA----QVSASVVPETVVVQISATDPSPARAAAIANA
A0A1M7V0F8      VLGPAGE--RA---GVSADARSLAG----RVTATVVPETVVVRIAATDPSPARAAAIADA
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      GNMRVVC----------------------RLPDPLRAERCANAFAKQAVVFSKKDRLLSA
A0A538AM15      DRALQQG----------------------RAPEAPPPAPVVPEVHTANEAAPRQEPLVAV
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      LDTRVRR----------------------DSDVTTVIDAPVLGSLSRNEAYVGTSPVIIS
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      --------------------------------------------------------MARH
A0A4R1CW45      ---------------------------------MAEAVSSSMNIKSLQLETLRVVQPNRD
A0A4R5Z7B0      ----------------------------------------------MVFKKNKKVRTT--
A0A542H054      ----------------------------------------------MGSKKSKKLKQVMM
A0A6M8GFV5      ----------------------------------------------MSKQTAKE------
A0A7G8U6J2      ----------------------------------------------MGFLRRKD------
A0A419GS64      -----------------------------------------------------MAMKTKS
A0A2V2CXY5      ----------------------------------------------------MASEGRAG
A0A2S8MDM2      --------------------------------------------------------LDKE
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      --------------------------------------KPVVGTIPEEKSFTADNRLLPF
A0A1I6IST1      --------------------------------------KPVVGTIPEEKSFTADNRLLPF
A0A412JBM5      SHELKRE----------------------SGHMRPAC----------------DRKLLTY
A0A6J4SUA1      LDRRFRY----------------------PEQVTDDLGLDILGAVPMLRSP-RARDISP-
A0A1C2B334      -----------------------------MGVVDSPV----IGLVPGDSAL-DGEGFVDF
R7Y679          LGTRIRD----------------------EGDLDDAIGVHSLGVVASDGAF-ADRSLIDF
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------M----------------------AARVDRGGDSAIRGLVD--------------
A0A538BBM6      -----------------------------------------------MRTRSSRGGAEVR
A0A7K0LE65      ASRAIGD----------------------RIGRTGDADADVARITG-----LPVLGRIPK
A0A510HHA8      NLKRRAR----------------------EEQRNGDLSGRLITLHD--------------
A0A6G8Q9J3      KVKRPAR----------------------KGNAEGGPSASLVTVTD--------------
A0A5Q2F9A3      LDTRVRT----------------------ASDVAQLTDSPLVGRIGYDAASERGLTLISD
A0A4R1BMZ2      IISRRKK----------------------RSEREEDLSGRLVTILD--------------
A0A023X491      ARSKPLK----------------------KHKKTENLTDRLVSLSD--------------
A0A6G8QDQ0      TESKMGK----------------------ETGASAIAAENLITLAE--------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ---------------------------------MPHVERRNGSGEE--------------
A0A6D1QMN1      MARKNKT----------------------NQPDMSEKQRSLITEFD--------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------MGEHLVSLLN--------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      DAPVLSS----------------------VAYDADVPKHPLLTEVG--------------
                                                                            

A0A6N6NKS9      L-----------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      V-----------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      I-----------------------------------------------------------
A0A4Q5B0V3      I-----------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      I-----------------------------------------------------------
A0A6N4VXX3      L-----------------------------------------------------------
A0A1H4I042      L-----------------------------------------------------------
A0A4R7A6D9      L-----------------------------------------------------------
A0A1Q2CRV2      I-----------------------------------------------------------
A0A7K0NRJ7      A-----------------------------------------------------------
K6WHS4          V-----------------------------------------------------------
A0A1L2ZMQ6      W-----------------------------------------------------------
A0A3E2DN22      G-----------------------------------------------------------
A0A3Q9ULZ9      A-----------------------------------------------------------
A0A3S9JFL2      A-----------------------------------------------------------
A0A7K0NTR2      F-----------------------------------------------------------
A0A1H6WL79      W-----------------------------------------------------------
A0A101LAM5      W-----------------------------------------------------------
A0A4Y3NEG0      W-----------------------------------------------------------
A0A1Q2CI19      F-----------------------------------------------------------
A0A512T3M3      F-----------------------------------------------------------
W6JTW4          F-----------------------------------------------------------
A0A0A0JTY0      F-----------------------------------------------------------
A0A0A0JXF2      F-----------------------------------------------------------
E6S8H2          F-----------------------------------------------------------
A0A0A0JGH0      F-----------------------------------------------------------
N0E4U7          F-----------------------------------------------------------
A0A0A0IYK2      F-----------------------------------------------------------
A0A0Q9L0H3      F-----------------------------------------------------------
A3TMK0          F-----------------------------------------------------------
A0A543PXP1      F-----------------------------------------------------------
A3TMH6          F-----------------------------------------------------------
A0A6I2XCV4      S-------------------------------------------------------AKIL
A0A5R8VLL6      W-----------------------------------------------------------
A0A3L7ADK2      W-----------------------------------------------------------
A0A538JQF8      F-----------------------------------------------------------
A0A1H6YPK1      W-----------------------------------------------------------
A0A0Q9TBP0      V-----------------------------------------------------------
A0A0G3V3M7      F-----------------------------------------------------------
A0A6I3DD56      F-----------------------------------------------------------
A0A5Q2FA83      V-----------------------------------------------------------
A0A2R7MGI0      W-----------------------------------------------------------
A0A2T7WQY4      W-----------------------------------------------------------
A0A1G6GTN3      W-----------------------------------------------------------
A0A1N7DLV3      W-----------------------------------------------------------
A0A1V2NSB5      W-----------------------------------------------------------
A0A0Q5Q5L3      W-----------------------------------------------------------
A0A0Q6DVM4      W-----------------------------------------------------------
A0A1R3WWR6      W-----------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      W-----------------------------------------------------------
A0A2W6DK08      F-----------------------------------------------------------
A0A2S0LQ32      A-----------------------------------------------------------
A0A2N6V1R5      G-----------------------------------------------------------
G9PHS6          G-----------------------------------------------------------
U1PLM7          G-----------------------------------------------------------
A0A346XTB0      V-----------------------------------------------------------
A0A6I1G2U1      F-----------------------------------------------------------
A0A351ETF8      WAQTYVTARYAETLAQNVESIEFLQALIAEIAEDRDAIRVEVDFYDDLLAETTDPDEYSR
A0A542FTE6      W-----------------------------------------------------------
A0A349B7N2      F-----------------------------------------------------------
A0A7J5B4S5      A-----------------------------------------------------------
A0A4Q2JUT1      W-----------------------------------------------------------
A0A6L5R0V7      W-----------------------------------------------------------
A0A2S5UYV0      A-----------------------------------------------------------
A0A2S5X9U6      A-----------------------------------------------------------
A0A2S5ULV5      A-----------------------------------------------------------
A0A653YMF0      A-----------------------------------------------------------
A0A3Q9IY80      W-----------------------------------------------------------
A0A0F0LP73      A-----------------------------------------------------------
A0A346Y185      I-----------------------------------------------------------
A0A4V1VGV9      A-----------------------------------------------------------
A0A7G8U6P0      A-----------------------------------------------------------
A0A259S8H9      A-----------------------------------------------------------
A0A2W1Z497      W-----------------------------------------------------------
A0A0Q5L115      W-----------------------------------------------------------
A0A7G6YY64      W-----------------------------------------------------------
A0A1F1X071      A-----------------------------------------------------------
A0A3R8RWC7      A-----------------------------------------------------------
A0A4U0RJZ4      A-----------------------------------------------------------
A0A4R1FGL9      A-----------------------------------------------------------
E3B8H1          A-----------------------------------------------------------
A0A7D7WDT9      S-----------------------------------------------------------
A0A0Q5AWK6      A-----------------------------------------------------------
A0A6P1F176      A-----------------------------------------------------------
A0A3N1NLD3      A-----------------------------------------------------------
A0A3N2FVI8      A-----------------------------------------------------------
A0A2S5XDQ6      A-----------------------------------------------------------
A0A2S5XNN6      A-----------------------------------------------------------
A0A3L8NYD3      V-----------------------------------------------------------
A0A1M6K628      G-----------------------------------------------------------
A0A561E8R3      A-----------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      V-----------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      I-----------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      V-----------------------------------------------------------
A0A261FE22      V-----------------------------------------------------------
A0A5C8C085      W-----------------------------------------------------------
A0A4Y5YMQ6      V-----------------------------------------------------------
A0A1E4BP96      W-----------------------------------------------------------
A0A151BT98      T-----------------------------------------------------------
A0A2Y8ZRF8      T-----------------------------------------------------------
A0A2R9UAT1      W-----------------------------------------------------------
A0A4Q5J5D7      W-----------------------------------------------------------
A0A3S0V9U6      S-----------------------------------------------------------
A0A1S2N0P2      A-----------------------------------------------------------
A0A0Q3BEY5      A-----------------------------------------------------------
A0A4R6Q3C6      A-----------------------------------------------------------
A0A2X3GKL3      A-----------------------------------------------------------
A0A1Y4CKD6      A-----------------------------------------------------------
A0A0Q7KBQ4      E-----------------------------------------------------------
A0A5Q5BFU2      L-----------------------------------------------------------
A0A439DNZ6      L-----------------------------------------------------------
A0A7I7UD03      L-----------------------------------------------------------
A0A7I7MI62      L-----------------------------------------------------------
A0A0J6YE86      L-----------------------------------------------------------
A0A7I7K1R9      L-----------------------------------------------------------
A0A7I9ZLK4      L-----------------------------------------------------------
A0A1F1IHY9      W-----------------------------------------------------------
A0A7H2BCD6      A-----------------------------------------------------------
A0A542HCT5      W-----------------------------------------------------------
A0A0Q5M6Z7      W-----------------------------------------------------------
A0A7G6YA19      W-----------------------------------------------------------
A0A2S8WHZ8      W-----------------------------------------------------------
A0A537WNY9      A-----------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      A-----------------------------------------------------------
A0A3N3ZPU0      Y-----------------------------------------------------------
A0A359IQX7      G-----------------------------------------------------------
A0A433EDP2      A-----------------------------------------------------------
A0A231VTW0      A-----------------------------------------------------------
A0A433ECD0      A-----------------------------------------------------------
U7V3Z1          A-----------------------------------------------------------
A0A1F1J417      A-----------------------------------------------------------
A0A2A8D6P2      A-----------------------------------------------------------
A0A1F0THV9      A-----------------------------------------------------------
A0A5F0M6Y0      A-----------------------------------------------------------
E3H5W1          A-----------------------------------------------------------
A0A1F1QKB0      A-----------------------------------------------------------
A0A509JY23      A-----------------------------------------------------------
A0A448USF4      A-----------------------------------------------------------
A0A0Q9LZR0      W-----------------------------------------------------------
A0A1N7E3F1      L-----------------------------------------------------------
A0A544ZKQ1      L-----------------------------------------------------------
A0A372P1T1      L-----------------------------------------------------------
A0A5D0Q2X0      L-----------------------------------------------------------
A0A5R8Z2E7      L-----------------------------------------------------------
A0A1L2ZMV4      F-----------------------------------------------------------
A0A6I3F378      Y-----------------------------------------------------------
A0A1S1CQC5      A-----------------------------------------------------------
A0A1E9T6I0      A-----------------------------------------------------------
A0A1F1GHA7      A-----------------------------------------------------------
A0A1S1CAD0      A-----------------------------------------------------------
G5ET14          A-----------------------------------------------------------
A0A1E9DXX2      A-----------------------------------------------------------
A0A1E8S156      A-----------------------------------------------------------
A0A1E8S5S2      A-----------------------------------------------------------
A0A1S1DFA8      A-----------------------------------------------------------
A0A2I1Z490      A-----------------------------------------------------------
A0A1F0DAA9      A-----------------------------------------------------------
A0A1F0PHK9      A-----------------------------------------------------------
A0A1F0VZG6      A-----------------------------------------------------------
A0A1E9G8X4      A-----------------------------------------------------------
A0A1E9IAW2      A-----------------------------------------------------------
A0A1E9ZBC9      A-----------------------------------------------------------
A0A1E9ZDP4      A-----------------------------------------------------------
A0A1F0R6B5      A-----------------------------------------------------------
A0A1F0Z7N5      A-----------------------------------------------------------
A0A1F1D897      A-----------------------------------------------------------
D2NP38          A-----------------------------------------------------------
A0A1F1FV74      A-----------------------------------------------------------
A0A1E9M791      A-----------------------------------------------------------
A0A291DEI8      A-----------------------------------------------------------
A0A1S1D5T1      A-----------------------------------------------------------
A0A1E8TRD6      A-----------------------------------------------------------
A0A1F0XT88      A-----------------------------------------------------------
A0A1F1EVP5      A-----------------------------------------------------------
C6R548          A-----------------------------------------------------------
A0A0K2RXS2      A-----------------------------------------------------------
A0A1F0KX60      A-----------------------------------------------------------
A0A542I3V2      W-----------------------------------------------------------
A0A2T0UZ65      T-----------------------------------------------------------
A0A1R4JTI6      W-----------------------------------------------------------
A0A4R7TM52      W-----------------------------------------------------------
A0A542XE74      T-----------------------------------------------------------
A0A0Q7QDF6      V-----------------------------------------------------------
A0A5R8L819      W-----------------------------------------------------------
A0A7K0PFV4      Y-----------------------------------------------------------
A0A0G3V3F3      A-----------------------------------------------------------
A0A7K0MUQ7      A-----------------------------------------------------------
A0A7K0U619      A-----------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      A-----------------------------------------------------------
A0A7K0V140      A-----------------------------------------------------------
A0A261FQA1      V-----------------------------------------------------------
A0A1Q2CJ92      A-----------------------------------------------------------
A0A2T0S3C8      L-----------------------------------------------------------
A0A4Y8WZJ3      W-----------------------------------------------------------
A0A285VUW0      L-----------------------------------------------------------
A0A2R7Z032      V-----------------------------------------------------------
A0A6J4MTQ2      V-----------------------------------------------------------
A0A1I0W453      V-----------------------------------------------------------
A0A1H4LCS9      V-----------------------------------------------------------
A0A4Q2RZP8      V-----------------------------------------------------------
A0A0Q6VV12      V-----------------------------------------------------------
A0A495NTA9      V-----------------------------------------------------------
A0A0Q9QB08      V-----------------------------------------------------------
A0A4Q2SA86      V-----------------------------------------------------------
A0A4Z1C3Z0      V-----------------------------------------------------------
A0A6V8KDX4      L-----------------------------------------------------------
A0A444BL03      V-----------------------------------------------------------
A0A4Y8X357      A-----------------------------------------------------------
R4LD52          L-----------------------------------------------------------
A0A4T2CD79      W-----------------------------------------------------------
A0A6L6AM03      V-----------------------------------------------------------
A0A4Q2RU39      V-----------------------------------------------------------
A0A4Q2SK58      V-----------------------------------------------------------
A0A2N3YJR1      V-----------------------------------------------------------
A0A6G8FYB9      V-----------------------------------------------------------
A0A4Q4D742      E-----------------------------------------------------------
A0A1C6T1J1      L-----------------------------------------------------------
A0A2W2CFC8      V-----------------------------------------------------------
A0A2W2A4B0      I-----------------------------------------------------------
A0A4Y9MDA5      V-----------------------------------------------------------
A0A1H7N9P7      V-----------------------------------------------------------
A0A1M7V0F8      V-----------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      Q-----------------------------------------------------------
A0A538AM15      D-----------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      R-----------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      R-----------------------------------------------------------
A0A4R1CW45      A-----------------------------------------------------------
A0A4R5Z7B0      D-----------------------------------------------------------
A0A542H054      S-----------------------------------------------------------
A0A6M8GFV5      T-----------------------------------------------------------
A0A7G8U6J2      E-----------------------------------------------------------
A0A419GS64      R-----------------------------------------------------------
A0A2V2CXY5      M-----------------------------------------------------------
A0A2S8MDM2      R-----------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      D-----------------------------------------------------------
A0A1I6IST1      D-----------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      G-----------------------------------------------------------
R7Y679          R-----------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      S-----------------------------------------------------------
A0A7K0LE65      G-----------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      A-----------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ----------------------SSSLPAVVE-----------------------------
A0A348NU28      ----------------------ADSLTAVVR-----------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ----------------------AKSLSSVVE-----------------------------
A0A4Q5B0V3      ----------------------AKSLSSVVE-----------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ----------------------AKSLSSVVE-----------------------------
A0A6N4VXX3      ----------------------SSEFVAMVK-----------------------------
A0A1H4I042      ----------------------SDQFVKMVR-----------------------------
A0A4R7A6D9      ----------------------SDQFVKMVR-----------------------------
A0A1Q2CRV2      ----------------------TERLIVAVD-----------------------------
A0A7K0NRJ7      ----------------------TVALIDAVR-----------------------------
K6WHS4          ----------------------SQALIEYVE-----------------------------
A0A1L2ZMQ6      ----------------------IDALAEEAH-----------------------------
A0A3E2DN22      ----------------------LEALISEAL-----------------------------
A0A3Q9ULZ9      ----------------------LVGLQAEAL-----------------------------
A0A3S9JFL2      ----------------------LVGVQAEAL-----------------------------
A0A7K0NTR2      ----------------------AEKLIAYVD-----------------------------
A0A1H6WL79      ----------------------VAALASQVY-----------------------------
A0A101LAM5      ----------------------VTALAAQVY-----------------------------
A0A4Y3NEG0      ----------------------VAALASQVY-----------------------------
A0A1Q2CI19      ----------------------ANETIAFFE-----------------------------
A0A512T3M3      ----------------------ADEAVAFFS-----------------------------
W6JTW4          ----------------------AEAAKAYFA-----------------------------
A0A0A0JTY0      ----------------------ANETINYIK-----------------------------
A0A0A0JXF2      ----------------------ATETVKFFK-----------------------------
E6S8H2          ----------------------ADETVTYFK-----------------------------
A0A0A0JGH0      ----------------------AKQTVAFFA-----------------------------
N0E4U7          ----------------------ADETVAFFE-----------------------------
A0A0A0IYK2      ----------------------ATETVKFFR-----------------------------
A0A0Q9L0H3      ----------------------ATETVKFIE-----------------------------
A3TMK0          ----------------------ANQTVLFIE-----------------------------
A0A543PXP1      ----------------------ADETVAFFK-----------------------------
A3TMH6          ----------------------ADEAVSFFD-----------------------------
A0A6I2XCV4      MDSWSTDSKRRAAESSDAVIARIDELAAKRD-----------------------------
A0A5R8VLL6      ----------------------IVELARQVE-----------------------------
A0A3L7ADK2      ----------------------ITAMSEQIE-----------------------------
A0A538JQF8      ----------------------ADSLKTVLA-----------------------------
A0A1H6YPK1      ----------------------MDATFLVVS-----------------------------
A0A0Q9TBP0      ---ATSYLQFREQDSVGRYEQARDRLAQEQA-----------------------------
A0A0G3V3M7      ----------------------AAKLVGYVD-----------------------------
A0A6I3DD56      ----------------------AATLVGYVD-----------------------------
A0A5Q2FA83      -------------------GPQLASIGKEFA-----------------------------
A0A2R7MGI0      ----------------------IRGMTTQVD-----------------------------
A0A2T7WQY4      ----------------------IRGMTTQVD-----------------------------
A0A1G6GTN3      ----------------------IRGMTVEVD-----------------------------
A0A1N7DLV3      ----------------------LQGMTVQVD-----------------------------
A0A1V2NSB5      ----------------------LHGMTVQVD-----------------------------
A0A0Q5Q5L3      ----------------------IRAMTTQVD-----------------------------
A0A0Q6DVM4      ----------------------IRAMTTQVD-----------------------------
A0A1R3WWR6      ----------------------IRGMTTEVD-----------------------------
A0A2S5WZJ5      -------------------------MADVIT-----------------------------
A0A0Q5JKD6      ----------------------IRGMTEEVD-----------------------------
A0A2W6DK08      ---AAGTVDEFRARHAAAAAARFRSLEGQLT-----------------------------
A0A2S0LQ32      ----------------------IPALGSYIA-----------------------------
A0A2N6V1R5      ----------------------IKAVSDEAN-----------------------------
G9PHS6          ----------------------IKAVSDEAN-----------------------------
U1PLM7          ----------------------IKAVSDEAN-----------------------------
A0A346XTB0      ----------------------AEAYRTQKR-----------------------------
A0A6I1G2U1      -------------------------AEQSVA-----------------------------
A0A351ETF8      YLSQMVSIETLLQPQLAPLEAQISEYQRQIT-----------------------------
A0A542FTE6      ----------------------IAAMSQRVE-----------------------------
A0A349B7N2      ----------------------AGALLATLT-----------------------------
A0A7J5B4S5      ----------------------LQAMADVIS-----------------------------
A0A4Q2JUT1      ----------------------LISLGSVVE-----------------------------
A0A6L5R0V7      ----------------------LTSLGTVVE-----------------------------
A0A2S5UYV0      ----------------------LQALADVIT-----------------------------
A0A2S5X9U6      ----------------------LQAMADVIT-----------------------------
A0A2S5ULV5      ----------------------LQAMADVIT-----------------------------
A0A653YMF0      ----------------------LQAMADVIT-----------------------------
A0A3Q9IY80      ----------------------IRAMATEVE-----------------------------
A0A0F0LP73      ----------------------LHALANVVA-----------------------------
A0A346Y185      ----------------------GEAYQAVVR-----------------------------
A0A4V1VGV9      ----------------------RTALADEAK-----------------------------
A0A7G8U6P0      ----------------------RTALADEAK-----------------------------
A0A259S8H9      ----------------------LHALAKVVA-----------------------------
A0A2W1Z497      ----------------------IAGMGRQIA-----------------------------
A0A0Q5L115      ----------------------LAAMGEQIA-----------------------------
A0A7G6YY64      ----------------------LAAMGEQIA-----------------------------
A0A1F1X071      ----------------------VEATAAEAR-----------------------------
A0A3R8RWC7      ----------------------VEATAAEAR-----------------------------
A0A4U0RJZ4      ----------------------PAALSQEIK-----------------------------
A0A4R1FGL9      ----------------------PAALSQEIK-----------------------------
E3B8H1          ----------------------PAALSQEIK-----------------------------
A0A7D7WDT9      ----------------------LHALAAVVE-----------------------------
A0A0Q5AWK6      ----------------------LAALAAVIA-----------------------------
A0A6P1F176      ----------------------LAALAEVIA-----------------------------
A0A3N1NLD3      ----------------------LAALADVIA-----------------------------
A0A3N2FVI8      ----------------------LAALADVIA-----------------------------
A0A2S5XDQ6      ----------------------LAALAAVIT-----------------------------
A0A2S5XNN6      ----------------------LAALAAVIT-----------------------------
A0A3L8NYD3      ----------------------IGAMSTEAA-----------------------------
A0A1M6K628      ----------------------IRATSVAAN-----------------------------
A0A561E8R3      ----------------------VNATRDEAA-----------------------------
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      ----------------------AASLQDYVE-----------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ----------------------GDQVAETVR-----------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ----------------------AEELVSWIA-----------------------------
A0A261FE22      ----------------------VKQLNKQIT-----------------------------
A0A5C8C085      ----------------------IVALQDQIE-----------------------------
A0A4Y5YMQ6      ----------------------ADNLTEVVY-----------------------------
A0A1E4BP96      ----------------------IRGMTAAID-----------------------------
A0A151BT98      ----------------------GPALAAVAP-----------------------------
A0A2Y8ZRF8      ----------------------GPALAAVAP-----------------------------
A0A2R9UAT1      ----------------------IQGMATEID-----------------------------
A0A4Q5J5D7      ----------------------VSALADQVA-----------------------------
A0A3S0V9U6      ----------------------LKATADTVN-----------------------------
A0A1S2N0P2      ----------------------LQATADYVS-----------------------------
A0A0Q3BEY5      ----------------------LQATADYVS-----------------------------
A0A4R6Q3C6      ----------------------LQATADYVS-----------------------------
A0A2X3GKL3      ----------------------LQATADYVS-----------------------------
A0A1Y4CKD6      ----------------------LEVYPEVSR-----------------------------
A0A0Q7KBQ4      ----------------------AEGIVSLVA-----------------------------
A0A5Q5BFU2      ----------------------SDEFVAMVR-----------------------------
A0A439DNZ6      ----------------------SEEFVVMVR-----------------------------
A0A7I7UD03      ----------------------SDEFVAMVR-----------------------------
A0A7I7MI62      ----------------------SDEFVAMVR-----------------------------
A0A0J6YE86      ----------------------SDEFVGRVR-----------------------------
A0A7I7K1R9      ----------------------SDEFVAMVR-----------------------------
A0A7I9ZLK4      ----------------------SDEFVAMVR-----------------------------
A0A1F1IHY9      ----------------------LGALEAQAT-----------------------------
A0A7H2BCD6      ----------------------LESVAYVAN-----------------------------
A0A542HCT5      ----------------------VAALARQVQ-----------------------------
A0A0Q5M6Z7      ----------------------IAGLTKQVR-----------------------------
A0A7G6YA19      ----------------------STALTDQVK-----------------------------
A0A2S8WHZ8      ----------------------VVALAAQVE-----------------------------
A0A537WNY9      ----------------------TDALVERTR-----------------------------
A0A5B8M469      ----------------------------MIT-----------------------------
A0A1Y4CTD2      ----------------------LQ------------------------------------
A0A3N3ZPU0      ----------------------AGALTQEVQ-----------------------------
A0A359IQX7      ----------------------LTATADAAA-----------------------------
A0A433EDP2      ----------------------LHATAEYIK-----------------------------
A0A231VTW0      ----------------------LHATAEYIK-----------------------------
A0A433ECD0      ----------------------LHATAEYIK-----------------------------
U7V3Z1          ----------------------LHATAEYIK-----------------------------
A0A1F1J417      ----------------------LHATAQYIE-----------------------------
A0A2A8D6P2      ----------------------LHATAQYIE-----------------------------
A0A1F0THV9      ----------------------LHATAQYIE-----------------------------
A0A5F0M6Y0      ----------------------LHATAQYIE-----------------------------
E3H5W1          ----------------------LHATAQYIE-----------------------------
A0A1F1QKB0      ----------------------LHATAQYIE-----------------------------
A0A509JY23      ----------------------LHATAQYIE-----------------------------
A0A448USF4      ----------------------LHATAQYIE-----------------------------
A0A0Q9LZR0      ----------------------VAALARQVQ-----------------------------
A0A1N7E3F1      ----------------------GAAFARLID-----------------------------
A0A544ZKQ1      ----------------------GAAFAQLID-----------------------------
A0A372P1T1      ----------------------GATFAALID-----------------------------
A0A5D0Q2X0      ----------------------GATFAALID-----------------------------
A0A5R8Z2E7      ----------------------GATFAALID-----------------------------
A0A1L2ZMV4      ----------------------ASALAEEAE-----------------------------
A0A6I3F378      ----------------------IEQYNIYTAKISADTLAGAVDSLQQQIDDLQKQIETLD
A0A1S1CQC5      ----------------------LQATADYIK-----------------------------
A0A1E9T6I0      ----------------------LQATADYIK-----------------------------
A0A1F1GHA7      ----------------------LQATADYIK-----------------------------
A0A1S1CAD0      ----------------------LQATADYIK-----------------------------
G5ET14          ----------------------LQATADYIK-----------------------------
A0A1E9DXX2      ----------------------LQATADYIK-----------------------------
A0A1E8S156      ----------------------LQATADYIK-----------------------------
A0A1E8S5S2      ----------------------LQATADYIK-----------------------------
A0A1S1DFA8      ----------------------LQATADYIK-----------------------------
A0A2I1Z490      ----------------------LQATADYIK-----------------------------
A0A1F0DAA9      ----------------------LQATADYIK-----------------------------
A0A1F0PHK9      ----------------------LQATADYIK-----------------------------
A0A1F0VZG6      ----------------------LQATADYIK-----------------------------
A0A1E9G8X4      ----------------------LQATADYIK-----------------------------
A0A1E9IAW2      ----------------------LQATADYIK-----------------------------
A0A1E9ZBC9      ----------------------LQATADYIK-----------------------------
A0A1E9ZDP4      ----------------------LQATADYIK-----------------------------
A0A1F0R6B5      ----------------------LQATADYIK-----------------------------
A0A1F0Z7N5      ----------------------LQATADYIK-----------------------------
A0A1F1D897      ----------------------LQATADYIK-----------------------------
D2NP38          ----------------------LQATADYIK-----------------------------
A0A1F1FV74      ----------------------LQATADYIK-----------------------------
A0A1E9M791      ----------------------LQATADYIK-----------------------------
A0A291DEI8      ----------------------LQATADYIK-----------------------------
A0A1S1D5T1      ----------------------LQATADYIK-----------------------------
A0A1E8TRD6      ----------------------LQATADYIK-----------------------------
A0A1F0XT88      ----------------------LQATADYIK-----------------------------
A0A1F1EVP5      ----------------------LQATADYIK-----------------------------
C6R548          ----------------------LQATADYIK-----------------------------
A0A0K2RXS2      ----------------------LQATADYIK-----------------------------
A0A1F0KX60      ----------------------LQATADYIK-----------------------------
A0A542I3V2      ----------------------VAELAKRVQ-----------------------------
A0A2T0UZ65      ----------------------MEAVAAEAN-----------------------------
A0A1R4JTI6      ----------------------VSSLAEEVS-----------------------------
A0A4R7TM52      ----------------------VKAMSNEVK-----------------------------
A0A542XE74      ----------------------LSALRVEALRLETFG-----------------------
A0A0Q7QDF6      ----------------------AEELVSWIA-----------------------------
A0A5R8L819      ----------------------LAGMAVEVQ-----------------------------
A0A7K0PFV4      ----------------------IDVALGARNALVEAGARRALTALDSRTDP---------
A0A0G3V3F3      ----------------------TVALIDAVRAQQTASLAQDIAPIQAQRVILQKQLSNLP
A0A7K0MUQ7      ----------------------TVALIDAVRAQQAASLAQDIAPIQAQRVILQKQLSALP
A0A7K0U619      ----------------------TVALIDAVRAQQTASLAQDIAPIQAQRVVLQKQLSDLP
A0A6I3DFP2      --------------------------------------------MQAQRVVLQKQLSDLP
A0A7K0SI36      ----------------------TVALIDAVRAQQAASLAQDIAPIQAQRVVLQKQLSDLP
A0A7K0V140      ----------------------TVALIDAVRAQQTASLAQDIAPIQAQRVVLQKQLSDLP
A0A261FQA1      ----------------------YDSLVQQIE-----------------------------
A0A1Q2CJ92      ----------------------IRATSVEAN-----------------------------
A0A2T0S3C8      ----------------------AREFTTMVE-----------------------------
A0A4Y8WZJ3      ----------------------LGALEAQAT-----------------------------
A0A285VUW0      ----------------------PQQLATTAR-----------------------------
A0A2R7Z032      ----------------------VQAIADEAE-----------------------------
A0A6J4MTQ2      ----------------------VAAVAEEAA-----------------------------
A0A1I0W453      ----------------------VDAVVVVAQ-----------------------------
A0A1H4LCS9      ----------------------IKAVVVYAA-----------------------------
A0A4Q2RZP8      ----------------------IDAVVIYAA-----------------------------
A0A0Q6VV12      ----------------------VDAVVEYAQ-----------------------------
A0A495NTA9      ----------------------VDAVVEYAQ-----------------------------
A0A0Q9QB08      ----------------------VDAVVVVAQ-----------------------------
A0A4Q2SA86      ----------------------VDAVVVYAQ-----------------------------
A0A4Z1C3Z0      ----------------------VDAVVVYAQ-----------------------------
A0A6V8KDX4      ----------------------AADFRTLVQ-----------------------------
A0A444BL03      ----------------------IKATAQEAN-----------------------------
A0A4Y8X357      ----------------------LVATADVAN-----------------------------
R4LD52          ----------------------AGQFKQLVE-----------------------------
A0A4T2CD79      ----------------------IVGLTTQIA-----------------------------
A0A6L6AM03      ----------------------VEAVVVVAQ-----------------------------
A0A4Q2RU39      ----------------------VDAVVVVAE-----------------------------
A0A4Q2SK58      ----------------------VDAVVVVAR-----------------------------
A0A2N3YJR1      ----------------------IKATAEEAN-----------------------------
A0A6G8FYB9      ----------------------IKATAEEAN-----------------------------
A0A4Q4D742      ----------------------ADAIVALVK-----------------------------
A0A1C6T1J1      ----------------------SAKFVDLVQ-----------------------------
A0A2W2CFC8      ----------------------SAKFVELVK-----------------------------
A0A2W2A4B0      ----------------------VRSFSSVVQ-----------------------------
A0A4Y9MDA5      ----------------------ATQLERAVL-----------------------------
A0A1H7N9P7      ----------------------AAELELAVE-----------------------------
A0A1M7V0F8      ----------------------ADQLERTVE-----------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      -----------EISP---------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      -----------NTLY---------------------------------------------
A0A4Q5B0V3      -----------NTLY---------------------------------------------
A0A022KX11      -----------VVST---------------------------------------------
A0A4Q5A868      -----------TTLY---------------------------------------------
A0A6N4VXX3      -----------QLET---------------------------------------------
A0A1H4I042      -----------ELET---------------------------------------------
A0A4R7A6D9      -----------ELET---------------------------------------------
A0A1Q2CRV2      -----------ELSP---------------------------------------------
A0A7K0NRJ7      -----------AQQT---------------------------------------------
K6WHS4          -----------VLEV---------------------------------------------
A0A1L2ZMQ6      -----------DIES---------------------------------------------
A0A3E2DN22      -----------RMET---------------------------------------------
A0A3Q9ULZ9      -----------RMET---------------------------------------------
A0A3S9JFL2      -----------RMET---------------------------------------------
A0A7K0NTR2      -----------ELGQ---------------------------------------------
A0A1H6WL79      -----------ELDK---------------------------------------------
A0A101LAM5      -----------ELDK---------------------------------------------
A0A4Y3NEG0      -----------ELDK---------------------------------------------
A0A1Q2CI19      -----------T-SP---------------------------------------------
A0A512T3M3      -----------G-TR---------------------------------------------
W6JTW4          -----------K-AS---------------------------------------------
A0A0A0JTY0      -----------EKPR---------------------------------------------
A0A0A0JXF2      -----------ETSP---------------------------------------------
E6S8H2          -----------K-NR---------------------------------------------
A0A0A0JGH0      -----------K-PR---------------------------------------------
N0E4U7          -----------K-GA---------------------------------------------
A0A0A0IYK2      -----------ERSR---------------------------------------------
A0A0Q9L0H3      -----------ERKR---------------------------------------------
A3TMK0          -----------QARR---------------------------------------------
A0A543PXP1      -----------Q-SR---------------------------------------------
A3TMH6          -----------T-PR---------------------------------------------
A0A6I2XCV4      -----------ELES---------------------------------------------
A0A5R8VLL6      -----------ERER---------------------------------------------
A0A3L7ADK2      -----------AIQG---------------------------------------------
A0A538JQF8      -----------DQTT---------------------------------------------
A0A1H6YPK1      -----------DVER---------------------------------------------
A0A0Q9TBP0      -----------DIES---------------------------------------------
A0A0G3V3M7      -----------ELGQ---------------------------------------------
A0A6I3DD56      -----------ELGQ---------------------------------------------
A0A5Q2FA83      -----------PLLN---------------------------------------------
A0A2R7MGI0      -----------DLET---------------------------------------------
A0A2T7WQY4      -----------ELET---------------------------------------------
A0A1G6GTN3      -----------QLET---------------------------------------------
A0A1N7DLV3      -----------QLES---------------------------------------------
A0A1V2NSB5      -----------QLES---------------------------------------------
A0A0Q5Q5L3      -----------ELES---------------------------------------------
A0A0Q6DVM4      -----------ELES---------------------------------------------
A0A1R3WWR6      -----------QLQS---------------------------------------------
A0A2S5WZJ5      -----------DVET---------------------------------------------
A0A0Q5JKD6      -----------QLET---------------------------------------------
A0A2W6DK08      -----------EVDN---------------------------------------------
A0A2S0LQ32      -----------SLEAIGSGQSPSPADAQPPAAGSDQPSTPSPADEQPAAPEPATPEPRQE
A0A2N6V1R5      -----------AITTLNA------------------------------------------
G9PHS6          -----------AITTLNA------------------------------------------
U1PLM7          -----------AITTLNA------------------------------------------
A0A346XTB0      -----------AQEV---------------------------------------------
A0A6I1G2U1      -----------YFAT---------------------------------------------
A0A351ETF8      -----------EFES---------------------------------------------
A0A542FTE6      -----------ELEV---------------------------------------------
A0A349B7N2      -----------ETTQ---------------------------------------------
A0A7J5B4S5      -----------DLES---------------------------------------------
A0A4Q2JUT1      -----------EVEV---------------------------------------------
A0A6L5R0V7      -----------EVEI---------------------------------------------
A0A2S5UYV0      -----------DLES---------------------------------------------
A0A2S5X9U6      -----------EIET---------------------------------------------
A0A2S5ULV5      -----------EIET---------------------------------------------
A0A653YMF0      -----------EIET---------------------------------------------
A0A3Q9IY80      -----------NLET---------------------------------------------
A0A0F0LP73      -----------RIEDAAG------------------------------------------
A0A346Y185      -----------EEAE---------------------------------------------
A0A4V1VGV9      -----------YLET---------------------------------------------
A0A7G8U6P0      -----------YLET---------------------------------------------
A0A259S8H9      -----------HIEQVAQ------------------------------------------
A0A2W1Z497      -----------AIQS---------------------------------------------
A0A0Q5L115      -----------AMQE---------------------------------------------
A0A7G6YY64      -----------AMQE---------------------------------------------
A0A1F1X071      -----------ELET---------------------------------------------
A0A3R8RWC7      -----------ELET---------------------------------------------
A0A4U0RJZ4      -----------HIET---------------------------------------------
A0A4R1FGL9      -----------HIET---------------------------------------------
E3B8H1          -----------HIET---------------------------------------------
A0A7D7WDT9      -----------EIEK---------------------------------------------
A0A0Q5AWK6      -----------DIET---------------------------------------------
A0A6P1F176      -----------DIET---------------------------------------------
A0A3N1NLD3      -----------DIET---------------------------------------------
A0A3N2FVI8      -----------DIET---------------------------------------------
A0A2S5XDQ6      -----------DIET---------------------------------------------
A0A2S5XNN6      -----------DIET---------------------------------------------
A0A3L8NYD3      -----------KLES---------------------------------------------
A0A1M6K628      -----------ELET---------------------------------------------
A0A561E8R3      -----------QIET---------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      -----------SLET---------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      -----------ELSP---------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      -----------SYQD---------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      -----------AVEN---------------------------------------------
A0A4Y5YMQ6      -----------DIAP---------------------------------------------
A0A1E4BP96      -----------DIEG---------------------------------------------
A0A151BT98      -----------QFSQ---------------------------------------------
A0A2Y8ZRF8      -----------QFSQ---------------------------------------------
A0A2R9UAT1      -----------GLES---------------------------------------------
A0A4Q5J5D7      -----------EIEN---------------------------------------------
A0A3S0V9U6      -----------EIDG---------------------------------------------
A0A1S2N0P2      -----------DLEG---------------------------------------------
A0A0Q3BEY5      -----------DLEG---------------------------------------------
A0A4R6Q3C6      -----------DLEG---------------------------------------------
A0A2X3GKL3      -----------DLEG---------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      -----------RLEK---------------------------------------------
A0A5Q5BFU2      -----------ELET---------------------------------------------
A0A439DNZ6      -----------ELET---------------------------------------------
A0A7I7UD03      -----------ELET---------------------------------------------
A0A7I7MI62      -----------ELET---------------------------------------------
A0A0J6YE86      -----------ELET---------------------------------------------
A0A7I7K1R9      -----------ELET---------------------------------------------
A0A7I9ZLK4      -----------DLET---------------------------------------------
A0A1F1IHY9      -----------EVEA---------------------------------------------
A0A7H2BCD6      -----------ELE----------------------------------------------
A0A542HCT5      -----------AVEN---------------------------------------------
A0A0Q5M6Z7      -----------ALEA---------------------------------------------
A0A7G6YA19      -----------ALES---------------------------------------------
A0A2S8WHZ8      -----------ELES---------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      -----------EIQK---------------------------------------------
A0A1Y4CTD2      -----------NYER---------------------------------------------
A0A3N3ZPU0      -----------RIES---------------------------------------------
A0A359IQX7      -----------RLES---------------------------------------------
A0A433EDP2      -----------NIEG---------------------------------------------
A0A231VTW0      -----------NIEG---------------------------------------------
A0A433ECD0      -----------NIEG---------------------------------------------
U7V3Z1          -----------NIEG---------------------------------------------
A0A1F1J417      -----------NIEK---------------------------------------------
A0A2A8D6P2      -----------NIEK---------------------------------------------
A0A1F0THV9      -----------NIEK---------------------------------------------
A0A5F0M6Y0      -----------NIEK---------------------------------------------
E3H5W1          -----------NIEK---------------------------------------------
A0A1F1QKB0      -----------NIEK---------------------------------------------
A0A509JY23      -----------NIEK---------------------------------------------
A0A448USF4      -----------NIEK---------------------------------------------
A0A0Q9LZR0      -----------AVEN---------------------------------------------
A0A1N7E3F1      -----------QIER---------------------------------------------
A0A544ZKQ1      -----------KIER---------------------------------------------
A0A372P1T1      -----------RIER---------------------------------------------
A0A5D0Q2X0      -----------RIER---------------------------------------------
A0A5R8Z2E7      -----------RIER---------------------------------------------
A0A1L2ZMV4      -----------RVER---------------------------------------------
A0A6I3F378      HSIAASGNDD-DSTR---------------------------------------------
A0A1S1CQC5      -----------EIEQ---------------------------------------------
A0A1E9T6I0      -----------EIEQ---------------------------------------------
A0A1F1GHA7      -----------EIEQ---------------------------------------------
A0A1S1CAD0      -----------EIEQ---------------------------------------------
G5ET14          -----------EIEQ---------------------------------------------
A0A1E9DXX2      -----------EIEQ---------------------------------------------
A0A1E8S156      -----------EIEQ---------------------------------------------
A0A1E8S5S2      -----------EIEQ---------------------------------------------
A0A1S1DFA8      -----------EIEQ---------------------------------------------
A0A2I1Z490      -----------EIEQ---------------------------------------------
A0A1F0DAA9      -----------EIEQ---------------------------------------------
A0A1F0PHK9      -----------EIEQ---------------------------------------------
A0A1F0VZG6      -----------EIEQ---------------------------------------------
A0A1E9G8X4      -----------EIEQ---------------------------------------------
A0A1E9IAW2      -----------EIEQ---------------------------------------------
A0A1E9ZBC9      -----------EIEQ---------------------------------------------
A0A1E9ZDP4      -----------EIEQ---------------------------------------------
A0A1F0R6B5      -----------EIEQ---------------------------------------------
A0A1F0Z7N5      -----------EIEQ---------------------------------------------
A0A1F1D897      -----------EIEQ---------------------------------------------
D2NP38          -----------EIEQ---------------------------------------------
A0A1F1FV74      -----------EIEQ---------------------------------------------
A0A1E9M791      -----------EIEQ---------------------------------------------
A0A291DEI8      -----------EIEQ---------------------------------------------
A0A1S1D5T1      -----------EIEQ---------------------------------------------
A0A1E8TRD6      -----------EIEQ---------------------------------------------
A0A1F0XT88      -----------EIEQ---------------------------------------------
A0A1F1EVP5      -----------EIEQ---------------------------------------------
C6R548          -----------EIEQ---------------------------------------------
A0A0K2RXS2      -----------EIEQ---------------------------------------------
A0A1F0KX60      -----------EIEQ---------------------------------------------
A0A542I3V2      -----------LLES---------------------------------------------
A0A2T0UZ65      -----------RLE----------------------------------------------
A0A1R4JTI6      -----------NIEN---------------------------------------------
A0A4R7TM52      -----------KLES---------------------------------------------
A0A542XE74      -----------RTQG---------------------------------------------
A0A0Q7QDF6      -----------SYQD---------------------------------------------
A0A5R8L819      -----------NLEG---------------------------------------------
A0A7K0PFV4      -----------GLPT---------------------------------------------
A0A0G3V3F3      AFDPQAASIQANIDA---------------------------------------------
A0A7K0MUQ7      ALDPQAASIQANIDA---------------------------------------------
A0A7K0U619      ALDPQAASIQANIDA---------------------------------------------
A0A6I3DFP2      ALDPQAASIQANIDA---------------------------------------------
A0A7K0SI36      ALDPQAASIQANIDA---------------------------------------------
A0A7K0V140      ALDPQAASIQANIDA---------------------------------------------
A0A261FQA1      -----------DDSF---------------------------------------------
A0A1Q2CJ92      -----------ALE----------------------------------------------
A0A2T0S3C8      -----------ALET---------------------------------------------
A0A4Y8WZJ3      -----------EVE----------------------------------------------
A0A285VUW0      -----------SYAP---------------------------------------------
A0A2R7Z032      -----------EIE----------------------------------------------
A0A6J4MTQ2      -----------AIQ----------------------------------------------
A0A1I0W453      -----------EIE----------------------------------------------
A0A1H4LCS9      -----------QVD----------------------------------------------
A0A4Q2RZP8      -----------QVE----------------------------------------------
A0A0Q6VV12      -----------EVD----------------------------------------------
A0A495NTA9      -----------EVD----------------------------------------------
A0A0Q9QB08      -----------QYE----------------------------------------------
A0A4Q2SA86      -----------EVE----------------------------------------------
A0A4Z1C3Z0      -----------EVE----------------------------------------------
A0A6V8KDX4      -----------VLET---------------------------------------------
A0A444BL03      -----------RIET---------------------------------------------
A0A4Y8X357      -----------GLD----------------------------------------------
R4LD52          -----------SLE----------------------------------------------
A0A4T2CD79      -----------TLEN---------------------------------------------
A0A6L6AM03      -----------QIE----------------------------------------------
A0A4Q2RU39      -----------DVD----------------------------------------------
A0A4Q2SK58      -----------DID----------------------------------------------
A0A2N3YJR1      -----------RIE----------------------------------------------
A0A6G8FYB9      -----------AIE----------------------------------------------
A0A4Q4D742      -----------RLER---------------------------------------------
A0A1C6T1J1      -----------KVE----------------------------------------------
A0A2W2CFC8      -----------QVE----------------------------------------------
A0A2W2A4B0      -----------DRL----------------------------------------------
A0A4Y9MDA5      -----------DLS----------------------------------------------
A0A1H7N9P7      -----------GLS----------------------------------------------
A0A1M7V0F8      -----------QLS----------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A7K0NRJ7      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A7K0NTR2      --------------NEYYERIFTLTVSRNNAETLLREIDLKMATPLLSASEYDSLGIRRE
A0A1H6WL79      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A0A4Y3NEG0      ------------------------------------------------------------
A0A1Q2CI19      ------------------------------------------------------------
A0A512T3M3      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A543PXP1      ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A6I2XCV4      -------------------------------------------QIARNPSQATLLRAELD
A0A5R8VLL6      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A538JQF8      QRRQLQIDSQLKAAEQIQGQINDINLQIARAPDAGTVAALQARRQPLQVRVDRAMNQVDI
A0A1H6YPK1      ------------------------------------------------------------
A0A0Q9TBP0      --------------------------------------------------RLSEVNALLE
A0A0G3V3M7      --------------KQYDEQIFGLTISRGNSETLISKIDSQLAAPGLSASEYDSLDIRRE
A0A6I3DD56      --------------KQFDEQIFGLTLSRSNSETLIRQIDSQLAAPGLSASEYDSLDIRRE
A0A5Q2FA83      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A2W6DK08      -----------------------------------QLKQVTGFTGAVSTPVNPVLQARAA
A0A2S0LQ32      EPRGGNQDEGANPGTGERRSTPGRGNGTGEEKEDAAADAQARVVPAVAGTGASLVPAVAG
A0A2N6V1R5      -------------------------------------------------------PTVQP
G9PHS6          -------------------------------------------------------PTVQP
U1PLM7          -------------------------------------------------------PTVQP
A0A346XTB0      ------------------------------------------------------------
A0A6I1G2U1      ------------------------------------------------------------
A0A351ETF8      ------------------------------------------------------------
A0A542FTE6      ------------------------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A7J5B4S5      ------------------------------------------------------------
A0A4Q2JUT1      ------------------------------------------------------------
A0A6L5R0V7      ------------------------------------------------------------
A0A2S5UYV0      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A653YMF0      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A346Y185      ------------------------------------------------------------
A0A4V1VGV9      ------------------------------------------------------------
A0A7G8U6P0      ------------------------------------------------------------
A0A259S8H9      ------------------------------------------------------------
A0A2W1Z497      ------------------------------------------------------------
A0A0Q5L115      ------------------------------------------------------------
A0A7G6YY64      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
A0A4U0RJZ4      ------------------------------------------------------------
A0A4R1FGL9      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A7D7WDT9      ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A6P1F176      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A4R6Q3C6      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A7I7UD03      ------------------------------------------------------------
A0A7I7MI62      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      ------------------------------------------------------------
A0A7I9ZLK4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A7H2BCD6      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A7G6YA19      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ------------------------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A7K0PFV4      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A7K0MUQ7      ------------------------------------------------------------
A0A7K0U619      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A6J4MTQ2      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A4Q2SA86      ------------------------------------------------------------
A0A4Z1C3Z0      ------------------------------------------------------------
A0A6V8KDX4      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A4T2CD79      ------------------------------------------------------------
A0A6L6AM03      ------------------------------------------------------------
A0A4Q2RU39      ------------------------------------------------------------
A0A4Q2SK58      ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A6G8FYB9      ------------------------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------SSANGSSRISAN------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------ASGSHSSVKLS-------------------------------
A0A4Q5B0V3      ------------------ASGSHSSVKLS-------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------ASGSHSSVKLS-------------------------------
A0A6N4VXX3      ------------------SGDGNLPDTRV-------------------------------
A0A1H4I042      ------------------PGDGSLPDTRV-------------------------------
A0A4R7A6D9      ------------------PGDGSLPDTRV-------------------------------
A0A1Q2CRV2      ------------------PGADGQKPVVAT------------------------------
A0A7K0NRJ7      ----------------ASLAQDIAPIQAQR------------------------------
K6WHS4          ------------------PSAGGDPLA---------------------------------
A0A1L2ZMQ6      ------------TGVDGVDKDFQPAVE---------------------------------
A0A3E2DN22      -----YGQIAASDHKSDAQLAKMTSVH---------------------------------
A0A3Q9ULZ9      -----YTQAQANPGYTQAQLEKLTAIH---------------------------------
A0A3S9JFL2      -----YSQAQANPGYSQAQLEKLTAIH---------------------------------
A0A7K0NTR2      ATLRKLANSDYEISDIQEAGPQTSGLV---------------------------------
A0A1H6WL79      ----------------GNASPGTEPVTK--------------------------------
A0A101LAM5      ----------------GNASPGTEPVTK--------------------------------
A0A4Y3NEG0      ----------------GNASPGTEPVTK--------------------------------
A0A1Q2CI19      ------------------PGAETTRLS---------------------------------
A0A512T3M3      ------------------PEAAGTRLS---------------------------------
W6JTW4          ------------------P-SGGTRLT---------------------------------
A0A0A0JTY0      ------------------AGVENARLE---------------------------------
A0A0A0JXF2      ------------------PGAENTTLT---------------------------------
E6S8H2          ------------------PGVGRANVS---------------------------------
A0A0A0JGH0      ------------------PGVGRAVVT---------------------------------
N0E4U7          ------------------PGTGGAAVS---------------------------------
A0A0A0IYK2      ------------------PGAENVAVS---------------------------------
A0A0Q9L0H3      ------------------PGAETTTLS---------------------------------
A3TMK0          ------------------PGAENATLS---------------------------------
A0A543PXP1      ------------------PGTGNATVT---------------------------------
A3TMH6          ------------------PGTGTVGIT---------------------------------
A0A6I2XCV4      SVINQYRLAREQFQSIAVSDQTVAAFT---------------------------------
A0A5R8VLL6      ----------------AAAAAGQPAAPAGQPAPVVTPPIS--------------------
A0A3L7ADK2      ----------------NDGVIGAQNTK---------------------------------
A0A538JQF8      IQNRPDPLPALLTLESGSIRGGRTDLS---------------------------------
A0A1H6YPK1      -------------TSRGISNPERTVIN---------------------------------
A0A0Q9TBP0      KNPGGQALQGERRTLIASSAQVAAQID---------------------------------
A0A0G3V3M7      AVLRKLANADSDLSNLQEIGPQTSGLT---------------------------------
A0A6I3DD56      AVLRKLANADSGISNLEDAGPQTSGLT---------------------------------
A0A5Q2FA83      --------------------SAGQGVK---------------------------------
A0A2R7MGI0      ------------------GGTGQGAVR---------------------------------
A0A2T7WQY4      ------------------GGSGQGAVR---------------------------------
A0A1G6GTN3      ------------------GAGGRSAVR---------------------------------
A0A1N7DLV3      ------------------TGGGHGAVK---------------------------------
A0A1V2NSB5      ------------------TGGAHSAVK---------------------------------
A0A0Q5Q5L3      ------------------GGSGQGAVR---------------------------------
A0A0Q6DVM4      ------------------GGSGQGAVR---------------------------------
A0A1R3WWR6      ------------------GGNGESAVR---------------------------------
A0A2S5WZJ5      -----------------QVGGGVSNVT---------------------------------
A0A0Q5JKD6      ------------------GGGGQSAVR---------------------------------
A0A2W6DK08      ALSARYAAIYGLLQETANQANNPTGLD---------------------------------
A0A2S0LQ32      APQAAVGQAGVGQAGQAAPAAPATAAPTDETYNSQTR-----------------------
A0A2N6V1R5      TTKTTTNPDGTQVTTTTQSVDGTTNVTTTDNSYRETR-----------------------
G9PHS6          TTKTTTNPDGTQVTTTTQSVDGTTNVTTTDNSYRETR-----------------------
U1PLM7          TTKTTTNPDGTQVTTTTQSVDGTTNVTTTDNSYRETR-----------------------
A0A346XTB0      ----------------QRAEDAVAELRAQQVRLEEERSGLQSSLEADSSNVALPFLIQSL
A0A6I1G2U1      ----------------PRDGTGEAELS---------------------------------
A0A351ETF8      ----------------VARFLDSPDVS---------------------------------
A0A542FTE6      ----------------PEGTIRTQATS---------------------------------
A0A349B7N2      ----------------QERAEAQTRLSARLDELEARLADLDAQIEDGAGDLVQAQRDALV
A0A7J5B4S5      -----------------QAGGGVSSVT---------------------------------
A0A4Q2JUT1      ----------------ESSPTGAAPVQ---------------------------------
A0A6L5R0V7      ----------------ESSPTGAAPVQ---------------------------------
A0A2S5UYV0      -----------------QAGGGVSSVT---------------------------------
A0A2S5X9U6      -----------------QVGGGASGVT---------------------------------
A0A2S5ULV5      -----------------QVGGGTSGVT---------------------------------
A0A653YMF0      -----------------QVGGGASGVT---------------------------------
A0A3Q9IY80      -----------------SGGVSLATVQ---------------------------------
A0A0F0LP73      --AGATPPP-------GSTVVPTEGIV---------------------------------
A0A346Y185      ----------------RSTQASLSELQTQRAALEDAIAAAEARLAASPTDASARAERDAA
A0A4V1VGV9      ----------------VGTEAKTSVYR---------------------------------
A0A7G8U6P0      ----------------VGTEAKTSVYR---------------------------------
A0A259S8H9      --SAAPVDPSLPPEPKSATNAAPGGIA---------------------------------
A0A2W1Z497      ----------------SGEALASATTK---------------------------------
A0A0Q5L115      ----------------ESTDTGGSATS---------------------------------
A0A7G6YY64      ----------------ESTDTGGSATS---------------------------------
A0A1F1X071      ----------------GGNENAAVGVQ---------------------------------
A0A3R8RWC7      ----------------GGNENAAVGVQ---------------------------------
A0A4U0RJZ4      ----------------LNGA-KSTVYD---------------------------------
A0A4R1FGL9      ----------------LNGA-KSTVYD---------------------------------
E3B8H1          ----------------LNGA-KSTVYD---------------------------------
A0A7D7WDT9      ----------------AAGAVNAGGFT---------------------------------
A0A0Q5AWK6      ----------------QSTADRTPQIT---------------------------------
A0A6P1F176      ----------------QSTADRTPGIT---------------------------------
A0A3N1NLD3      ----------------QSTADRTPQIT---------------------------------
A0A3N2FVI8      ----------------QSTADRTPQIT---------------------------------
A0A2S5XDQ6      ----------------QSTADRTPQIT---------------------------------
A0A2S5XNN6      ----------------QSTADRTPQIT---------------------------------
A0A3L8NYD3      -------------AARPSGAPVSTLVK---------------------------------
A0A1M6K628      ----------MTVTGEPTD-QLV--VK---------------------------------
A0A561E8R3      -------------TGEPAGTQPS--VR---------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      ------------------PAGGGSP-----------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------KRDGQDTVK---------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      ------------------RAAERAGED---------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      ------------------PNGKNEA-----------------------------------
A0A4Y5YMQ6      ------------------KDDRGESTV---------------------------------
A0A1E4BP96      ------------------TGVAGSA-----------------------------------
A0A151BT98      ------------------LLSGAGSVT---------------------------------
A0A2Y8ZRF8      ------------------LLSGAGSVT---------------------------------
A0A2R9UAT1      ------------------DGGKVQA-----------------------------------
A0A4Q5J5D7      ------------------PRGEAGA-----------------------------------
A0A3S0V9U6      ------------------SRS---------------------------------------
A0A1S2N0P2      ------------------RES---------------------------------------
A0A0Q3BEY5      ------------------RES---------------------------------------
A0A4R6Q3C6      ------------------RES---------------------------------------
A0A2X3GKL3      ------------------RES---------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------PTSGN-------------------------------------
A0A5Q5BFU2      ------------------PEDGSSP-----------------------------------
A0A439DNZ6      ------------------PPDGTRP-----------------------------------
A0A7I7UD03      ------------------PEDGSTP-----------------------------------
A0A7I7MI62      ------------------PENGARP-----------------------------------
A0A0J6YE86      ------------------PENSTRA-----------------------------------
A0A7I7K1R9      ------------------PDSGARP-----------------------------------
A0A7I9ZLK4      ------------------PGDGARP-----------------------------------
A0A1F1IHY9      ------------------GG----------------------------------------
A0A7H2BCD6      ------------------------------------------------------------
A0A542HCT5      ------------------PTGKSEQ-----------------------------------
A0A0Q5M6Z7      ------------------PEG---------------------------------------
A0A7G6YA19      ------------------PEG---------------------------------------
A0A2S8WHZ8      ------------------VSVGG-------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      ------------------AGGASDT-----------------------------------
A0A1Y4CTD2      ------------------VSGYVFS-----------------------------------
A0A3N3ZPU0      ------------------IATEGNN-----------------------------------
A0A359IQX7      ------------------LTTTG-------------------------------------
A0A433EDP2      ------------------NNGGSGNAA---------------------------------
A0A231VTW0      ------------------NNGGSGNAA---------------------------------
A0A433ECD0      ------------------NNGGSGNAA---------------------------------
U7V3Z1          ------------------NNGGSGNAA---------------------------------
A0A1F1J417      ------------------NGSGNNSTA---------------------------------
A0A2A8D6P2      ------------------NGSGNNSTA---------------------------------
A0A1F0THV9      ------------------NGSGNNSTA---------------------------------
A0A5F0M6Y0      ------------------NGSGNNSTA---------------------------------
E3H5W1          ------------------NGSGNNSTA---------------------------------
A0A1F1QKB0      ------------------NGSGNNNTA---------------------------------
A0A509JY23      ------------------NGSGNNSTA---------------------------------
A0A448USF4      ------------------NGSGNNSTA---------------------------------
A0A0Q9LZR0      ------------------PTGKAAQ-----------------------------------
A0A1N7E3F1      ------------------PT----------------------------------------
A0A544ZKQ1      ------------------PT----------------------------------------
A0A372P1T1      ------------------PT----------------------------------------
A0A5D0Q2X0      ------------------PT----------------------------------------
A0A5R8Z2E7      ------------------PT----------------------------------------
A0A1L2ZMV4      ------------------VMATGGTDS---------------------------------
A0A6I3F378      ------------------EAQRRELLA---------------------------------
A0A1S1CQC5      ------------------NPGNAQALV---------------------------------
A0A1E9T6I0      ------------------NPGNAQALV---------------------------------
A0A1F1GHA7      ------------------NPGNAQALV---------------------------------
A0A1S1CAD0      ------------------NPGNAQALV---------------------------------
G5ET14          ------------------NPGNAQALV---------------------------------
A0A1E9DXX2      ------------------NPGNAQALV---------------------------------
A0A1E8S156      ------------------NPGNAQALV---------------------------------
A0A1E8S5S2      ------------------NPGNAQALV---------------------------------
A0A1S1DFA8      ------------------NPGNAQALV---------------------------------
A0A2I1Z490      ------------------NPSNAQALV---------------------------------
A0A1F0DAA9      ------------------NPGNAQALV---------------------------------
A0A1F0PHK9      ------------------NPGNAQALV---------------------------------
A0A1F0VZG6      ------------------NPGNAQALV---------------------------------
A0A1E9G8X4      ------------------NPGNAQALV---------------------------------
A0A1E9IAW2      ------------------NPGNAQALV---------------------------------
A0A1E9ZBC9      ------------------NPGNAQALV---------------------------------
A0A1E9ZDP4      ------------------NPGNAQALV---------------------------------
A0A1F0R6B5      ------------------NPGNAQALV---------------------------------
A0A1F0Z7N5      ------------------NPGNAQALV---------------------------------
A0A1F1D897      ------------------NPGNAQALV---------------------------------
D2NP38          ------------------NPGNAQALV---------------------------------
A0A1F1FV74      ------------------NPGNAQALV---------------------------------
A0A1E9M791      ------------------NPGNAQALV---------------------------------
A0A291DEI8      ------------------NPGNAQALV---------------------------------
A0A1S1D5T1      ------------------NPSNAQALV---------------------------------
A0A1E8TRD6      ------------------NPGNAQALV---------------------------------
A0A1F0XT88      ------------------NPGNAQALV---------------------------------
A0A1F1EVP5      ------------------NPGNAQALV---------------------------------
C6R548          ------------------NPGNAQALV---------------------------------
A0A0K2RXS2      ------------------NPGNAQALV---------------------------------
A0A1F0KX60      ------------------NPGNAQALV---------------------------------
A0A542I3V2      ------------------FVTAGQP-----------------------------------
A0A2T0UZ65      ------------------LGGGEVK-----------------------------------
A0A1R4JTI6      ------------------QTLPGVE-----------------------------------
A0A4R7TM52      ------------------ASGGEA------------------------------------
A0A542XE74      ------------------RETSEEQ-----------------------------------
A0A0Q7QDF6      ------------------RAAERAG-----------------------------------
A0A5R8L819      ------------------GSSGGGE-----------------------------------
A0A7K0PFV4      ------------------IRRQLRV-----------------------------------
A0A0G3V3F3      ------------------LNKVEAE-----------------------------------
A0A7K0MUQ7      ------------------LNQVEAE-----------------------------------
A0A7K0U619      ------------------LNQVEAE-----------------------------------
A0A6I3DFP2      ------------------LNQVEAE-----------------------------------
A0A7K0SI36      ------------------LNQVEAE-----------------------------------
A0A7K0V140      ------------------LNQVEAE-----------------------------------
A0A261FQA1      ------------------ASNETGL-----------------------------------
A0A1Q2CJ92      ------------------TLTITGE-----------------------------------
A0A2T0S3C8      ------------------PRDRTAS-----------------------------------
A0A4Y8WZJ3      ------------------AGGIAGQ-----------------------------------
A0A285VUW0      ------------------TLAQSGA-----------------------------------
A0A2R7Z032      ------------------NTGRPAG-----------------------------------
A0A6J4MTQ2      ------------------STGQPAG-----------------------------------
A0A1I0W453      ------------------TGEENPK-----------------------------------
A0A1H4LCS9      ------------------NGGTTPK-----------------------------------
A0A4Q2RZP8      ------------------NGGTTPK-----------------------------------
A0A0Q6VV12      ------------------TGESNPR-----------------------------------
A0A495NTA9      ------------------TGEANPK-----------------------------------
A0A0Q9QB08      ------------------TGEENPR-----------------------------------
A0A4Q2SA86      ------------------TGEESPR-----------------------------------
A0A4Z1C3Z0      ------------------TGEENPR-----------------------------------
A0A6V8KDX4      ------------------PPGQSTA-----------------------------------
A0A444BL03      ------------------TGSNAK------------------------------------
A0A4Y8X357      ------------------PAS---------------------------------------
R4LD52          ------------------TPPGKQV-----------------------------------
A0A4T2CD79      ------------------KAVTQQA-----------------------------------
A0A6L6AM03      ------------------TGEENPR-----------------------------------
A0A4Q2RU39      ------------------GAN---------------------------------------
A0A4Q2SK58      ------------------GGT---------------------------------------
A0A2N3YJR1      ------------------TAGSGRG-----------------------------------
A0A6G8FYB9      ------------------TAADPSA-----------------------------------
A0A4Q4D742      ------------------PATSGQA-----------------------------------
A0A1C6T1J1      ------------------TPPSGEP-----------------------------------
A0A2W2CFC8      ------------------TRPDGSA-----------------------------------
A0A2W2A4B0      ------------------DANASGV-----------------------------------
A0A4Y9MDA5      ------------------PVGEDGS-----------------------------------
A0A1H7N9P7      ------------------PAGEDGS-----------------------------------
A0A1M7V0F8      ------------------PAGEDGS-----------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A7K0NRJ7      ------------------------VILQKQLSNLPAFDPQAASIQANIDALNKVEAERRA
K6WHS4          ------------------------KL----------------------------------
A0A1L2ZMQ6      ------------------------LM----------------------------------
A0A3E2DN22      ------------------------VL----------------------------------
A0A3Q9ULZ9      ------------------------VL----------------------------------
A0A3S9JFL2      ------------------------VL----------------------------------
A0A7K0NTR2      ------------------------TL----------------------------------
A0A1H6WL79      ------------------------IV----------------------------------
A0A101LAM5      ------------------------IV----------------------------------
A0A4Y3NEG0      ------------------------IV----------------------------------
A0A1Q2CI19      ------------------------VL----------------------------------
A0A512T3M3      ------------------------IL----------------------------------
W6JTW4          ------------------------IV----------------------------------
A0A0A0JTY0      ------------------------VL----------------------------------
A0A0A0JXF2      ------------------------IL----------------------------------
E6S8H2          ------------------------IL----------------------------------
A0A0A0JGH0      ------------------------IL----------------------------------
N0E4U7          ------------------------VL----------------------------------
A0A0A0IYK2      ------------------------IL----------------------------------
A0A0Q9L0H3      ------------------------LL----------------------------------
A3TMK0          ------------------------VL----------------------------------
A0A543PXP1      ------------------------IL----------------------------------
A3TMH6          ------------------------VL----------------------------------
A0A6I2XCV4      ------------------------VFQPAIAVQINGRAFAIRYDAN--------------
A0A5R8VLL6      ------------------------LV----------------------------------
A0A3L7ADK2      ------------------------FV----------------------------------
A0A538JQF8      ------------------------------------------------------------
A0A1H6YPK1      ------------------------VM----------------------------------
A0A0Q9TBP0      ------------------------AL-----------------------------TDSLT
A0A0G3V3M7      ------------------------TL----------------------------------
A0A6I3DD56      ------------------------TL----------------------------------
A0A5Q2FA83      ------------------------AT----------------------------------
A0A2R7MGI0      ------------------------LI----------------------------------
A0A2T7WQY4      ------------------------LI----------------------------------
A0A1G6GTN3      ------------------------LV----------------------------------
A0A1N7DLV3      ------------------------LV----------------------------------
A0A1V2NSB5      ------------------------LV----------------------------------
A0A0Q5Q5L3      ------------------------LV----------------------------------
A0A0Q6DVM4      ------------------------LV----------------------------------
A0A1R3WWR6      ------------------------LI----------------------------------
A0A2S5WZJ5      ------------------------VI----------------------------------
A0A0Q5JKD6      ------------------------LV----------------------------------
A0A2W6DK08      ------------------------TL----------------------------------
A0A2S0LQ32      ------------------------LV----------------------------------
A0A2N6V1R5      ------------------------VT----------------------------------
G9PHS6          ------------------------VT----------------------------------
U1PLM7          ------------------------VT----------------------------------
A0A346XTB0      DARILDISGRIDATLLAVRLRGDGVE----------------------------------
A0A6I1G2U1      ------------------------IL----------------------------------
A0A351ETF8      ------------------------AQ----------------------------------
A0A542FTE6      ------------------------FV----------------------------------
A0A349B7N2      REYGIVYEDFQVLSREPEATVGLRTLQPAVAVPISGDAFVAALQETLGATDPSEPTAIED
A0A7J5B4S5      ------------------------VL----------------------------------
A0A4Q2JUT1      ------------------------VV----------------------------------
A0A6L5R0V7      ------------------------VV----------------------------------
A0A2S5UYV0      ------------------------VL----------------------------------
A0A2S5X9U6      ------------------------VV----------------------------------
A0A2S5ULV5      ------------------------VV----------------------------------
A0A653YMF0      ------------------------VV----------------------------------
A0A3Q9IY80      ------------------------LV----------------------------------
A0A0F0LP73      ------------------------IV----------------------------------
A0A346Y185      VSQLIMIDSRADQIAVDSTLFGSGVE----------------------------------
A0A4V1VGV9      ------------------------VF----------------------------------
A0A7G8U6P0      ------------------------VF----------------------------------
A0A259S8H9      ------------------------IV----------------------------------
A0A2W1Z497      ------------------------LV----------------------------------
A0A0Q5L115      ------------------------FV----------------------------------
A0A7G6YY64      ------------------------FV----------------------------------
A0A1F1X071      ------------------------LT----------------------------------
A0A3R8RWC7      ------------------------LT----------------------------------
A0A4U0RJZ4      ------------------------AY----------------------------------
A0A4R1FGL9      ------------------------AY----------------------------------
E3B8H1          ------------------------AY----------------------------------
A0A7D7WDT9      ------------------------IV----------------------------------
A0A0Q5AWK6      ------------------------VV----------------------------------
A0A6P1F176      ------------------------VV----------------------------------
A0A3N1NLD3      ------------------------VV----------------------------------
A0A3N2FVI8      ------------------------VV----------------------------------
A0A2S5XDQ6      ------------------------VV----------------------------------
A0A2S5XNN6      ------------------------VV----------------------------------
A0A3L8NYD3      ------------------------LV----------------------------------
A0A1M6K628      ------------------------IA----------------------------------
A0A561E8R3      ------------------------IY----------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A222TG79      ----------------------------------------------------------MA
A0A0W8I9Y2      ------------------------------------------------------------
A0A7C6LSF9      ------------------------------------------------------------
A0A255G8R8      ------------------------AT----------------------------------
A0A6G7Y423      ------------------------------------------------------------
A0A4Q4D4T1      -----------------------------------------------------APDLPTL
A0A261FE22      -----------------------------------------------------SDGSSGI
A0A5C8C085      ----------------------------------------------------------PI
A0A4Y5YMQ6      ------------------------GA----------------------------------
A0A1E4BP96      ----------------------------------------------------------PV
A0A151BT98      ------------------------ST----------------------------------
A0A2Y8ZRF8      ------------------------ST----------------------------------
A0A2R9UAT1      ----------------------------------------------------------AV
A0A4Q5J5D7      -----------------------------------------------------------L
A0A3S0V9U6      -----------------------------------------------------------V
A0A1S2N0P2      ----------------------------------------------------------AV
A0A0Q3BEY5      ----------------------------------------------------------AV
A0A4R6Q3C6      ----------------------------------------------------------AV
A0A2X3GKL3      ----------------------------------------------------------AV
A0A1Y4CKD6      ------------------------------------------------------FVLGNI
A0A0Q7KBQ4      -----------------------------------------------------GSPAFVA
A0A5Q5BFU2      ----------------------------------------------------------DA
A0A439DNZ6      ----------------------------------------------------------DA
A0A7I7UD03      ----------------------------------------------------------DS
A0A7I7MI62      ----------------------------------------------------------DA
A0A0J6YE86      ----------------------------------------------------------DS
A0A7I7K1R9      ----------------------------------------------------------DS
A0A7I9ZLK4      ----------------------------------------------------------DA
A0A1F1IHY9      -----------------------------------------------------IAGQSII
A0A7H2BCD6      -------------------------------------------------------GGNTV
A0A542HCT5      ----------------------------------------------------------AL
A0A0Q5M6Z7      -----------------------------------------------------AIAEPAI
A0A7G6YA19      -----------------------------------------------------SVGDPAI
A0A2S8WHZ8      -----------------------------------------------------SDRATAV
A0A537WNY9      ---------------------------------------------------SGEVGVPTL
A0A5B8M469      ---------------------------------------------------------PHL
A0A1Y4CTD2      -----------------------------------------------------NATLQLV
A0A3N3ZPU0      --------------------------------YEPPSPSPSEDGGEEASPESSEDGTGLV
A0A359IQX7      -----------------------------------------------------TPGQSVV
A0A433EDP2      ------------------------NSNGGNNATPNAENGNTAGANASANTAVSGNAANNI
A0A231VTW0      ------------------------NSNGGNNATPNTENGNTAGASASANTAVSGNAANNI
A0A433ECD0      ------------------------NSNGGNNATPNTENGNTAGASASANTAVSGNAANNI
U7V3Z1          ------------------------NSNGGNNATPNTENGNTAGASASANTAVSGNAANNI
A0A1F1J417      ------------------------TP------TPAGEENQESAQNKVSSTNPSDTTNTLI
A0A2A8D6P2      ------------------------TP------TPAGEENQESAQNKVSSTNPSDTTNTLI
A0A1F0THV9      ------------------------TP------TPAGEENQESAQNKVSSTNPSDTTNTLI
A0A5F0M6Y0      ------------------------TP------TPAGEENQESAQNKVSSTNPSDTTNTLI
E3H5W1          ------------------------TP------TPAGEENQESAQNKVSSTNPSDTTNTLI
A0A1F1QKB0      ------------------------TP------APAGEENQESAQNKVSSTNPSDTTNTLI
A0A509JY23      ------------------------TP------TPAGEENQESAQNKVSSTNPSDTTNTLI
A0A448USF4      ------------------------TP------TPAGEENQESAQNKVSSTNPSDTTNTLI
A0A0Q9LZR0      ----------------------------------------------------------AL
A0A1N7E3F1      -----------------------------------------------------PKSPPTI
A0A544ZKQ1      -----------------------------------------------------PKSPPTI
A0A372P1T1      -----------------------------------------------------PKSPPTI
A0A5D0Q2X0      -----------------------------------------------------PKSPPTI
A0A5R8Z2E7      -----------------------------------------------------PKSPPTI
A0A1L2ZMV4      -----------------------------------------------------TSSVPVV
A0A6I3F378      ------------------------QQ-------------------ADFRHTLEQQQIDAR
A0A1S1CQC5      ------------------------NG-------------------DSNAAATPSASSNTV
A0A1E9T6I0      ------------------------NG-------------------DSNAAATPPANSNTV
A0A1F1GHA7      ------------------------NG-------------------DSNAAATPPANSNTV
A0A1S1CAD0      ------------------------NG-------------------DSTAAS--PTGGNTV
G5ET14          ------------------------NG-------------------DSTAAS--PTGGNTV
A0A1E9DXX2      ------------------------NG-------------------DNAVVS--PTGGNTV
A0A1E8S156      ------------------------NG-------------------ENTGAT--PTGGNTV
A0A1E8S5S2      ------------------------NG-------------------ENTGAT--PTGGNTV
A0A1S1DFA8      ------------------------NG-------------------ENTGAT--PTGGNTV
A0A2I1Z490      ------------------------NG-------------------ENTGAT--PTGGNTV
A0A1F0DAA9      ------------------------NG-------------------ENTGAS--PTGGNTV
A0A1F0PHK9      ------------------------NG-------------------ENTGAS--PTGGNTV
A0A1F0VZG6      ------------------------NG-------------------ENTGAS--PTGGNTV
A0A1E9G8X4      ------------------------NG-------------------ENTGAS--PTGGNTV
A0A1E9IAW2      ------------------------NG-------------------ENTGAS--PTGGNTV
A0A1E9ZBC9      ------------------------NG-------------------ENTGAS--PTGGNTV
A0A1E9ZDP4      ------------------------NG-------------------ENTGAS--PTGGNTV
A0A1F0R6B5      ------------------------NG-------------------ENTGAS--PTGGNTV
A0A1F0Z7N5      ------------------------NG-------------------ENTGAS--PTGGNTV
A0A1F1D897      ------------------------NG-------------------ENTGAS--PTGGNTV
D2NP38          ------------------------NG-------------------ENTGAS--PTGGNTV
A0A1F1FV74      ------------------------NG-------------------ENTAAS--PTTNNTV
A0A1E9M791      ------------------------NG-------------------ENTAAS--PTTNNTV
A0A291DEI8      ------------------------NG-------------------ENTAAS--PTTNNTV
A0A1S1D5T1      ------------------------NG-------------------ENTGAT--PTGGNTV
A0A1E8TRD6      ------------------------NG-------------------ENTGAS--PTTSNTV
A0A1F0XT88      ------------------------NG-------------------ENTGAS--PTTSNTV
A0A1F1EVP5      ------------------------NG-------------------ENTGAS--PTTSNTV
C6R548          ------------------------NG-------------------ENTGAS--PTTNNTV
A0A0K2RXS2      ------------------------NG-------------------ENTAAS--PTTNNTV
A0A1F0KX60      ------------------------NG-------------------ENAAAS--PTTNNTV
A0A542I3V2      -----------------------------------------------------TPPALPV
A0A2T0UZ65      -----------------------------------------------------PGTQALV
A0A1R4JTI6      -----------------------------------------------------QSEESSA
A0A4R7TM52      ----------------------------------------------------------LV
A0A542XE74      -----------------------------------------------------MRGMTSI
A0A0Q7QDF6      -----------------------------------------------------EDAPDLP
A0A5R8L819      ----------------------------------------------------------VV
A0A7K0PFV4      -----------------------------------------------------WRDQGDP
A0A0G3V3F3      -----------------------------------------------------RRAQPAN
A0A7K0MUQ7      -----------------------------------------------------RRAQPAN
A0A7K0U619      -----------------------------------------------------RRAQPAN
A0A6I3DFP2      -----------------------------------------------------RRAQPAN
A0A7K0SI36      -----------------------------------------------------RRAQPAN
A0A7K0V140      -----------------------------------------------------RRAQPAN
A0A261FQA1      -----------------------------------------------------FN---GL
A0A1Q2CJ92      -----------------------------------------------------SSGQTVV
A0A2T0S3C8      ----------------------------------------------------------PI
A0A4Y8WZJ3      -----------------------------------------------------S----II
A0A285VUW0      ----------------------------------------------------------SV
A0A2R7Z032      -----------------------------------------------------NKAETLV
A0A6J4MTQ2      -----------------------------------------------------GQAVSLV
A0A1I0W453      -----------------------------------------------------EP--ALT
A0A1H4LCS9      -----------------------------------------------------GD--SLA
A0A4Q2RZP8      -----------------------------------------------------GD--PLA
A0A0Q6VV12      -----------------------------------------------------RD--PLT
A0A495NTA9      -----------------------------------------------------TD--PLT
A0A0Q9QB08      -----------------------------------------------------GP--SLT
A0A4Q2SA86      -----------------------------------------------------EA--PLT
A0A4Z1C3Z0      -----------------------------------------------------GD--PLT
A0A6V8KDX4      ----------------------------------------------------------TV
A0A444BL03      ----------------------------------------------------------NI
A0A4Y8X357      ----------------------------------------------------------NV
R4LD52          -----------------------------------------------------S----SV
A0A4T2CD79      -----------------------------------------------------GN--TVV
A0A6L6AM03      -----------------------------------------------------EE--PLT
A0A4Q2RU39      ----------------------------------------------------------LA
A0A4Q2SK58      ----------------------------------------------------------LT
A0A2N3YJR1      -----------------------------------------------------A----AS
A0A6G8FYB9      -----------------------------------------------------K----PI
A0A4Q4D742      -----------------------------------------------------A----AV
A0A1C6T1J1      -----------------------------------------------------G----PI
A0A2W2CFC8      -----------------------------------------------------G----PI
A0A2W2A4B0      ----------------------------------------------------------GV
A0A4Y9MDA5      -----------------------------------------------------P----SV
A0A1H7N9P7      -----------------------------------------------------P----AV
A0A1M7V0F8      -----------------------------------------------------R----AV
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      -------------PSPAAPVREPGPT---------------------PATGAVDGADEHL
A0A348NU28      -------LVDEA-VVPNVQAL-PNKP---------------RDALLGAVVGLLLGVLAAL
A0A2N4T4Q5      ------------------------------------------------------------
A0A4Q5APW3      -------VVQPA-AVPSSPSS-PKWK---------------LNILVGIVGGLILGVFAAL
A0A4Q5B0V3      -------VVQPA-AVPSSPSS-PKWK---------------LNILVGIVGGLILGVFAAL
A0A022KX11      -------PIQPA-SAPAQPVS-PNPT---------------RNLALGLLAGLVLGLGLAF
A0A4Q5A868      -------VVQPA-AVPSSPSS-PKWK---------------LNILVGIVGGLILGVFAAL
A0A6N4VXX3      -------VVEQPASVSSSPAI-PNLF---------------RNLALGLVAGVLLGIALAF
A0A1H4I042      -------VVEQPAAIASSPAV-PNLM---------------RNLALGLFAGILFGVACAL
A0A4R7A6D9      -------VVEQPAAIASSPAV-PNLM---------------RNLALGLFAGVLLGVACAL
A0A1Q2CRV2      -------VIRQP-LVPTAPTS-PKPL---------------QNLAIGGLVGLLLGAGQAL
A0A7K0NRJ7      QPANRVNVAASA-HASSTPIS-PHPT---------------RSAVVAFLLTCILVGELIV
K6WHS4          -------TVVSPATVDDAPVS-PRYG---------------RTVLIALTLGICMGIGIVV
A0A1L2ZMQ6      -------PMTEG-TLPTSPYA-PNVN---------------QAVLIGAVVGLVLGLIWAA
A0A3E2DN22      -------GYESA-GLPSGDRG-KSVA---------------LYVVAGLAAGFLIGAVVAV
A0A3Q9ULZ9      -------SYEPA-GLPATPKQ-DNLL---------------LYLALGLVAGLVVGSVIAV
A0A3S9JFL2      -------SYEPA-GLPATPKT-ANLP---------------LYLALGLLAGLVLGGVISV
A0A7K0NTR2      ---ESASRESTTVLVTQAKGS-SSES---------------TGLLYGAAFGFIIGLGILL
A0A1H6WL79      -------PLAKA-TLPSAPVS-PLLT---------------ATIGIGLAGGLLVGLGYAL
A0A101LAM5      -------PLAKA-SLPSAPVS-PLLT---------------ATLGIGLAAGLLIGLGYAL
A0A4Y3NEG0      -------PLTKA-SLPSAPIS-PLLT---------------ATLGIGLAAGLLIGLGYAI
A0A1Q2CI19      ---QEATPIPNE-STANFVIP-PDRW---------------FRTLLAAVLGLLFGIALAL
A0A512T3M3      ---QRGIPVAEA--HKGTLIP-PGRP---------------QRTGLAAGLGLLLGLAIAL
W6JTW4          ---QDAVAVPDA--NPGSILP-PGRP---------------TRTALAALIGLLFGMALAV
A0A0A0JTY0      ---QTATPIPTAGSDGGFVIP-PGRG---------------PRTAIATLLGVLVGLGLAL
A0A0A0JXF2      ---QPATPIPSTANDGGFVVP-PGRG---------------PRTAIATLLGLLVGMGLAL
E6S8H2          ---QRATPIPNV-TGGGFVIP-PDRT---------------TRTALAAGLGLLLGLGLAL
A0A0A0JGH0      ---QEATPIPDE-IGGGFVVP-PSRP---------------LRAALAALVGLLLGFALAL
N0E4U7          ---QVATPIPDQ-IGGGFVVP-PSRP---------------LRTAMAAFIGLLLGFALAL
A0A0A0IYK2      ---QAASPVPVANSDGGFVVP-PGRG---------------PRTAIATVLGLLAGLALAL
A0A0Q9L0H3      ---QPATPIPSAATDGGFVIP-PGRG---------------PRTAIATLLGLLVGLGLAL
A3TMK0          ---QPATPIPSATTDGGFVVP-PGRG---------------PRTAMATLLGLLVGLGAAL
A0A543PXP1      ---QRATPIPNV-TGGGFVVP-PGRA---------------FRTALAAMLGLLAGLALAL
A3TMH6          ---QSASPIPNA-DGGGFVVP-PSRP---------------VRAALSAVLGLLLGLALAL
A0A6I2XCV4      -------LNSRG-SISATQSV-PKLTFSETDLTVVSGSSRAVRILIGGLVGLILGIATAF
A0A5R8VLL6      -------PLDPA-TVPTHPVS-PGMG---------------LTALYGAAVGLLLAYASAL
A0A3L7ADK2      -------SVSKA-ATPNSPVS-PNVI---------------IALVLATITGTLLAIAYAV
A0A538JQF8      -------RFLAQ-RAAATFHP-KPRR---------------IRAVIGLLIGLLVGAGVSF
A0A1H6YPK1      -------VLQQA-RLPSVPAS-PAIK---------------QNTAVGLMLGLALGVAYAF
A0A0Q9TBP0      TAAAGGELLHSA-EPADNPVS-PQIV---------------LNLILGALVGLVLGVGAAL
A0A0G3V3M7      --EAATKGRATI-IVSRAQGS-TSES---------------QRLLFGAAIGFIVGLGILL
A0A6I3DD56      --EAATKARATI-LVTSAKGS-TSES---------------QRLLFGAAIGFIIGLGILL
A0A5Q2FA83      -------TITPA-TVPSQPVS-PNLL---------------QNIALGVLAGLALGIGLAL
A0A2R7MGI0      -------AGDSA-RLPTSPSS-PNIK---------------IDVAVGGIAGGVLGVVFAL
A0A2T7WQY4      -------AGDSA-RLPTSPSS-PNVK---------------VDVAVGAIAGGVLGVVFAL
A0A1G6GTN3      -------AGDSA-RLPTAPSS-PNVR---------------LDVTLGALAGGVAGIIFAL
A0A1N7DLV3      -------AGDSA-RLPTAPSS-PNEK---------------LAIAVGALAGAVAGVLFAL
A0A1V2NSB5      -------AGDSA-RLPTSPSS-PNEK---------------LAIAVGALGGAVVGVLFAL
A0A0Q5Q5L3      -------AGDSA-RLPTSPSS-PNVR---------------LDVMIGALLGLVAGVVFAL
A0A0Q6DVM4      -------AGDSA-RLPTSPSS-PNVR---------------LDVMIGALLGLVAGVVFAL
A0A1R3WWR6      -------AGDSA-RLPTSPSS-PNVR---------------LDIAIGALVGAMAGTVFAL
A0A2S5WZJ5      -------PLEDA-VPPTTPVT-PNLQ---------------TNLLLGAGIGIVLAYVFVF
A0A0Q5JKD6      -------AGDSA-RLPTAPSS-PNVR---------------LDVTLGALAGGVAGLIFAF
A0A2W6DK08      -----SPAAGAT-FNAGAFSL-SSTT---------------ARTVVGLVLGVVLGCALAL
A0A2S0LQ32      -------ALEPA-QLPGAPFS-PDTT---------------KLAGMGGAGGLALGLAVAF
A0A2N6V1R5      -------QTLQA-VAPSAPSS-PDFY---------------KLSGMGALAGLVIGYLVVF
G9PHS6          -------QTLQA-VAPSAPSS-PDFY---------------KLSGMGALAGLVIGYLVVF
U1PLM7          -------QTLQA-VAPSAPSS-PDFY---------------KLSGMGALAGLVIGYLVVF
A0A346XTB0      -------DFQDA-IPPDFPSR-PRPR---------------LTALSFAFLGGVASAMWAY
A0A6I1G2U1      ---AEATPIPII-ASGGFSIP-PSRT---------------FRTTMAALLGLLIGFGLAL
A0A351ETF8      -------VSQLA-EVPTIPVS-PNVT---------------RNLVVAAAFGMALGIALTY
A0A542FTE6      -------PLAAA-TTPTAPSS-PNIF---------------SALVVGGVVGLVAAGIFML
A0A349B7N2      GDPDEEDPLLEA-FDAGPSEP-PSPA---------------RRGMLGGGLGLVLSVGAVV
A0A7J5B4S5      -------PLQDA-VAPTSPES-PNLR---------------NNLLIGAGIGLVLAYVFVF
A0A4Q2JUT1      -------TRESA-SLPTSPAF-PDVQ---------------TALIVGGVLGLGFGIAFAM
A0A6L5R0V7      -------TRESA-SLPSSPAF-PDVQ---------------TALIVGGVLGLGFGVAFAM
A0A2S5UYV0      -------PLQDA-VEPTSPES-PNLR---------------NNLLIGAGLGLVLAYVFVF
A0A2S5X9U6      -------ELQNA-VEPTSPVS-PNLR---------------NNLIIGGAIGLLLAYAFAL
A0A2S5ULV5      -------PLQNA-VEPTSPVS-PNLR---------------NNLIIGGAIGLVLAYAFAL
A0A653YMF0      -------PLQNA-VEPTSPVS-PNLR---------------NNLIIGGAIGLVLAYAFAL
A0A3Q9IY80      -------PGDTA-RLPSSPSS-PNVR---------------IALALGALAGLVLGIAYAV
A0A0F0LP73      -------PLDQA-VAPRTPSA-PDKR---------------AMIIAGALIGLGVGLLLVL
A0A346Y185      -------LFERA-DVPESPSA-PTPV---------------RNAVLACFLGALAAAALAW
A0A4V1VGV9      -------PLTAA-ARPSAPSS-PNWM---------------RNLMAGAAIGLLAGIVLVV
A0A7G8U6P0      -------PLTAA-ARPSAPSS-PNWM---------------RNLMAGAAIGLLAGIVLVV
A0A259S8H9      -------PMDEA-VAPTRPSA-PNKP---------------LIAGIGGGAGLVLGLIALL
A0A2W1Z497      -------PLASA-TVPTSPSS-PDVR---------------AAVTLGVLVGLLLASVYVL
A0A0Q5L115      -------ALSSA-SVPTSPAS-PNVE---------------VALLLGGLSGLMLAGVYLL
A0A7G6YY64      -------ALSSA-SVPTSPAS-PNVE---------------VALLLGGLSGLMLAGVYLL
A0A1F1X071      -------NYQNA-VVPGAPVS-PDRE---------------KFLLAGAAFGLLVALGLAW
A0A3R8RWC7      -------NYQNA-VVPGAPVS-PDRE---------------KFLLAGAAFGLLVALGLAW
A0A4U0RJZ4      -------PLSRA-GLPASQTS-PKWP---------------VNLLIGAFLGLVAGTILVV
A0A4R1FGL9      -------PLSRA-GLPASQTS-PKWP---------------VNLLIGAFLGLVAGTVLVV
E3B8H1          -------PLSRA-GLPASQTS-PKWP---------------VNLLIGAFLGLVAGTVLVV
A0A7D7WDT9      -------PMDNA-AQPTSPVS-PNLR---------------LAVIAGAAAGLVLAYLVLF
A0A0Q5AWK6      -------PLENA-EPASTPTS-PNWL---------------RNLLLGAAGGLVLGFVVAF
A0A6P1F176      -------PLENA-EPASAPTS-PDWL---------------RNLLLGAAGGLVLGFAVAI
A0A3N1NLD3      -------PLENA-EPAAAPTS-PNWL---------------RNLLLGAAGGLVLGFVLAI
A0A3N2FVI8      -------PLENA-EPAAAPTS-PNWL---------------RNLLLGAAGGLVLGFVLAI
A0A2S5XDQ6      -------PLENA-EPPAAPTS-PDWV---------------RNILLGALGGLVLGFGLAF
A0A2S5XNN6      -------PLENA-EPPAAPTS-PDWV---------------RNILLGALGGLVLGFGLAF
A0A3L8NYD3      -------ATQQA-GAPSAPSS-PDYR---------------INLLAGGIAGIVAGYLLAL
A0A1M6K628      -------PVEPA-LTPSRPTS-PNWA---------------RNLALGLALGLLCGFGAVV
A0A561E8R3      -------PFDNA-TTPSLPFS-PDFK---------------KATAEGLLAGLVAGYLWAA
A0A345NSU7      -------TVVPA-AVPGRPVE-PDPE---------------RNLALGALAGLLLGVAFAL
A0A222TG79      KLT----TVTPA-VEPSVPVS-PGIE---------------KNTLIGVAVGLLFGLLAVM
A0A0W8I9Y2      -----------------------------------------------------MGLLYAF
A0A7C6LSF9      -------------------------------------------------------FGIAL
A0A255G8R8      -------TISPA-LPPPSPSS-PKVA---------------QNLALGLLLGLALGFAAAL
A0A6G7Y423      -------------------------------------------------MGAAVGVGQAL
A0A4Q4D4T1      SPI----VIQEG-TASSQPVE-PDAR---------------RTYVLFGLAGLLLGLLLAA
A0A261FE22      QLS----FIQKP-YVPSSPSS-PNVK---------------GNMMMGAFAALIIAAAGAV
A0A5C8C085      RLL----PVESA-ALPSAPVS-PNIT---------------RNLAIGFGAGLLLGFAYAL
A0A4Y5YMQ6      -------RVIDP-GAPAQFQSSPNKS---------------QDAVLGVVLGAFGALFALS
A0A1E4BP96      TLI----PGDSA-RLPTAPSS-PNTT---------------LNLALGGLVGLALGIAYAV
A0A151BT98      -------AVQPA-EVPASPAS-PDLK---------------KALELALAVGLLLGVAMAL
A0A2Y8ZRF8      -------AVQPA-TVPSSPAS-PDIK---------------RTLELAFAVGLLLGVAMAL
A0A2R9UAT1      RLV----PADTA-RLPTAPSS-PNVR---------------LALAIGGVAGLVVGLMIAL
A0A4Q5J5D7      KVV----PIEAA-ALPSAPVS-PRVE---------------LNLLIGGVVGVLLGLAYAL
A0A3S0V9U6      RVI----PLDDA-QKPGSPVG-PNVK---------------KYVLFGAAAGLIIVYLVVF
A0A1S2N0P2      KVT----PLDDA-QAPDGPVS-PSYR---------------NYLLIGAAVGLVLAYLIAF
A0A0Q3BEY5      KVT----PLDDA-QAPDGPVS-PSYR---------------NYLLIGAAVGLVLAYLIAF
A0A4R6Q3C6      KVT----PLDDA-QAPDGPVS-PSYR---------------NYLLIGAAVGLVLAYLIAF
A0A2X3GKL3      KVT----PLDDA-QAPDGPVS-PSYR---------------NYLLIGAAVGLVLAYLIAF
A0A1Y4CKD6      AFN----LIDEI-STPATPVNEPSQS---------------RIWGFGVMGGICTAALVVG
A0A0Q7KBQ4      RIV------GPP-SISQTPVA-PNVP---------------LNIAVGLLLSLFVAIAGAV
A0A5Q5BFU2      RVV----VEQRA-SIANKPVI-PKTA---------------RNIVFGLGLGLLLGVGLAV
A0A439DNZ6      RVI----VEQRA-SIPKSPVI-PKTA---------------RNIALGLALGLALGIGLAI
A0A7I7UD03      RVV----VEQRA-SIPDSPVV-PKTA---------------RNIGIGLVLGLAFGVALAV
A0A7I7MI62      RVV----VEQRA-TIPDHAVV-PKTA---------------RNIGMGLVLGVVLGVGLAL
A0A0J6YE86      RVV----VEQRA-SIPSSPVV-PKRA---------------RNIAVGLVLGLVLGVGFAL
A0A7I7K1R9      RVV----VEQRA-SIPGDPVV-PKTL---------------RNIAVGLALGIVFGIGLAV
A0A7I9ZLK4      RVV----VEQRA-SIPDDPVV-PKTG---------------RNLATGLLLGLLLGIGLAV
A0A1F1IHY9      SLE----TLSDA-SLPSAPSS-PNLP---------------LALSIGGALGLLAGLGVAV
A0A7H2BCD6      RVV----PLEDA-LPNNSPIS-PNTW---------------RNVLLGALVGFVAVYALVF
A0A542HCT5      RIV----PIESA-ALPASPVS-PNTQ---------------RNLALGFVLGLILGMGYAL
A0A0Q5M6Z7      SFV----ALASA-RPPYFPSS-PNVQ---------------TALVLAILAGIALAVVYGL
A0A7G6YA19      SFV----PLANA-RAPYFPSS-PDIQ---------------TALVLALLAGCALALVYAL
A0A2S8WHZ8      KLQ----PLGQA-VLPSSPVS-PNTK---------------LSLALGGVIGLALGLGYAL
A0A537WNY9      ELK----ELDRP-ALPQAPVF-PRKR---------------LTLIVASLIAVLLGVAAAL
A0A5B8M469      KVI----PLDNA-TAPSTPVS-PKPK---------------LVLPIGALAGLVLGYIVIL
A0A1Y4CTD2      QEP----SVPES-PSNTSPLI-AYRY---------------LGAAIAALGAVALIALIYL
A0A3N3ZPU0      QVV----PVSSA-SVPESPVS-PDLR---------------LNLLVGVGVGLLLAALYVL
A0A359IQX7      KLQ----PYISA-AESPNPVS-PNWK---------------ANLPIGAIAGLVIGYGIAF
A0A433EDP2      RVI----PLDNA-SINPPLVS-PNYT---------------RNTLIGAVAGLVLVYVVIF
A0A231VTW0      RVI----PLDNA-SINPPLVS-PNYT---------------RNTLIGAVAGLVLVYVVIF
A0A433ECD0      RVI----PLDNA-SINPPLVS-PNYT---------------RNTLIGAVAGLVLVYVVIF
U7V3Z1          RVI----PLDNA-SINPPLVS-PNYT---------------RNTLIGAVAGLVLVYVVIF
A0A1F1J417      RVI----PLDNA-SVNPPLVS-PNYM---------------QNGLIGAGAGLVLVYLAIF
A0A2A8D6P2      RVI----PLDNA-SVNPPLVS-PNYM---------------QNGLIGAGAGLVLVYLAIF
A0A1F0THV9      RVI----PLDNA-SVNPPLVS-PNYM---------------QNGLIGAGAGLVLVYLAIF
A0A5F0M6Y0      RVI----PLDNA-SVNPPLVS-PNYM---------------QNGLIGAGAGLVLVYLAIF
E3H5W1          RVI----PLDNA-SVNPPLVS-PNYM---------------QNGLIGAGAGLVLVYLAIF
A0A1F1QKB0      RVI----PLDNA-SVNPPLVS-PNYM---------------QNGLIGAGAGLVLVYLAIF
A0A509JY23      RVI----PLDNA-SVNPPLVS-PNYM---------------QNGLIGAGAGLVLVYLAIF
A0A448USF4      RVI----PLDNA-SVNPPLVS-PNYM---------------QNGLIGAGAGLVLVYLAIF
A0A0Q9LZR0      RVV----PIESA-ALPASPVS-PNTR---------------RNLALGFVLGLMLGLGYAL
A0A1N7E3F1      RVT----VVDDA-EVPEDPVA-PQPL---------------TNMALGVLIALFAAVTGLV
A0A544ZKQ1      RVT----VVDEA-EVPKEPVA-PQPL---------------TNMALGALIALLAAVTVLV
A0A372P1T1      RVT----VIDEA-EVPREPVA-PQPL---------------TNMALGALIALFAAVSGLV
A0A5D0Q2X0      RVT----VIDEA-EVPREPVA-PQPL---------------TNMALGALIALFAAVSGLV
A0A5R8Z2E7      RVT----VIDEA-EVPREPVA-PQPL---------------TNMALGALIALFAAVSGLV
A0A1L2ZMV4      QII----PISSA-LLPSAPSA-PVLR---------------TNLMYGAIAGLILAALFVF
A0A6I3F378      LDTPGAKVVHPA-ETPGTPVR-PTPI---------------ATTGLGLAIGALLGVALAL
A0A1S1CQC5      RVI----PLNNA-SVNPPLVS-PNYQ---------------QNTLIGAVIGLVVVYTAIF
A0A1E9T6I0      RVI----PLNNA-SVNPPLVS-PNYQ---------------QNTLIGAVIGLVVVYTAIF
A0A1F1GHA7      RVI----PLNNA-SVNPPLVS-PNYQ---------------QNTLIGAVIGLVVVYTAIF
A0A1S1CAD0      RVI----PLNNA-SVNPPLVA-PNYE---------------QNTLIGAGTGLVLVYAAIF
G5ET14          RVI----PLNNA-SVNPPLVA-PNYE---------------QNTLIGAGTGLVLVYAAIF
A0A1E9DXX2      RVI----PLNNA-SVNPPLVA-PNYK---------------QNVLIGAGTGLVLVYAAIF
A0A1E8S156      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLIGAGTGLVLVYAAIF
A0A1E8S5S2      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLIGAGTGLVLVYAAIF
A0A1S1DFA8      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLIGAGTGLVLVYAAIF
A0A2I1Z490      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLVGAATGLALVYLAIF
A0A1F0DAA9      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLVGAAAGLALVYLAIF
A0A1F0PHK9      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLVGAAAGLALVYLAIF
A0A1F0VZG6      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLVGAAAGLALVYLAIF
A0A1E9G8X4      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNTLIGAGTGLVLVYAAIF
A0A1E9IAW2      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNTLIGAGTGLVLVYAAIF
A0A1E9ZBC9      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNTLIGAGTGLVLVYAAIF
A0A1E9ZDP4      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNTLIGAGTGLVLVYAAIF
A0A1F0R6B5      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNTLIGAGTGLVLVYAAIF
A0A1F0Z7N5      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNTLIGAGTGLVLVYAAIF
A0A1F1D897      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNTLIGAGTGLVLVYAAIF
D2NP38          RVI----PLNNA-SVNPPLVA-PNYQ---------------QNTLIGAGTGLVLVYAAIF
A0A1F1FV74      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLIGAVAGLGLVYLAIF
A0A1E9M791      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLIGAVAGLGLVYLAIF
A0A291DEI8      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLIGAVAGLGLVYLAIF
A0A1S1D5T1      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLVGAATGLALVYLAIF
A0A1E8TRD6      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLVGAAAGLALVYLAIF
A0A1F0XT88      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLVGAAAGLALVYLAIF
A0A1F1EVP5      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLVGAAAGLALVYLAIF
C6R548          RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLVGAVAGLALVYLAIF
A0A0K2RXS2      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLIGAVAGLGLVYLAIF
A0A1F0KX60      RVI----PLNNA-SVNPPLVA-PNYQ---------------QNVLIGAVAGLGLVYLAIF
A0A542I3V2      GLV----PLDKA-ALPTTPIS-PNIK---------------LALLFGAIGGLLLAYAAAL
A0A2T0UZ65      RII----PIETA-LLPGAPIG-PNVT---------------KYVLAGAVAGAALAYAWIF
A0A1R4JTI6      QSIVKVLPLVQA-TQPQTPHT-PNVR---------------MALALGALVGLVVGLGVAA
A0A4R7TM52      QLV----PGDSA-QLPTSPSS-PNWR---------------IAVVIGAVIGLAAGIGAAA
A0A542XE74      NVL----AYEPA-ALPSSPVR-PGVI---------------RNLILGGLAGAILGGLIAF
A0A0Q7QDF6      TLSPI--VIQEG-TASSQPVE-PDAR---------------RTYVLFGLAGLLLGLLLAA
A0A5R8L819      RLV----EGDSA-RLPSSPSY-PNDR---------------LFAALGVVAGLALGIIYAV
A0A7K0PFV4      TFS----IAQRA-TAPDGPDG-PADW---------------LVVLGAMVAGGLLAVIGTI
A0A0G3V3F3      RVN----VAASA-HASSTPIS-PHPT---------------RSAVVAFLLTCILVGELIV
A0A7K0MUQ7      RVN----VAAGA-HAHSTPIS-PHPT---------------RSAVVAFLLTCILVGELIV
A0A7K0U619      RVN----VAAGA-HAHSTPIS-PHPT---------------RSAVVAFLLTCILVGELIV
A0A6I3DFP2      RVN----VAAGA-HAHSTPIS-PHPT---------------RSAVVAFLLTCILVGELIV
A0A7K0SI36      RVN----VAAGA-HAHSTPIS-PHPT---------------RSAVVAFLLTCILVGELIV
A0A7K0V140      RVN----VAAGA-HAHSTPIS-PHPT---------------RSAVVAFLLTCILVGELIV
A0A261FQA1      QFS----VIERA-VAPSSPVS-PNKP---------------RLIFMGTLAGLVLALVVIV
A0A1Q2CJ92      RIV----PVELA-QTPTTPVS-PNYV---------------RNLALGAALGLLLGLGIVV
A0A2T0S3C8      KVE----VVAGP-TGGDTPVS-PKPL---------------RNLALAALLGLLAGGVAAV
A0A4Y8WZJ3      SLE----TLSDA-SLPSAPSS-PNLP---------------LALSIGGALGLLAGLGVAV
A0A285VUW0      AAQ----FVDQP-TQSSEPVS-PNPT---------------RNLAIATLAGLMLGLAYAL
A0A2R7Z032      QVV----PLEQA-QLPGAPFT-PNYR---------------NGAIKGAGGGLVLAYVILI
A0A6J4MTQ2      RVV----PYEQA-QLPTEPFT-PDYR---------------LAALQGAAGGLALAYALIL
A0A1I0W453      RII----PLEEA-QLPGAPFT-PNYE---------------SAAMKGALGGLGLAYAFLI
A0A1H4LCS9      TIV----PLEEA-QLPGAPFT-PNYQ---------------KAAMYGAAGGLGLCYAFLV
A0A4Q2RZP8      RIV----PLEEA-ALPGAPFT-PNYK---------------KGAMQGAAAGLGLCYAVLV
A0A0Q6VV12      RVV----PVQPA-ELPQAPFT-PDYA---------------KAAMKGAAGGLALAYAFLI
A0A495NTA9      RIV----PVTPA-QLPGAPFT-PDYR---------------KAAMKGAAGGLGLAYAFLI
A0A0Q9QB08      RII----PVTPA-ELPGAPFT-PDYR---------------AAAIKGALGGLALAYAFLI
A0A4Q2SA86      RIV----PVEQA-QLPTAPFS-PDYP---------------SAALKGALGGLALAYAVLI
A0A4Z1C3Z0      RIV----AVEPA-QLPSAPFS-PDYR---------------SAALKGALGGLALAYAVLI
A0A6V8KDX4      KVD----VVAGP-TPDDAPVS-PKPV---------------RNLGLATLLGLLLGAGAAV
A0A444BL03      VTI----VPIES-ALPGRRIA-PDPP---------------RNVLIGIGLGLLVAYLLVF
A0A4Y8X357      KVT----AMEDA-LPPQAPSS-PDHL---------------RNALIGGSIGLLAALAAAF
R4LD52          KVE----VVAGP-ELADAPVS-PRPV---------------RNLVLAALLGLLTGAAGAV
A0A4T2CD79      AAVTFLEPVESA-VAPTQPIF-PNVR---------------LSVIIGALIGLVLAIVYAM
A0A6L6AM03      RII----PLEQA-QLPGAPFT-PDYR---------------NAAMKGAIGGLALAYAFLV
A0A4Q2RU39      RII----PLEEA-QLPGAPFT-PDYE---------------RAAMKGAIGGLGLAYAFLI
A0A4Q2SK58      RII----PLEEA-QLPGAPFT-PNYE---------------RAAMKGAIGGLGIAYAFLI
A0A2N3YJR1      VTI----VPIES-ALPGTKIA-PDPR---------------RNTLVGLVGGLFLAYALIF
A0A6G8FYB9      VSI----VPIES-ALPGGKIA-PNPK---------------RSGLIGLVVGLGVAYALVF
A0A4Q4D742      TAR----IAADP-SFRSSPVA-PNVP---------------LNLAAGLLLSLFLAIAGAL
A0A1C6T1J1      KIE----IVSGP-RVSASPVS-PQPL---------------RNFTIGGLLGLVAGVALAV
A0A2W2CFC8      KIE----VISGP-GVTPSPVS-PQPV---------------RNVLIGTLIGLLAGVGLAI
A0A2W2A4B0      TVT----QTSPA-ARPTTPVA-PRTR---------------ANAALGGAAGAGLGVLAAF
A0A4Y9MDA5      RAD----TVAPA-SVPSAPVS-PRTS---------------LNLAVGQLAGLLAGCVAAL
A0A1H7N9P7      RAT----TVAPA-GVPGAPVS-PRTS---------------LNLAVGVLAGLLLGCGLAL
A0A1M7V0F8      RAT----TVASA-DVPTAPVS-PRTS---------------LNLAVGVLAGLLAGCAAAL
A0A1M3LEY6      --------------MPQEPIS-PNTR---------------LYLSLGLLIGLIVGLAVAI
A0A538AJI7      -------LVAPA-VKPTTPAA-PPRR---------------LLELASLFIGSLLGIVASL
A0A538AM15      -------AAEPL-TLQQSPA-------------------------DSAVDDHLVSLVAPA
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      -------PASRE------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      -------KVGREQESPGSRSE---------------------------------------
A0A4R1CW45      -------VASNNVVGFDSRDK---------------------------------------
A0A4R5Z7B0      -------PARKLIANLDPKSP---------------------------------------
A0A542H054      -------TRRKLVAHDNPQSP---------------------------------------
A0A6M8GFV5      -------LKRFLITLTNPKSP---------------------------------------
A0A7G8U6J2      -------KQVNLIAQTNPKSP---------------------------------------
A0A419GS64      -------GSKYLYTKDFPASV---------------------------------------
A0A2V2CXY5      -------KELVIRNMPKLPFD---------------------------------------
A0A2S8MDM2      -------RKQPAISFETDNAA---------------------------------------
A0A357ZDL3      -------MSKKNNKSFSNNHE---------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      -------GGTSRSSESAHLFG---------------------------------------
A0A1I6IST1      -------GGTSRSSESAHLFG---------------------------------------
A0A412JBM5      -------DSPFA------------------------------------------------
A0A6J4SUA1      -------EEASQ------------------------------------------------
A0A1C2B334      -------AGGSV------------------------------------------------
R7Y679          -------AGGSS------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      -------VRSPS------------------------------------------------
A0A538BBM6      -------PEEIQ------------------------------------------------
A0A7K0LE65      -------EGFET------------------------------------------------
A0A510HHA8      -------PSNPA------------------------------------------------
A0A6G8Q9J3      -------PTGAA------------------------------------------------
A0A5Q2F9A3      -------ITSPR------------------------------------------------
A0A4R1BMZ2      -------PEGPA------------------------------------------------
A0A023X491      -------PGGQA------------------------------------------------
A0A6G8QDQ0      -------PGGMA------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      -------GAAGV------------------------------------------------
A0A6D1QMN1      -------QRSPV------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      -------PASFE------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      -------SHSTR------------------------------------------------
                                                                            

A0A6N6NKS9      ------------------------------------------------------------
A0A538BYZ4      VSLLTPTSF---------------------------------------------------
A0A348NU28      LWTLLDTRV----PNE----TVLSQVVPAPVLGSISRVRGNGERGLYVAREPLGH-----
A0A2N4T4Q5      ----MDRRI----RSV----EEVRETFGTPVLGIIPEDDRLADHREIIETGTSGGRGHHA
A0A4Q5APW3      LKDALSKRI----QND----DEISEYIDAPIIGRIPEEELLNSTKPVIVSEPGSP-----
A0A4Q5B0V3      LKDVLSKRI----QND----DEISEYIDAPIIGRIPEEELLNSTKPVIVSEPGSP-----
A0A022KX11      IRHALDTKV----RGE----EDIRAHSDAPMLAGLPLESRGSKRGLISVEEDPHGR----
A0A4Q5A868      LKDVLSKRI----QDD----DEISEYIDAPIIGRIPEEELLNSAKPVIVSEPGSP-----
A0A6N4VXX3      GLDVVDSTV----KKR----EDLESITGASVVGEIPVDKPRRTAPVISFASDNSR-----
A0A1H4I042      GREMIDNTV----KKH----EDLESITGVAVVGDIPMDKARRGTPAISFGTENSQ-----
A0A4R7A6D9      GREVIDNTV----KKH----EDLESITGVAVVGDIPMDKARRGAPAISFGTENSQ-----
A0A1Q2CRV2      LRDVLNTVV----RSR----RDIEQVSDQAILGAIPLDESGDVLVLNSDPHGL-------
A0A7K0NRJ7      ASRAIGDRIGRTGDDD----ADVARITGLPVLGRIPKGEGF-------------------
K6WHS4          LVERADTRI----RSE----DSVLEVTELPILGDLPDD-------------PAVDRNVVN
A0A1L2ZMQ6      IKHLLDRRV----RSV----EAIQK-VGMSAVGTLPSDPRLSRGRQVL---PVVYSAETR
A0A3E2DN22      VRKQFDVKV----RDQ----ATIEELTGSGILSVIPDDK------------KLAEQREKS
A0A3Q9ULZ9      IRRMFDVKI----RSQ----NDVEELTGRGVLAIIPEDR------------QLSKQRKTG
A0A3S9JFL2      IKRMFDVKI----RSQ----KDVEDLTGHGVMAVIPEDR------------QLTKQRKSG
A0A7K0NTR2      LLEILSARI----RDV----PGTEGAARMPVIAEIPVMNLD----------KSLRFQITT
A0A1H6WL79      ARNHFDRRI----RAA----SEIERLFGLAVVGTLPLDKRLSEKSS-----VLESTSVVH
A0A101LAM5      ARNHLDRRI----RGA----SEIERLFGLAVVGTLPLDKRLSEKSS-----VLESTTGMH
A0A4Y3NEG0      ARNHFDRRI----RGA----SEIERLFGLAVVGTLPLDKRLSEKSS-----VLE-TTGTH
A0A1Q2CI19      VLERLDSRL----RTR----EEIAEALDMPIVGVVPKITAA----------QRRNKEILT
A0A512T3M3      VLNRLDSRM----RSR----EEIQEALGLPIIAEVPKLARG----------QRASAGTLV
W6JTW4          FVDRIDSRL----RSR----TEIQAALGLPIIAEVPKLPRA----------KRSDAYHMV
A0A0A0JTY0      LLDRLDSRL----RTR----SEIHNALQMPIIAEVPRLKRA----------QRSRASIAV
A0A0A0JXF2      LLDRLDSRL----RSR----SEIGDALSMPIIAEVPRLKRS----------QRNRNSIAV
E6S8H2          VLDRVDSRL----RTR----SEIAAALRLPIIAEVPKMSRS----------LRRRRSIGV
A0A0A0JGH0      VLQRVDSRL----RTR----DEVHAGLRLPIIAEVPRLKRS----------QKGERTITV
N0E4U7          VIQRVDSRL----RTR----DEVHAALRLPIIAEVPRLSQA----------QKRKASIMV
A0A0A0IYK2      LLDRLDSRL----RTR----QEIHGALRMPIIAEIPRLRRS----------ERHQGAIAV
A0A0Q9L0H3      LLDRLDSRL----RTR----GEIASALRMPIIAEIPRLKRS----------QRNSASIAV
A3TMK0          VMDRLDSRL----RTR----ADIHSALRMPIIAEVPRLKRS----------QRNRATLGV
A0A543PXP1      VLDRLDSRL----RTR----EEIAAALRLPIIAEVPRLNRS----------QRSSPSIGV
A3TMH6          VLDRLDSRL----RTR----EEIAAALALPIVAEVPRLGRT----------KRRDKTIGV
A0A6I2XCV4      VLEVWDDRI----RRR----DGLEAVTGLPVIVEVPVFTRA----------ERQELSVIA
A0A5R8VLL6      LRDRLDRRL----RTA----AEVENLFSVPVVGTLPVDLRLTGENKVLG--GLPAAPAPG
A0A3L7ADK2      IRQHLDRRI----RSA----DVLEQRYGTSVLGTIPMNPFLRKGSQLL---SQLTETSTE
A0A538JQF8      AIDFFDPRL----RTR----AKVEDLLGLPVVAEIPLLSRR----------ARRVPGILA
A0A1H6YPK1      VRATLDRRL----RSR----NDVEIQFGVPVVGTVPWD-------------GAIAKKGPL
A0A0Q9TBP0      LRDRLDDVV----HDE----EAVRQALDAVVLARVPQWSE-----------RSHRDRLVT
A0A0G3V3M7      LLEILSARI----RDV----PGTEGAARMPVIAEIPVMNLD----------RSLRFQVTT
A0A6I3DD56      LLEILSARI----RDV----PGTEGAARMPVIAEIPVMNLD----------RTLRFQVIT
A0A5Q2FA83      LRHFLDTRV----RSE----LDLRAVSDRPILGALRLL-------------PKGTSPTVM
A0A2R7MGI0      VRRTFDRRV----RTV----QDITDTVDASVVGVLPVDKELANGR------AVFSFTDIR
A0A2T7WQY4      VRRTFDRRV----RTV----EDITAAVGASVVGVLPIDKELANGR------AVFSFTDTH
A0A1G6GTN3      VRRAFDRRV----RST----HDITDAVDASVVGVLPVDKELASGR------AVFSFDDIK
A0A1N7DLV3      VRRAFDRRV----RSA----HDISDSVDVSVVGILPVDKELAAGR------AVFSFDDIR
A0A1V2NSB5      VRRTFDRRV----RST----QDISDSVDVSVVGILPVDKELAAGR------AVFSFDDIR
A0A0Q5Q5L3      VRRTFDRRL----RSA----SDITDAVDASVVGVLPVDKELAAGR------AVFSFDDIR
A0A0Q6DVM4      VRRTFDRRL----RSA----SDITDAVDASVVGVLPVDKELAAGR------AVFSFDDIR
A0A1R3WWR6      VRRAFDRRI----RSA----ADITDTIAASVVGILPVDKELASGR------AVFSFDDIR
A0A2S5WZJ5      LRKALDVKV----RTS----KDLATATRSGSLGRIPKS-------------PQLMGKNRG
A0A0Q5JKD6      VRRAFDRRV----RSA----HDITDAVDASVVGVLPVDKELAGGR------AVFSFDDIK
A0A2W6DK08      ALEHFDTRP----RDR----AAAGRAYRLPVLAEIPQARHS----------ERRNFAVIT
A0A2S0LQ32      LRRALDNKI----RHN----SDIEDILQSSVLAVVPRS-------------TDLSAKGRR
A0A2N6V1R5      MRRLMDNRV----RHN----SDVEELLGSSVLAVVPKS-------------TELNAKGRQ
G9PHS6          MRRLMDNRV----RHN----SDVEELLGSSVLAVVPKS-------------TELNAKGRQ
U1PLM7          MRRLMDNRV----RHN----SDVEELLGSSVLAVVPKS-------------TELNAKGRQ
A0A346XTB0      WYAFKSQRV----TSR----TDPEIVLGVPPLGEIPLYR------------MTSEDQLTG
A0A6I1G2U1      VLHQVDSRL----RTR----DEVYQALRMPVIAEIPKLSRS----------QREQRQILV
A0A351ETF8      LREVINDKI----EGA----RSVEQATGLAILGTIPGYQ------------LNSDQVVEV
A0A542FTE6      VRNTLDRRV----RSV----ETVEKTAGVAVIGTLIRYEPFDAGRRLATAVSPLSGPARR
A0A349B7N2      LFDRFDDRL----RTK----EDAEEAFGLPVVAEIPLLRRR----------QRRNSEVVS
A0A7J5B4S5      LRKALDVKV----RNS----KDLASAAGVGSLGRIPKS-------------PQLMGKNRA
A0A4Q2JUT1      IRTAADRRI----RNA----EDTESKTGVAVVGTIPWVAGFDSGERL----VDTSAANRT
A0A6L5R0V7      IRTAADRRI----RSA----EDTESKTGVAVVGTIPWVAGFDSGERL----VDTSAANRT
A0A2S5UYV0      LRKALDVKV----RNS----KDLASAAGVGSLGRIPKS-------------PQLMGKNRA
A0A2S5X9U6      LRRSLDVKV----RDS----KDLAAASGAGTLGRIPKS-------------PQLMGKNRG
A0A2S5ULV5      LRRSLDVKV----RDS----KDLATASGAGTLGRIPKS-------------PQLMGKNRG
A0A653YMF0      LRRSLDVKV----RDS----KDLATASGAGTLGRIPKS-------------PQLMGKNRG
A0A3Q9IY80      LRYTLDRRI----RSA----DAVEKETGLSVVGTIPDEKSFTADNRL----LPVDGISSG
A0A0F0LP73      LRRALDVRV----RAH----TDVAAIVGAGVLGRVPK--------------FDPDGRSKK
A0A346Y185      WRADETATA----DGR----NDPSRMLKAPLLGTVPSFEE-----------IGLTGSVPT
A0A4V1VGV9      LRKQLDSRI----RHT----SEVEKLTGSGVLGVIPKA-------------PTLQSRRRG
A0A7G8U6P0      LRKQLDSRI----RHT----SEVEKLTGSGVLGVIPKA-------------PTLQSRRRG
A0A259S8H9      LRRAMDVRV----RAH----TDVAALVGAGVLGRVPRM--------------RKSGQGRN
A0A2W1Z497      VRQALDRRI----RSA----AAIEAAFGVPVLGTIPLNPALTDHRQLVDALPNRTPEERR
A0A0Q5L115      VRNTLDRRI----RSA----AEVESRFGVGVIGTIPQNDALAEHGGLVAALPNATADDRH
A0A7G6YY64      VRNTLDRRI----RSA----AEVESRFGVGVIGTIPQNDALAEHGGLVAALPNATADDRH
A0A1F1X071      LRDRNDSRL----RTA----DDVTDVVGLPTLGALPDA----KE-------LARGKDGVL
A0A3R8RWC7      LRDRNDSRL----RTA----DDVTDVVGLPTLGALPDA----KE-------LARGKDGVL
A0A4U0RJZ4      LRKQLDSRI----RHT----SDLEKVTGVGTLGVIPKA-------------KNLQTKSRG
A0A4R1FGL9      LRKQLDSRI----RHT----SDLEKVTGVGTLGVIPKA-------------KNLQTKSRG
E3B8H1          LRKQLDSRI----RHT----SDLEKVTGVGTLGVIPKA-------------KNLQTKSRG
A0A7D7WDT9      LRRALDVRV----RAD----TDTRELMGAGVLARVPK--------------MGRKGTPQG
A0A0Q5AWK6      LRRALDIRV----RTV----DQLTELFGVGVLGRIPK--------------AGRRAGRKG
A0A6P1F176      LRRALDIRV----RTV----DDLTALFGVGVLGRIPKI----GKGRGGRGQGGRDRGGRG
A0A3N1NLD3      LRRALDIRV----RTV----DDLTQLFGVGVLGRIPKM----GKGR-----VGRRGDARA
A0A3N2FVI8      LRRALDIRV----RTV----DDLTQLFGVGVLGRIPKM----GKGR-----GGRRGDARA
A0A2S5XDQ6      LRRALDIRV----RTV----DDLTELFGVGVLGRIPK------AGR-----PGRTGGRRG
A0A2S5XNN6      LRRALDIRV----RTV----DDLTELFGVGVLGRIPK------AGR-----PGRTGGRRG
A0A3L8NYD3      VRRQLDSRI----RTV----DDMESLVGTSVLTILPESDE-----------LDRVGDDGL
A0A1M6K628      LRRSLDRRV----RQA----DEVEELTSATALGVVPTAVE-----------L---ASGVS
A0A561E8R3      FRRQLDSRV----RHQ----DDVERHLEAPVVGVIPKVPE-----------L---AEDYR
A0A345NSU7      ARQALDQRV----RGT----ADVEAISDRPVLSTIPMRKADDAHSIYLELDPFGP-----
A0A222TG79      FASRLTNRI----QTP----ADVVEVTESPVLAVVPRFPSAADSPVSFGAGSSP------
A0A0W8I9Y2      ARFKMDRRI----KSV----EEIRDGFGVAVLGVIPTDDRLADHREIVETGFSAGRGHHE
A0A7C6LSF9      VLHQVDSRL----RTR----DEVYEALRMPVVAEIPKLGRSARENARILVADEPHGV---
A0A255G8R8      VRERLDTRV----RNE----ADVAAVTTASQVGSIPYVAGTPEHPLELGAHTDQ------
A0A6G7Y423      ARHALDTRI----RTA----RDLQQTTTLPLLASIGRRHPDPAQGGE-GAHWAT------
A0A4Q4D4T1      LRNLATATV----TSS----DALTEQVKAPVIGAVAQDRHVADHPLISTLSNQHP-----
A0A261FE22      IREMSDNSI----HTK----AEIQSIVPAPILAAVPKSPTLAGRTPAVIVKPRGH-----
A0A5C8C085      VRSQLDRRL----RTA----SAVEKKFGLSVVGSIPKAPLLAHDTNEAANLAVLEAAARG
A0A4Y5YMQ6      AWALLDRRV----RSV----AALEGVTDLPVLGLVPRRRNPAQGAAFLISPNGS------
A0A1E4BP96      MRSVLDSRI----REP----QDVERNTGASVVGVLPLDHDLDNRREVLSFTGASGNVVRG
A0A151BT98      LRHFMDNRV----RTV----EDLETLVQRPVLSIVPRVGGGHRVVDTSDHPSGA------
A0A2Y8ZRF8      LRHFMDNRV----RTV----EDLEALVQRPVLSIVPRVGSGQRVVDTSDSPSGA------
A0A2R9UAT1      LRFTLDRRI----RSA----ELVERETGVAVVGTVPVEKSFTAANRLIPVGGQRDERLFA
A0A4Q5J5D7      LRNQLDRRL----RSS----QAVERQFGVTVVGAIPTASDLASTDGAGPVAVQDRSGSQR
A0A3S0V9U6      IRRFMDVRV----RTT----KDMEESTGLGVLGVLPKTNALDQNSFLEDAADHQ------
A0A1S2N0P2      LRKFADVRV----RTT----DDLENATEAGTLGILPKSSALDENTFLSDRADHQ------
A0A0Q3BEY5      LRKFADVRV----RTT----DDLENATEAGTLGILPKSSALDENTFLSDRADHQ------
A0A4R6Q3C6      LRKFADVRV----RTT----DDLENATEAGTLGILPKSSALDENTFLSDRADHQ------
A0A2X3GKL3      LRKFADVRV----RTT----DDLENATEAGTLGILPKSSALDENTFLSDRADHQ------
A0A1Y4CKD6      LIALFNNTI----KTA----EDLESVSSMVCLGALPEVRAKARKRSAASRYVSALDKRVS
A0A0Q7KBQ4      LRDLLDRTV----KTR----QEAEELSGGAVLATLPFDRQLKKQALTSEGHGA-------
A0A5Q5BFU2      LRDTLDNTV----KDR----QALEDVTGAGVVGNIPLSKDRRKQAAIGFESDNSG-----
A0A439DNZ6      LRDLLDNTV----KDR----QNLEEITGVGVVGSIPLDKERKRSPAKSLDNDNSA-----
A0A7I7UD03      VRDLLDNTV----KDR----ETLESITGTGLVGSIPLDKDRRKQPAISFDADNSL-----
A0A7I7MI62      IRDLLDNTV----KSR----ETLEQLTGAGIVGSIPLDKERRRQAAIFFDGDNSA-----
A0A0J6YE86      IRDLLDNTV----KDR----TTLEQIANVGLVGTVPLDKERRRHAAIAFENDNSV-----
A0A7I7K1R9      FRDLMDNTV----KDS----GTLEEITGTGVVGSIPLDKERRRQPAIAFDADNSG-----
A0A7I9ZLK4      LRDLLDNTV----KDR----EALEEITGAGIVGSIPLDKERRKHPAISFDNDNSG-----
A0A1F1IHY9      VRHVLDNKI----RSA----AALESRFGLTILGTVPESTRSARNRRRRDGGDVINLAGRV
A0A7H2BCD6      ARRAIDTKV----RTR----EDAIKSTELGVLGMLPKSEDLASTKILHEAGDHV------
A0A542HCT5      LRSQLDRRV----REP----EVIERDFGVTVAGAIPETSALVRKKGGLVPLVVTGPRKDK
A0A0Q5M6Z7      LRQHFDRRI----RSV----EQIERLLGAPVIGTIPASPALEDRRRVTDSDSGDDAVELF
A0A7G6YA19      LRQYFDRRI----RSV----DQIERLLDAPVIGTVPASPALSDRRRVVEQDGSADSVQLF
A0A2S8WHZ8      TRNHLDRRI----RSV-----EAIERLGVSVVGTIPEDQRLTEGRSVVETGSIVHDDRAA
A0A537WNY9      VRENLGTRI----ETA----EDLARIAGVPSYGEVPHEPAVTRLATPEALALDNRLHV--
A0A5B8M469      LRRALDVRV----RAG----TDMIELLGTGVLGRVPR---FKGKGGVRGGELDRL-----
A0A1Y4CTD2      LRNTVKTA------------EQASDLLDGRVLGTVPFERKRVVRGGDERSVPALVLSSPL
A0A3N3ZPU0      ARSLFDRKV----RSS----EAVANATGLAILGTIPLDKRLTAKRGVIPTAPPRKDREAW
A0A359IQX7      IRRSIDGRV----RTQ----AEVEELTGAGVIGVIPKVAELEQQRVEEGQVSLGE-----
A0A433EDP2      LRRSVDQRI----RTR----DDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHI-----
A0A231VTW0      LRRSVDQRI----RTR----DDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHI-----
A0A433ECD0      LRRSVDQRI----RTR----DDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHI-----
U7V3Z1          LRRSVDQRI----RTR----DDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHI-----
A0A1F1J417      LRRSVDQRI----RTR----DDAIKATNSNILGVLPVSDDLAEENIVHASNDDHI-----
A0A2A8D6P2      LRRSVDQRI----RTR----DDAIKATNSNILGVLPVSDDLAEENIVHASNDDHI-----
A0A1F0THV9      LRRSVDQRI----RTR----DDAIKATNSNILGVLPVSDDLAEENIVHASNDDHI-----
A0A5F0M6Y0      LRRSVDQRI----RTR----DDAIKATNSNILGVLPVSDDLAEENIVHASNDDHI-----
E3H5W1          LRRSVDQRI----RTR----DDAIKATNSNILGVLPVSDDLAEENIVHASNDDHI-----
A0A1F1QKB0      LRRSVDQRI----RTR----DDAIKATNSNILGVLPVSDDLAEENIVRASNDDHI-----
A0A509JY23      LRRSVDQRI----RTR----DDAIKATNSNILGVLPVSDDLAEENIVRASNDDHI-----
A0A448USF4      LRRSVDQRI----RTR----DDAIKATNSNILGVLPVSDDLAEENIVRASNDDHI-----
A0A0Q9LZR0      LRSQLDRRV----REP----EVVERDFGVTVAGAIPETSALVRKKGGLVPLVVAGTSKEK
A0A1N7E3F1      LRDRLDTTI----KTA----ETLRQVAKSSVLGLIGYERDARRHPLVLRDQGRSV-----
A0A544ZKQ1      LRDRLDTTV----KTA----EALQQVARSSILGVIGYERDAKRHPLILRDQGRSS-----
A0A372P1T1      LRDRLDTTV----KTA----ETLQKVARSSILGVIGYERDAKRHPLILRDQGRSS-----
A0A5D0Q2X0      LRDRLDTTV----KTA----ETLQKVARSSILGVIGYERDAKRHPLILRDQGRSS-----
A0A5R8Z2E7      LRDRLDTTV----KTA----ETLQKVARSSILGVIGYERDAKRHPLILRDQGRSS-----
A0A1L2ZMV4      IKHLFDVRI----RST----EQVETTTGHPVLGTVPQDKRLDHHRQVITVGEPGD-----
A0A6I3F378      IRQRLATTV----DRP---EDLVTLGIAAPLLTVVPVTSSTGDRPLATTDPTND------
A0A1S1CQC5      LRRALDQRI----RTR----DDATKATGASILGVLPVSEDLNEENIVNGDTDDHI-----
A0A1E9T6I0      LRRALDQRI----RTR----DDATKATGASILGVLPVSEDLNEENIVNGDTDDHI-----
A0A1F1GHA7      LRRALDQRI----RTR----DDATKATGASILGVLPVSEDLNEENIVNGDTDDHI-----
A0A1S1CAD0      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEDNIVKGDTDDHI-----
G5ET14          LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEDNIVKGDTDDHI-----
A0A1E9DXX2      LRRALDQRI----RTR----DDATKATGASILGVLPISDDLNEENIVNGDTDDHI-----
A0A1E8S156      LRRALDQRI----RTR----DDATKATGASVLGVLPVSDDLNEDNIVKGDTDDHI-----
A0A1E8S5S2      LRRALDQRI----RTR----DDATKATGASVLGVLPVSDDLNEDNIVKGDTDDHI-----
A0A1S1DFA8      LRRALDQRI----RTR----DDATKATGASVLGVLPVSDDLNEDNIVKGDTDDHI-----
A0A2I1Z490      LRRALDQRI----RTR----DDATKATGASVLGVLPVSDDLNEDNIVKGDTEDHI-----
A0A1F0DAA9      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVKGNTDDHI-----
A0A1F0PHK9      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVKGNTDDHI-----
A0A1F0VZG6      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVKGNTDDHI-----
A0A1E9G8X4      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVNGNTDDHI-----
A0A1E9IAW2      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVNGNTDDHI-----
A0A1E9ZBC9      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVNGNTDDHI-----
A0A1E9ZDP4      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVNGNTDDHI-----
A0A1F0R6B5      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVNGNTDDHI-----
A0A1F0Z7N5      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVNGNTDDHI-----
A0A1F1D897      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVNGNTDDHI-----
D2NP38          LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVNGNTDDHI-----
A0A1F1FV74      LRRALDQRI----RTR----DDATKATGASILGVLPVSEDLNEENIVKGDTDDHI-----
A0A1E9M791      LRRALDQRI----RTR----DDATKATGASILGVLPVSEDLNEENIVKGDTDDHI-----
A0A291DEI8      LRRALDQRI----RTR----DDATKATGASILGVLPVSEDLNEENIVKGDTDDHI-----
A0A1S1D5T1      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLSEENIVNGGTDDHI-----
A0A1E8TRD6      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLSEENIVNGDTDDHI-----
A0A1F0XT88      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLSEENIVNGDTDDHI-----
A0A1F1EVP5      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLSEENIVNGDTDDHI-----
C6R548          LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLSEENIVNGDTDDHI-----
A0A0K2RXS2      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVNGNTDDHI-----
A0A1F0KX60      LRRALDQRI----RTR----DDATKATGASILGVLPVSDDLNEENIVNGNTDDHI-----
A0A542I3V2      LRHHLDRRL----RSS----SEIERLFDVPVIGTLPYDPDISGALKVLGTERHQLTQAGE
A0A2T0UZ65      IRRLSDTRI----RTS----KDVEDLTGSSSLGVIPLSNELRKARGGRSSG---------
A0A1R4JTI6      LRSLNDRRI----RGV----KVLEETFGLTVLGTIPAMAGLGRRAQRNRTQSKDSNAEVE
A0A4R7TM52      IRYVVDRRI----RSA----DIVERETGHAVVGTIPFEKSFTSAGRLIPFGGGYDEGIRS
A0A542XE74      GRRALDARI----RSQ----EQVELLTGKAVLGVVPETKSLKVRKGQASKR---------
A0A0Q7QDF6      LRNLATATV----TSS----DALTEQVKAPVIGAVAQDRHVADHPLISTLSNQH------
A0A5R8L819      ARHTLDRRV----RSA----ETVEKETGRAVVGILPLERTFSSASRLLPAGGSHVPHELF
A0A7K0PFV4      VLQRTDHRV----ASR----AALLENIPAPVLAGVPTVRGFGGINMPP------------
A0A0G3V3F3      ASRAIGDRI----GRTGDDDADVARITGLPVLGRIPKGEGF-------------------
A0A7K0MUQ7      ASRAIGDRI----GRTGDDDADVARITGLPVLGRIPKGEGF-------------------
A0A7K0U619      ASRAIGDRI----GRTGDDDADVARITGLPVLGRIPKGEGF-------------------
A0A6I3DFP2      ASRAIGDRI----GRTGDDDADVARITGLPVLGRIPKGEGF-------------------
A0A7K0SI36      ASRAIGDRI----GRTGDDDADVARITGLPVLGRIPKGEGF-------------------
A0A7K0V140      ASRAIGDRI----GRTGDDDADVARITGLPVLGRIPKGEGF-------------------
A0A261FQA1      VIDVSDKRV----RDT----ADIQRILYSPVISSVPKSDTFRGTAPAVISD---------
A0A1Q2CJ92      GRQSFDRRI----RRA----HEAEEVAETSSLGIVPAAAELAGESALVTGS---------
A0A2T0S3C8      LRETLDTTV----KTA----DALHELAGAPVLAGVPFDADARSGPLRLTGS---------
A0A4Y8WZJ3      VRHVLDNKI----RSA----AALESRFGLTILGTVPESTRSARNRRRRDGGDVINLAGRV
A0A285VUW0      GMQALDTRL----RST----ADVEALTGRPVLSTVPVLPTAGRTSSMYIEN---------
A0A2R7Z032      ARRLIDRRI----RSV----KDVETATGSAVIGIIPKVDALNRTHRGVRGD---------
A0A6J4MTQ2      LRRAVDRKI----RSV----NDVEDATGGSVIGIIPKVDSLAQSSRGIRGD---------
A0A1I0W453      GRRLIDRRI----RTT----KHVEEATGASVLGIIPKEDSLGRSHRGVRGD---------
A0A1H4LCS9      GRRLIDRRI----RSA----KHVEEATGASVLGIIPKEDALGRGHRGVRGD---------
A0A4Q2RZP8      GRRLIDRRI----RSA----KHVEEATGSSVLGIIPKEDALGRGHRGVRGD---------
A0A0Q6VV12      ARRLIDRRI----RSV----KHVEDATGAAVLGIIPKEDALGRTHRGVRGD---------
A0A495NTA9      ARRLIDRRV----RSV----KHVEDATGASVLGIIPKEDALDRGHRGVRGD---------
A0A0Q9QB08      ARRLIDRRV----RSA----KHVEDATGAAVLGVIPKEDALGRVNRGVRGD---------
A0A4Q2SA86      GRRLIDRRI----RSA----KHVEEATGAAVLGIIPKEDSLGRTHRGVRGD---------
A0A4Z1C3Z0      ARRLLDRRI----RSA----AHVEEATGAAVLGVIPTEDSLGRTHRGVRGD---------
A0A6V8KDX4      LREKLDSTV----KSA----EELRDATDAPTLAVVPFDAKAADAPLLTEAA---------
A0A444BL03      VRRQLDTRL----RSA----QDVEAATGASVLGVVPVTSELRVQGGRGRLD---------
A0A4Y8X357      LRRLLDVNV----RTT----TDATQASGAGLLGAIPQDKTMTAERTDRLGD---------
R4LD52          LREVLDTTV----KTV----EGLQALAAAPVLAAVPFDDDAKEGPRALLGT---------
A0A4T2CD79      VRNVLDRRI----RTA----ATIQQQFKLAVIGVLPKDAALTDENRIVSETGGIHAGSVT
A0A6L6AM03      GRRLIDRRI----RSA----KHVEDATGASVLGIIPKEDALGRVHRGVRGD---------
A0A4Q2RU39      ARRLIDRRV----RSA----KHVEEATGAAVLGVIPKEEVLGRTHRGVRGD---------
A0A4Q2SK58      ARRLIDRRV----RSA----KHVEEATGASVLGIIPKEEALGRSHRGVRGD---------
A0A2N3YJR1      VRRQLDTRV----RSA----EDVEKETGASVLGVVPVTPELRAARGRGRLD---------
A0A6G8FYB9      VRRQLDTRL----RTV----GDVEELTAASVLGVVPQTKELGVVRGRGRVG---------
A0A4Q4D742      VRDLLDRTV----KSR----RDVETITSSAVLATLPFYPQVKKEP--LSAE---------
A0A1C6T1J1      LRGMADVRL----RDA----AGLQRVTGSPLLGEIPLDTAARTAPLIVGEA---------
A0A2W2CFC8      LRGIADLRV----RDG----ASLRRVTDSPLLGEIPLDNDARTAPLIIGVA---------
A0A2W2A4B0      LRWALDTKV----RGR----DEVQELWDLPVLGDIGFDPEASKQPLVLRDA---------
A0A4Y9MDA5      LRDRLDNRV----RDT----GVVAELTSLPVVGSIPTRPAGSTPGAVVDAD---------
A0A1H7N9P7      ARDRLDTRV----RDA----AVVAQLTGLPVVGSIPTRPSGSTAHPAVDAD---------
A0A1M7V0F8      VRDLLDNRV----RDA----GVVAELTGVPVVGAIPARSPRSAPGAVVETD---------
A0A1M3LEY6      LIEVLDTRI----RGE----ANVRQITDAPILGGIAFDKLAPKRPLIVQSEPNSP-----
A0A538AJI7      LLERGRPRL----RSW----RDLARASGYPVVGRIPPSRALKQGPLAAFSDLRT------
A0A538AM15      AFE---------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A6N6NKS9      ------------------LSNASKTLFANIRFVSI-------------------------
A0A538BYZ4      ------------------AAEQYRGLRHLVEQFHK-------------------------
A0A348NU28      ------------------TSEEFRRIRAALSYSGV-------------------------
A0A2N4T4Q5      ------------------FSEALRELRTNLSFVSV-------------------------
A0A4Q5APW3      ------------------VAEGFRRVRTNLSFMAP-------------------------
A0A4Q5B0V3      ------------------VAEGFRRVRTNLSFMAP-------------------------
A0A022KX11      ------------------HAEAVRRLRTNLMFVDV-------------------------
A0A4Q5A868      ------------------VAEGFRRVRTNLSFMAP-------------------------
A0A6N4VXX3      ------------------IAESFRKLRTNLSFLAV-------------------------
A0A1H4I042      ------------------IAESFRKLRTNLSFLSV-------------------------
A0A4R7A6D9      ------------------IAESFRKMRTNLSFLSV-------------------------
A0A1Q2CRV2      ------------------RAEAYRSMRTNLQFLAL-------------------------
A0A7K0NRJ7      ------E-----------TVEAFRVLRTNLMVLEA-------------------------
K6WHS4          FGVGGSP-----------AAEAFRHLRTNLSFMDV-------------------------
A0A1L2ZMQ6      TDRSYHA-----------YSEALRELRTNLAYMDV-------------------------
A0A3E2DN22      IVHISGV-----------TGEAFRHLRTNLRFANV-------------------------
A0A3Q9ULZ9      DLGLSGI-----------TAEAFRQLRTNLRFINV-------------------------
A0A3S9JFL2      DLELAGI-----------AGEAFRQLRTNLRFINV-------------------------
A0A7K0NTR2      AADPTSL-----------MAEAYRSFRTSLVAMWH----------------------RHP
A0A1H6WL79      RVPGGHA-----------MAEALRELRTNLNFIDV-------------------------
A0A101LAM5      RVPGGHA-----------MAEALRELRTNLDFIDV-------------------------
A0A4Y3NEG0      RVPGGHA-----------MAEALRELRTNLDFIDV-------------------------
A0A1Q2CI19      VTQPLSP-----------YADGYRSVRAALAHGQA-----------------EAAPA---
A0A512T3M3      VTEPLSP-----------FADGYRAARTAISHTLG-----------------RSAKPSDM
W6JTW4          LDQPLSP-----------FADAYRAARAATTHSVE-----------------TSRAAAPR
A0A0A0JTY0      ATDPLSI-----------YSDGYRAARTALVHTTG-----------------QVMPGDYT
A0A0A0JXF2      VEDPLNL-----------YSDAYRAARTALSHTAG-----------------QVMPSDYT
E6S8H2          ADEPLSP-----------YADGYRGARTALVHTSS-----------------LLVQGD--
A0A0A0JGH0      AVDPLSP-----------YSDAYRAARTALMHTVS-----------------RQAPGEYM
N0E4U7          AADPLDP-----------YSDAYRAARTALMHTVS-----------------RKMTGDYT
A0A0A0IYK2      AEDPLSN-----------YSDGYRAARTALVHTTG-----------------QIMPGDYT
A0A0Q9L0H3      ASDPLSN-----------YSDGYRAARTALVHTSG-----------------QIMPGDYT
A3TMK0          LEDPLSL-----------YADGYRAARTALTHTAG-----------------QVMPGDYS
A0A543PXP1      AEQPLSP-----------YSDSYRAARTALAHTAS-----------------QHAGASVS
A3TMH6          AEQPLSP-----------YADAYRGARTAIVHTAS-----------------QRLSVGSA
A0A6I2XCV4      LDAPRSR-----------TAELYRTVRTSILFAIE----------------------AES
A0A5R8VLL6      SRPQSPA-----------FSEALRELRTNLTFLDV-------------------------
A0A3L7ADK2      SRHASFA-----------MAESLRELRTNLSYVDV-------------------------
A0A538JQF8      FNRPLSP-----------LAEGYRVLRTSLLRMPTRVFTEAPPTPDASGGHPEVEAAAAV
A0A1H6YPK1      GAVPGFA-----------FTEAMRQLRTNLQFMNV-------------------------
A0A0Q9TBP0      LVDPHSP-----------ASEEYQRLGVNVRFMVAT------------------GA----
A0A0G3V3M7      AVDPTSL-----------MAEAYRSFRTSLVAMWQR------------------HPTNNR
A0A6I3DD56      AVDPTSL-----------MAEAYRSFRTSLVAMWQR------------------HPTNNR
A0A5Q2FA83      SSDPHGV-----------AAEEYRRLRTNLQFADVT------------------------
A0A2R7MGI0      DGRGSFA-----------HKEAIRELRTNLQYVDV-------------------------
A0A2T7WQY4      DGRGSFA-----------HKEAVRELRTNLQYVDV-------------------------
A0A1G6GTN3      DGRGSFA-----------HKEAMRELRTNLQYVDV-------------------------
A0A1N7DLV3      DGRGSFA-----------HKEAMRELRTNLQYVDV-------------------------
A0A1V2NSB5      DGRGSFA-----------HKEAMRELRTNLQYVDV-------------------------
A0A0Q5Q5L3      DGRGSFA-----------HKEAMRELRTNLQYVDV-------------------------
A0A0Q6DVM4      DGRGSFA-----------HKEAMRELRTNLQYVDV-------------------------
A0A1R3WWR6      DGRGSFA-----------HKEAMRELRTNLQYVDV-------------------------
A0A2S5WZJ5      ANDADAI-----------AAESFRRLRTNLRFASV-------------------------
A0A0Q5JKD6      DGRGSFA-----------HKEAMRELRTNLQYVDV-------------------------
A0A2W6DK08      ASEPESS-----------AAEAYRSLRSSIMFTENR------------------MNHFDR
A0A2S0LQ32      NVDGLGQ-----------AAEAIRLLRTNLRFVDV-------------------------
A0A2N6V1R5      NVDGLGQ-----------AAEALRHLRTNLRFVDV-------------------------
G9PHS6          NVDGLGQ-----------AAEALRHLRTNLRFVDV-------------------------
U1PLM7          NVDGLGQ-----------AAEALRHLRTNLRFVDV-------------------------
A0A346XTB0      LLRVDPS-----------AAEAYEFVLSSIEFALA-------------------------
A0A6I1G2U1      ADEPHGV-----------YADGYRTARAAVMHTASL------------------EVGRSE
A0A351ETF8      IERPKSL-----------AAERYEAVLTAIEFASI-------------------------
A0A542FTE6      ---SHFA-----------ITEGIRELRTNLAYVSI-------------------------
A0A349B7N2      AERPRSR-----------IAEAYRGLRTSVQYMGVV------------------TSRVGE
A0A7J5B4S5      SNDADAI-----------AAESFRRLRTNLRFASV-------------------------
A0A4Q2JUT1      GRTGTFA-----------VSEALRSLRTNLQFMDV-------------------------
A0A6L5R0V7      GRSGTFA-----------VSESLRSLRTNLQFMDV-------------------------
A0A2S5UYV0      SNDADAI-----------AAESFRRLRTNLRFASV-------------------------
A0A2S5X9U6      TNDADAI-----------AAESFRRLRTNLRFASV-------------------------
A0A2S5ULV5      TNDADAI-----------AAESFRRLRTNLRFASV-------------------------
A0A653YMF0      TNDADAI-----------AAESFRRLRTNLRFASV-------------------------
A0A3Q9IY80      SHADLFG-----------VSEAMRELRTNLQFMDV-------------------------
A0A0F0LP73      DAIARAV-----------AHEAHRQIRTGLRFASV-------------------------
A0A346Y185      VEAPKSP-----------AGEAYQFLVGALAFALA-------------------------
A0A4V1VGV9      GLGELGT-----------TAEAFRMLRTNLRYIST-------------------------
A0A7G8U6P0      GLGELGT-----------TAEAFRMLRTNLRYIST-------------------------
A0A259S8H9      AALARAV-----------AHEAYRQIRTGLRFASV-------------------------
A0A2W1Z497      VNFATS--------------EALRELRTNLSYVHV-------------------------
A0A0Q5L115      VNFAMS--------------EALRELRTNLAYVKV-------------------------
A0A7G6YY64      VNFAMS--------------EALRELRTNLAYVKV-------------------------
A0A1F1X071      PEPTSFP-----------SREALRKLRTNLRYIDV-------------------------
A0A3R8RWC7      PEPASFP-----------SREALRKLRTNLRYIDV-------------------------
A0A4U0RJZ4      GLGALGS-----------TSEAFRMLRTNLRYVLA-------------------------
A0A4R1FGL9      GLGALGS-----------TSEAFRMLRTNLRYVSA-------------------------
E3B8H1          GLGALGS-----------TSEAFRMLRTNLRYVSA-------------------------
A0A7D7WDT9      DSLTETV-----------ANEAFRQLRTSLRFANV-------------------------
A0A0Q5AWK6      ET-VDRI-----------TAEAYRALRTGLRFSSV-------------------------
A0A6P1F176      RA-VDGI-----------TAEAFRALRTGLRFSSV-------------------------
A0A3N1NLD3      ---VDGI-----------TAEAFRALRTGLRFSSV-------------------------
A0A3N2FVI8      ---VDGI-----------TAEAFRALRTGLRFSSV-------------------------
A0A2S5XDQ6      ---TDAL-----------TAEAFRSLRTGLRFSSV-------------------------
A0A2S5XNN6      ---TDAL-----------TAEAFRSLRTGLRFSSV-------------------------
A0A3L8NYD3      VGSQTGP-----------AAEALRQLRTNLRFVDV-------------------------
A0A1M6K628      LVNDSGT-----------AAEALRQLRTNLRFVSV-------------------------
A0A561E8R3      GDTGLGN-----------AAEALRMLRTNLRFIDV-------------------------
A0A345NSU7      ------------------QAEAVRQLRTNMMFVDV-------------------------
A0A222TG79      ------------------ASEAYRRLRTNLSFIGV-------------------------
A0A0W8I9Y2      ------------------FSEALRELRTNLSFVSV-------------------------
A0A7C6LSF9      ------------------YADGYRTARAAVMHTAS-------------------------
A0A255G8R8      ------------------RFEAYRRLRTNVQFVA--------------------------
A0A6G7Y423      ------------------A-EAYRRLRTNVGFVAL-------------------------
A0A4Q4D4T1      ------------------RAEAMRIIRTNLQFLDV-------------------------
A0A261FE22      ------------------AAEEFRRLITNLSFVKN-------------------------
A0A5C8C085      AGQS--------------AAEAFRKLRTNLQFMNV-------------------------
A0A4Y5YMQ6      ------------------AAEAFRQVRSALRFSAV-------------------------
A0A1E4BP96      A-----------------LTEAIRELRTNLQFMDV-------------------------
A0A151BT98      ------------------MVEAMRRLRTNVKFVNV-------------------------
A0A2Y8ZRF8      ------------------MVEAMRRLRTNVKFVNV-------------------------
A0A2R9UAT1      ------------------VSEALRELRTNIQFMDV-------------------------
A0A4Q5J5D7      RSE---------------SAEAFRKLRTNLQFMDV-------------------------
A0A3S0V9U6      ------------------SAESLRQLRTNLRFVSV-------------------------
A0A1S2N0P2      ------------------SEEALRQLRTNLRFVSV-------------------------
A0A0Q3BEY5      ------------------SEEALRQLRTNLRFVSV-------------------------
A0A4R6Q3C6      ------------------SEEALRQLRTNLRFVSV-------------------------
A0A2X3GKL3      ------------------SEEALRQLRTNLRFVSV-------------------------
A0A1Y4CKD6      HG----------------FRESARAMGARVRDALS-------------------------
A0A0Q7KBQ4      ------------------LAEAFRVLRTNLQFANL-------------------------
A0A5Q5BFU2      ------------------IAEAFRKLRTNLQFLAV-------------------------
A0A439DNZ6      ------------------FAEAFRKLRTNLQFLAV-------------------------
A0A7I7UD03      ------------------IAEAFRKVRTNLQFLAV-------------------------
A0A7I7MI62      ------------------IAEGFRKLRTNLQFLAV-------------------------
A0A0J6YE86      ------------------IAEAFRKLRTNLQFLSV-------------------------
A0A7I7K1R9      ------------------IAEAFRKLRTNLQFLSV-------------------------
A0A7I9ZLK4      ------------------IAEAFRKVRTNLQFLAV-------------------------
A0A1F1IHY9      DGETSPKQHQDSFR----LTESFKELRTNLQFLRP-------------------------
A0A7H2BCD6      ------------------SQESIRQLRTNLRFVNV-------------------------
A0A542HCT5      DPVH--------------SAESFLKLRTNLQFMDI-------------------------
A0A0Q5M6Z7      T-----------------ISESLRELRTNLSYIDV-------------------------
A0A7G6YA19      A-----------------ISESLRELRTNLSYIDV-------------------------
A0A2S8WHZ8      HA----------------FSESLRELRTNLNYIDV-------------------------
A0A537WNY9      ------------------FAEALRDVRTNLLFTEG-------------------------
A0A5B8M469      ------------------SAESFRQVRTGLRFSSV-------------------------
A0A1Y4CTD2      VSMG--------------FAEANRRTATRLEAHLR-------------------------
A0A3N3ZPU0      A-----------------TSEAFRQLRTNLTFANV-------------------------
A0A359IQX7      ------------------ASEAFRHLRTNLRYVNV-------------------------
A0A433EDP2      ------------------AQESIRQLRTNLRFVNI-------------------------
A0A231VTW0      ------------------AQESIRQLRTNLRFVNI-------------------------
A0A433ECD0      ------------------AQESIRQLRTNLRFVNI-------------------------
U7V3Z1          ------------------AQESIRQLRTNLRFVNI-------------------------
A0A1F1J417      ------------------AHESIRQLRTNLRFVNI-------------------------
A0A2A8D6P2      ------------------AHESIRQLRTNLRFVNI-------------------------
A0A1F0THV9      ------------------AHESIRQLRTNLRFVNI-------------------------
A0A5F0M6Y0      ------------------AHESIRQLRTNLRFVNI-------------------------
E3H5W1          ------------------AHESIRQLRTNLRFVNI-------------------------
A0A1F1QKB0      ------------------AHESIRQLRTNLRFVNI-------------------------
A0A509JY23      ------------------AHESIRQLRTNLRFVNI-------------------------
A0A448USF4      ------------------AHESIRQLRTNLRFVNI-------------------------
A0A0Q9LZR0      DPVH--------------SAESFLKLRTNLQFMDI-------------------------
A0A1N7E3F1      ------------------RAEAFRSLRTNLQFIGV-------------------------
A0A544ZKQ1      ------------------RAEAFRSLRTNLQFIGV-------------------------
A0A372P1T1      ------------------RSEAFRSLRTNLQFIGV-------------------------
A0A5D0Q2X0      ------------------RSEAFRSLRTNLQFIGV-------------------------
A0A5R8Z2E7      ------------------RSEAFRSLRTNLQFIGV-------------------------
A0A1L2ZMV4      -------------KQGWATSEALRELRTNLTFSRV-------------------------
A0A6I3F378      ------------------AVEAYRWLRTSVQFAGT-------------------------
A0A1S1CQC5      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1E9T6I0      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1F1GHA7      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1S1CAD0      ------------------AQESIRQLRTNLRFVNV-------------------------
G5ET14          ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1E9DXX2      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1E8S156      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1E8S5S2      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1S1DFA8      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A2I1Z490      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1F0DAA9      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1F0PHK9      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1F0VZG6      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1E9G8X4      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1E9IAW2      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1E9ZBC9      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1E9ZDP4      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1F0R6B5      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1F0Z7N5      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1F1D897      ------------------AQESIRQLRTNLRFVNV-------------------------
D2NP38          ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1F1FV74      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1E9M791      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A291DEI8      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1S1D5T1      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1E8TRD6      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1F0XT88      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1F1EVP5      ------------------AQESIRQLRTNLRFVNV-------------------------
C6R548          ------------------AQESIRQLRTNLRFVNV-------------------------
A0A0K2RXS2      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A1F0KX60      ------------------AQESIRQLRTNLRFVNV-------------------------
A0A542I3V2      RNRA--------------FVEALRALRTNLRFVDV-------------------------
A0A2T0UZ65      --LG---------L----AGESFRQIRTNLRFVSP-------------------------
A0A1R4JTI6      SRSALLELTGHTGRDDFHVVEAFKELRTNLQFLRP-------------------------
A0A4R7TM52      KHF----------R----VAEAMRELRTNIQFMDV-------------------------
A0A542XE74      -VSG---------A----AGEALRQLRTNLRFVSV-------------------------
A0A0Q7QDF6      -------------P----RAEAMRIIRTNLQFLDV-------------------------
A0A5R8L819      -------------A----MSEAMRELRTNIQFMDV-------------------------
A0A7K0PFV4      -------------P----VREAFRTLQIQLDLQPK-------------------------
A0A0G3V3F3      -------------E----TVEAFRVLRTNLMVLEA-------------------------
A0A7K0MUQ7      -------------E----TVEAFRVLRTNLMVLEA-------------------------
A0A7K0U619      -------------E----TVEAFRVLRTNLMVLEA-------------------------
A0A6I3DFP2      -------------E----TVEAFRVLRTNLMVLEA-------------------------
A0A7K0SI36      -------------E----TVEAFRVLRTNLMVLEA-------------------------
A0A7K0V140      -------------E----TVEAFRVLRTNLMVLEA-------------------------
A0A261FQA1      -PSS---------K----AAEDIRRLALNLDFIVP-------------------------
A0A1Q2CJ92      ---S---------A----AAEAIRQIRTNLRFVSV-------------------------
A0A2T0S3C8      -GHS---------P----RSEALRQLRTNLQFVDV-------------------------
A0A4Y8WZJ3      DGETSPKQHQDSFR----LTESFKELRTNLQFLRP-------------------------
A0A285VUW0      DPFG---------P----QAEAIRKLRTNLVFVDV-------------------------
A0A2R7Z032      --LG---------Q----AAEAFRQLRTNLRFLDV-------------------------
A0A6J4MTQ2      --LG---------Q----AAEAFRQLRTNLRFVDV-------------------------
A0A1I0W453      --LG---------K----AAESFRQLRTNLRFVDV-------------------------
A0A1H4LCS9      --LG---------R----AAESFRQLRTNLRFVDV-------------------------
A0A4Q2RZP8      --LG---------R----AAESFRQLRTNLRFVDV-------------------------
A0A0Q6VV12      --LG---------R----AAESFRQLRTNLRFVDV-------------------------
A0A495NTA9      --LG---------R----AAEAFRQLRTNLRFVDV-------------------------
A0A0Q9QB08      --LG---------R----AAEAFRVLRTNLRFVDV-------------------------
A0A4Q2SA86      --LG---------R----AAEAFRQLRTNLRFVDV-------------------------
A0A4Z1C3Z0      --LG---------R----AAEAFRLLRTNLRFVDV-------------------------
A0A6V8KDX4      --SC---------S----RSESLRHLRTNLQFADV-------------------------
A0A444BL03      -HLG---------I----ASESFRQIRTNLRFVGV-------------------------
A0A4Y8X357      -PSP---------R----AAEAVRQLRTNLRFAAV-------------------------
R4LD52          -GHS---------A----RAEALRQLRTNLQYVDV-------------------------
A0A4T2CD79      VQSR---------P----LAEAFRELRTNMRFMRV-------------------------
A0A6L6AM03      --LG---------R----AAEAFRQLRTNLRFVDV-------------------------
A0A4Q2RU39      --LG---------R----AAEAFRQLRTNLRFVDV-------------------------
A0A4Q2SK58      --LG---------K----AAEAFRQLRTNLRFVDV-------------------------
A0A2N3YJR1      -ALG---------A----SAESFRQIRTNLRFVGV-------------------------
A0A6G8FYB9      -QLG---------I----ATEAFRQIRTNLRFVGV-------------------------
A0A4Q4D742      -TGG---------N----LAEAFRVLRTNLQFVKL-------------------------
A0A1C6T1J1      -ATS---------A----RAEAVRKLRTNLRFVDV-------------------------
A0A2W2CFC8      -AAS---------A----RAEAIRKLRTNLRFVDA-------------------------
A0A2W2A4B0      -RAS---------A----RAEAFRSLRTNVQFLAS-------------------------
A0A4Y9MDA5      -PSG---------V----VAEAFRQLRTNLQFVGV-------------------------
A0A1H7N9P7      -PHG---------V----VAEAVRQFRTNLQFLGM-------------------------
A0A1M7V0F8      -SHS---------V----AAEAFRHLRTNLQFVGV-------------------------
A0A1M3LEY6      ------------------RAEAFRSLRTNLQFLDV-------------------------
A0A538AJI7      -------------------ASAFRILRANLEPQLR-------------------------
A0A538AM15      -------------------AEQYRALRHTVEQLHK-------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      -------------------AEEIRRLRTNVMFVLP-------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------VQNAAKTLYANIRFLSP-------------------------
A0A4R1CW45      ------------------RSRPFSLMRTQLAKRLV-------------------------
A0A4R5Z7B0      ------------------ISEQYRTIRTNIQYSSI-------------------------
A0A542H054      ------------------ISEQYKTVRTSINFSSV-------------------------
A0A6M8GFV5      ------------------FAEQYRTVRTNIQFSSI-------------------------
A0A7G8U6J2      ------------------ITEQYRLIRTNIQFSSV-------------------------
A0A419GS64      ------------------LAESYRTLRANILLTNV-------------------------
A0A2V2CXY5      ------------------VTEALNQFRINLGFCGD-------------------------
A0A2S8MDM2      ------------------TAEAFRKLRTNLQFLAI-------------------------
A0A357ZDL3      ------------------IQNAIKTLYANIRFLSP-------------------------
A0A4Y8ZIU8      -------------------------LRTNLRFAAV-------------------------
A0A1I6GVG4      ------------------IGEAMRELRTNLQYMDV-------------------------
A0A1I6IST1      ------------------IGEAMRELRTNLQYMDV-------------------------
A0A412JBM5      ------------------IREAYVRLRTNLMFCVN-------------------------
A0A6J4SUA1      ------------------MVEAFRSIRLALRHTFA-------------------------
A0A1C2B334      ------------------IAESYRRIRTNLAFAAV-------------------------
R7Y679          ------------------TAEQFRKIRTNLTFANV-------------------------
A0A0F0KYJ9      ----------------------MRELRTNLVYMDV-------------------------
A0A7M2YYB9      -------------------AEPFRMLRLAVDLRPR-------------------------
A0A538BBM6      -------------------REAVRVLRSNLQVALA-------------------------
A0A7K0LE65      -------------------VEAFRVLRTNLMVLEA-------------------------
A0A510HHA8      -------------------SEAYRTLRTGLLYAVV-------------------------
A0A6G8Q9J3      -------------------SEAYRGLRTNLLYAQV-------------------------
A0A5Q2F9A3      -------------------AEAFRRLRTNLQYLGR-------------------------
A0A4R1BMZ2      -------------------AEAYRTLRTNLLYALV-------------------------
A0A023X491      -------------------AEAYRTLRTSLLYSVV-------------------------
A0A6G8QDQ0      -------------------AEDYRTLRTSLLYTVV-------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      --------------------------RTNLSFLDV-------------------------
A0A1Q7WJN6      -------------------IEALRGVRLNVAYAH--------------------------
A0A6D1QMN1      -------------------SEQFKTLRTNIQFSSI-------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      -------------------AEQYRVLRHLVETLRK-------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      -------------------VEAFRLLRTNLQFLDL-------------------------
                                                                            

A0A6N6NKS9      --------------DEK----VKTIVVTSTGMDEGKTQVSTNLACAIA-SSG-KKVLIVD
A0A538BYZ4      --------------SAR----LSVLAVSSPASGDGKTTTAINLAGALA-QAPEARVLLVD
A0A348NU28      --------------AEK----VQRLMVTSVSPGEGKSMFASNLGLTLA-GLR-NNVLIID
A0A2N4T4Q5      --------------DAP----PRVVVVTSSMPGEGKSSITANLAVAIA-STG-RDVVVVD
A0A4Q5APW3      ------------VEDTN----CRLIVVTSIGASEGKTTTSVNIAAALA-ENG-AKVLLID
A0A4Q5B0V3      ------------VEDTN----CRLIVVTSIGASEGKTTTSVNIAAALA-ENG-AKVLLID
A0A022KX11      --------------TTG----RHSFVITSAVPGEGKTTTAVNLALAMA-DSG-RRTLLVD
A0A4Q5A868      ------------MEDTN----CRLIVVTSTGASEGKTTTSVNIAAALA-ENG-AKVLLID
A0A6N4VXX3      --------------DNP----PRVIVVTSSVPNEGKSTTAINLALALA-ETE-NNVVVVD
A0A1H4I042      --------------DNP----PRVIVVTSSIPNEGKSTTAVNIALALV-EVE-NNVLLVD
A0A4R7A6D9      --------------DNP----PRVIVVTSSIPNEGKSTTAVNIALALV-EVD-NNVLLVD
A0A1Q2CRV2      --------------DKG----GRSIVVTSSVPGEGKTSTAINLAATLA-AAG-EKVLLID
A0A7K0NRJ7      --------------AGR----PRTVAVVSNTQDAGKSFISINLAQSAS-ALD-DKVVLID
K6WHS4          --------------DSP----ARMIAVTSPSPGDGKTTVALNLAASLA-EAG-HSVLLVD
A0A1L2ZMQ6      --------------DNP----PRVIVVTSSVPGEGKSSLSANLAVTIA-HTG-QKVIVVD
A0A3E2DN22      --------------DNP----PRAVVVTSANPGEGKSTVSTHLAVVMA-QAG-EKVVLID
A0A3Q9ULZ9      --------------DHP----PKAVVITSANPGEGKSTVGSYLARAVA-RSG-QATVLVD
A0A3S9JFL2      --------------DHP----PKAVVVTSANPGEGKSTVCSYLARSVA-RSG-QATVLVD
A0A7K0NTR2      VNNPSGKTGSQDTEPLP----LRLLLVTSPGPAEGKSISVVNLAAAFA-ETG-MSVVIID
A0A1H6WL79      --------------DNP----PRILLITSSLPSEGKSTVTSNLAATIA-AAG-RDVIVVD
A0A101LAM5      --------------DNP----PRILLITSSLPSEGKSTVTSNLAATIA-AAG-RDVIVVD
A0A4Y3NEG0      --------------DNP----PRILLITSSLPSEGKSTVTSNLAATIA-AAG-RDVIVVD
A0A1Q2CI19      -------------RGHQ----SLVVLVSSAHVAEGKSTSTANLAASFA-ETG-KQVLVID
A0A512T3M3      SPR-----ERRGTRTNH----TPWVLVTSANPGDGKTTSVGNLAASFA-ESG-KSVLVLD
W6JTW4          GPR-----E--NDPEPQ----AVAVLVTSAQPSEGKTTSVANLAASFA-ESG-RRVLVLD
A0A0A0JTY0      PRRAASEVPEKQ-AATG----ARLIVVTSAHAAEGKTTSVANLAASFA-ETG-QRVLVLD
A0A0A0JXF2      PRR--STVEPRR-SASS----ARLVLITSAHAAEGKTTSVANLAASFA-ETG-QKVLVVD
E6S8H2          DRR--PTSPPEPVSAAS----ASLILVTSAHPREGKTTSVANLAASFA-ETG-QRILVLD
A0A0A0JGH0      GRR--AARPEPRPVVEG----ARLILVTSGNAAEGKTTTVANLAASFA-ETG-QRVLVLD
N0E4U7          GRR--AATAERGGTATG----ARLILVTSANAAEGKTTTVANLAASFA-ETG-QRVLVLD
A0A0A0IYK2      PRR--SAAGARP-AAKG----ARLILVTSAHAAEGKTTSVANLAASFA-ETG-QRVLVLD
A0A0Q9L0H3      PRR--PGGEESR-SRQG----GRLVLITSAHAAEGKTTSVANLAASFA-ETG-QTVLVLD
A3TMK0          PRR--SAIEPRR-PANT----ARLVLITSAHASEGKTTSVANLAASFA-ETG-QQVLVLD
A0A543PXP1      STD--VPRGYAA---AQ----GRLILVTSAYPGEGKTTSVANLAASFA-ETG-LRVLVLD
A3TMH6          PRH--LLDGPAT-QLEG----ARVVLVTSAHPAEGKTTTVANLAVSFA-ESG-QRVLVLD
A0A6I2XCV4      LAALANSDSPDSPRNDR----TPVILVTSPSPGEGKTTTTANVASVFA-AAG-TRTLIVD
A0A5R8VLL6      --------------DNP----PRIIVVTSSVSGEGKSTIAANLASAMA-AAG-DPVIVVD
A0A3L7ADK2      --------------DNP----PQVFVVTSPNPGEGKSTLSANLAETLAVNSG-KNVVVID
A0A538JQF8      PSGVGEWRPVGDSNGAT----PKVVLVCSPRPREGKTMTVANLAVCLA-ESG-HTVLVLD
A0A1H6YPK1      --------------DHP----PRVLVVTSPVPGDGKSTMAVMLAAAIA-ESG-RDVVLVD
A0A0Q9TBP0      --------------QES----APIVLLTSGQESEGKTVTSCNLAVSAA-RLG-LNVVLID
A0A0G3V3M7      PVLAGASEPE----ATP----LRVLLVTSPGPAEGKSISVVNIAAAFA-ETG-ISVLLID
A0A6I3DD56      AGLSGSSEPE----ATP----LRVLLVTSPGPAEGKSISVVNIAAAFA-ETG-MSVLLID
A0A5Q2FA83      --------------TGG----KHSFVISSVMPGEGKTTTAVNLAIALA-DSG-ANVVLVD
A0A2R7MGI0      --------------DRP----PRVIVVTSPLPGDGKSTTAANLAVSIA-ATG-QSVILID
A0A2T7WQY4      --------------DHP----PRVIVVTSPLPGDGKSTTAANLAVSIA-ATG-QSVILID
A0A1G6GTN3      --------------DRP----ARIVVVTSPLSGDGKSTTAANLAVSIA-ATG-QSVVLID
A0A1N7DLV3      --------------DRP----PRVMVVTSPLPGDGKSTTAANLAVSIA-ATG-QSVILID
A0A1V2NSB5      --------------DRP----PRVMVVTSPLPGDGKSTTAANLAVSIA-ATG-QSVILID
A0A0Q5Q5L3      --------------DRP----ARIMVVTSPLPGDGKSTTAANLAVSIA-ATG-QSVILVD
A0A0Q6DVM4      --------------DRP----ARIMVVTSPLPGDGKSTTAANLAVSIA-ATG-QSVILVD
A0A1R3WWR6      --------------DRP----ARVMVITSPLPGDGKSTTAANLAVSIA-ATG-QAVVLID
A0A2S5WZJ5      --------------DEE----IRSMVITSSNAGEGKSTIATSLAQVLA-QSN-TPTILID
A0A0Q5JKD6      --------------DRP----ARVLVVTSPLPGDGKSTIAANLAVSIA-ATG-QSVVLID
A0A2W6DK08      EDMVLDRSAVDT--TQP----PQVILVASACAAEGKTATVVNLAACFA-EVG-KRVLVLD
A0A2S0LQ32      --------------DNP----PRAIVMTSANPGEGKSTISAVLAQMLA-ASG-QRTILVD
A0A2N6V1R5      --------------DNP----PRAIVMTSANPGEGKSTMSAVLAQMLA-SSG-QRTVLID
G9PHS6          --------------DNP----PRAIVMTSANPGEGKSTMSAVLAQMLA-SSG-QRTVLID
U1PLM7          --------------DNP----PRAIVMTSANPGEGKSTMSAVLAQMLA-SSG-QRTVLID
A0A346XTB0      --------------DLD----GKSLLITSTLPGDGKTTTTLQLAIAAS-RDR-RRVVLVD
A0A6I1G2U1      SALAERRRAR----QGH----AKVVMVTSAQAGEGKSTSVANLAASFA-ETG-KSVLVLD
A0A351ETF8      --------------GEP----VSSVLFTSAVPGDGKTTTAVNVAALAS--KY-MNVLLVD
A0A542FTE6      --------------DDP----PSVVVVVSASPGEGKSTVAANLADAVA-ASG-RPVIVVD
A0A349B7N2      SPSDLRRQQTKRRDRSD----GTVVLVTSPGPAEGKSTTVVNLAAAYA-ESG-SRVLIVD
A0A7J5B4S5      --------------DEE----IRSMVITSSNAGEGKSTIATSLAQVLA-QSN-TPTILID
A0A4Q2JUT1      --------------DHP----PKTIVVTSPLPGDGKSTIACNLALTLA-AAG-STVVLVD
A0A6L5R0V7      --------------DHP----PKTIVVTSPLPGDGKSTIACNLALTLA-AAG-TTVVLVD
A0A2S5UYV0      --------------DEE----IRSMVITSSNAGEGKSTIATSLAQVLA-QSN-TPTILID
A0A2S5X9U6      --------------DEE----IRSIVVTSANAGEGKSTVSTSLAQVLA-QSN-TPTILID
A0A2S5ULV5      --------------DEE----IRSIVVTSANAGEGKSTVATSLAQVLA-QSN-TPTILID
A0A653YMF0      --------------DEE----IRSIVVTSANAGEGKSTVATSLAQVLA-QSN-TPTILID
A0A3Q9IY80      --------------DNP----PRIIVVTSPLPGDGKSTTSANLAITLA-ANG-SKVVLID
A0A0F0LP73      --------------DQE----VRVVMVTSANLGEGKSSTTRTLARVLA-ESG-QRTLVID
A0A346Y185      --------------ETG----GQSVVLTSASPVDGKTVTCLNLAVASA-QDG-RDVVLVD
A0A4V1VGV9      --------------ERP----PRSLVITSAMQSEGKSTVAANLARVLS-AAG-QSVVLVD
A0A7G8U6P0      --------------ERP----PRSLVITSAMQSEGKSTVAANLARVLS-AAG-QSVVLVD
A0A259S8H9      --------------DQE----VRVVMVTSANLGEGKSETTRALARVLA-ESG-QRTLVID
A0A2W1Z497      --------------DER----PKVLVVTSPLPGDGKSTIAANLARSLAVTST-GRVVLID
A0A0Q5L115      --------------DAQ----PRVIVMTSPQPGDGKSTLAANLAESLAVSSD-QRVVVID
A0A7G6YY64      --------------DAQ----PRVIVMTSPQPGDGKSTLAANLAESLAVSSD-QRVVVID
A0A1F1X071      --------------DNP----PRSIVVTSSAPGEGKSTVAANLARVMA-RAG-QPTLLVD
A0A3R8RWC7      --------------DNP----PRSIVVTSSAPGEGKSTVAANLARVMA-RAG-QPTLLVD
A0A4U0RJZ4      --------------EQP----PRSLVITSAVQSEGKSTVASNLARVLA-AAG-QHVVLVD
A0A4R1FGL9      --------------EQP----PRSLVITSAVQSEGKSTVASNLARVLA-AAG-QHVVLVD
E3B8H1          --------------EQP----PRSLVITSAVQSEGKSTVASNLARVLA-AAG-QHVVLVD
A0A7D7WDT9      --------------DSE----VRVVMVTSANQGEGKSMTASSLARVIA-ESG-ERTLIID
A0A0Q5AWK6      --------------DDE----TRSVVITSANQAEGKSTIASGLARVTA-DSG-QRTLLID
A0A6P1F176      --------------DDE----TRSVVITSANQAEGKSTIASGLARVMA-DSG-QRTLLID
A0A3N1NLD3      --------------DDE----TRSVVITSANQAEGKSTIASGLARVTA-DSG-QRTLLID
A0A3N2FVI8      --------------DDE----TRSVVITSANQAEGKSTIASGLARVMA-DSG-QRTLLID
A0A2S5XDQ6      --------------DEE----TRSVVITSANQAEGKSTIAAGLARVTA-ESG-QRTLLVD
A0A2S5XNN6      --------------DEE----TRSVVITSANQAEGKSTIAAGLARVTA-ESG-QRTLLVD
A0A3L8NYD3      --------------DKP----PQSIVITSANAGEGKSVVTANLARVLA-AAG-QKTILLD
A0A1M6K628      --------------DTP----VRSIVVTSPSQGEGKSTIAMQLAALLA-ESG-EPTVLID
A0A561E8R3      --------------DRH----PRSIVVTSPNPGEGKSTVAANLARVLA-AAG-QPVVLID
A0A345NSU7      --------------TTG----KHSFVISSTLPGEGKTTTAVNLALAMS-DAG-TKVLLID
A0A222TG79      --------------DSP----HRRFAVTSALEGEGKTTTAVNLAVCLS-EVG-YKVVVVD
A0A0W8I9Y2      --------------DSP----PKMIVVTSALPGEGKSSITANLAVAIA-STG-RNVVVVD
A0A7C6LSF9      ---LGFGRGGTEAHELARSTGARVVLVTSAQAGEGKTTSIANLAASFA-ETG-QSILVLD
A0A255G8R8      --------------APQ---GRTALVVTSSVPGEGKSVTVANLALAMA-DAG-NRTLLID
A0A6G7Y423      --------------GGE---RRRSMVITSSVQGEGKTQTAVNLARVLA-SAG-ESVLLVD
A0A4Q4D4T1      --------------DRV----SNVYVVTSSVAGEGKTTTASNLAISLA-QSG-QNVVLVD
A0A261FE22      --------------DRGNR--GNVLVVTSAMLGEGKTTVSVNIAATFV-EKG-ESVLLID
A0A5C8C085      --------------DNP----PRIIVVTSSKPGDGKSTVTANLAAAIA-ASG-APVILVD
A0A4Y5YMQ6      --------------EHQ----IGVLAVTSSIAGEGKTTMSVNTALAFA-EMG-NRVLLVD
A0A1E4BP96      --------------DDP----PRSIVVTSPLPGDGKSTTAANLAMSLA-AAG-QRVVLID
A0A151BT98      --------------TND----VPAVVVTSARPGDGKTTVAANLALAMA-RDG-YRTVLVD
A0A2Y8ZRF8      --------------TND----VPAVVVTSARPGDGKTTVAANLALAMS-RDG-HRTLLVD
A0A2R9UAT1      --------------DHP----PRVVVVTSPLPGDGKSTMSANLALAMA-ASG-QQVVLID
A0A4Q5J5D7      --------------DNP----PRVIIITSPQQGDGKSTVAANLAGALA-VSG-EPVILID
A0A3S0V9U6      --------------DQP----PRSIIVTSPNPGEGKSTVTSSLAHAFA-KAG-QPTVLID
A0A1S2N0P2      --------------DAP----PRSIIVSSPNPGEGKSTVSASLAHAFA-KAG-QPTILID
A0A0Q3BEY5      --------------DAP----PRSIIVSSPNPGEGKSTVSASLAHAFA-KAG-QPTILID
A0A4R6Q3C6      --------------DAP----PRSIIVSSPNPGEGKSTVSASLAHAFA-KAG-QPTILID
A0A2X3GKL3      --------------DAP----PRSIIVSSPNPGEGKSTVSASLAHAFA-KAG-QPTILID
A0A1Y4CKD6      --------------ERG----AKVVLVTSSIAGEGKSTVAINLAEQLA-QDG-SRVLLVD
A0A0Q7KBQ4      --------------DAK----VESILVSSAVPNEGKTLVATNLAMSMA-QSG-RSVLLID
A0A5Q5BFU2      --------------DNP----PRVIVLTSSVPHEGKSTTAINIALALA-EAE-HNVVLVD
A0A439DNZ6      --------------DNP----PRVIVVTSSMPGEGKSTTAINLALVLA-EAE-HNVVLVD
A0A7I7UD03      --------------DNP----PRVIIVTSSVPNEGKSTTAINIALALA-EAE-HNVLLID
A0A7I7MI62      --------------DNP----PRVISVTSSMPHEGKSTTAINIALSLA-EAE-HNVVLVD
A0A0J6YE86      --------------DNP----PRVIVITSSMPHEGKSTTAINIALALA-EAE-HNVVLVD
A0A7I7K1R9      --------------DNP----PRVIVVTSSMPSEGKSTTAINIALALA-EAE-HNVVLVD
A0A7I9ZLK4      --------------DNP----PRVIVVTSSMPSEGKSTTAINIALALA-EAE-HNVVLVD
A0A1F1IHY9      --------------DEA----VSIVTVTSAHPGEGKSTVAANLAVPVA-ESG-QRVVLVD
A0A7H2BCD6      --------------DRP----PKSVLITSSEPGEGKSTVASTLAQALA-EAG-QPTIIID
A0A542HCT5      --------------DNP----PRIIVVTSPLPGDGKSTVAMNLAAALS-MSD-RRVILID
A0A0Q5M6Z7      --------------DQP----PKVIVVTSSIPGEGKSTLTANLADAIA-SAN-SNVVVID
A0A7G6YA19      --------------DNP----PKVIVVTSSIPGEGKSTLTANLADAIA-SGN-ANVVIID
A0A2S8WHZ8      --------------DNP----PRIIVVSSSVPGEGKSSVTANLAVAIA-STG-RNVVLID
A0A537WNY9      --------------GK-----LRSVLITSPEGSHGKTTISYGLAVTLA-RAG-TSTLLVD
A0A5B8M469      --------------DGE----VRCVVVTSPNQSEGKSTVAARLAAVIA-ESG-QPTLIID
A0A1Y4CTD2      --------------SGG----FKTVLVASVEENEGKSTVAANLAAALA-ERG-RRVLLID
A0A3N3ZPU0      --------------DDP----PRTVVVTSSVAGEGKSSVAANLAVTLG-ALG-QPTVLVD
A0A359IQX7      --------------DSP----PKCIVVTSANASEGKSTVAANLARVLA-ESG-QITLLVD
A0A433EDP2      --------------DEP----PRSFLVTSAVPSEGKSTVSLSLARSMA-ESG-QAVILID
A0A231VTW0      --------------DEP----PRSFLVTSAVPSEGKSTVSLSLARSMA-ESG-QAVILID
A0A433ECD0      --------------DEP----PRSFLVTSAVPSEGKSTVSLSLARSMA-ESG-QAVILID
U7V3Z1          --------------DEP----PRSFLVTSAVPSEGKSTVSLSLARSMA-ESG-QAVILID
A0A1F1J417      --------------DNP----PSSFIVTSAVPGEGKSTVSLAVARSMA-SSG-QPVILID
A0A2A8D6P2      --------------DNP----PSSFIVTSAVPGEGKSTVSLAVARSMA-SSG-QPVILID
A0A1F0THV9      --------------DNP----PSSFIVTSAVPGEGKSTVSLAVARSMA-SSG-QPVILID
A0A5F0M6Y0      --------------DNP----PSSFIVTSAVPGEGKSTVSLAVARSMA-SSG-QPVILID
E3H5W1          --------------DNP----PSSFIVTSAVPGEGKSTVSLAVARSMA-SSG-QPVILID
A0A1F1QKB0      --------------DNP----PSSFIVTSAVPGEGKSTVSLAVARSMA-SSG-QPVILID
A0A509JY23      --------------DNP----PSSFIVTSAVPGEGKSTVSLAVARSMA-SSG-QPVILID
A0A448USF4      --------------DNP----PSSFIVTSAVPGEGKSTVSLAVARSMA-SSG-QPVILID
A0A0Q9LZR0      --------------DNP----PRIIVITSPLPGDGKSTVAMNLAAALS-MSD-RRVVLID
A0A1N7E3F1      --------------DRQ----PKSLVVTSCLPGEGKSSTSVNLAITMA-QAG-WRVVLVD
A0A544ZKQ1      --------------DRQ----PKSLVVTSCLPGEGKSSTSANLAITMA-QAG-WRVVLVD
A0A372P1T1      --------------DRQ----PKSLVVTSCLPGEGKSSTSANLAITMA-QAG-WRVVLVD
A0A5D0Q2X0      --------------DRQ----PKSLVVTSCLPGEGKSSTSANLAITMA-QAG-WRVVLVD
A0A5R8Z2E7      --------------DRQ----PKSLVVTSCLPGEGKSSTSANLAITMA-QAG-WRVVLVD
A0A1L2ZMV4      --------------DNP----PRIIVVTSALAGEGKSSIAANLAVTIA-QSG-SKVILID
A0A6I3F378      --------------DRN----LKVLQVTSAMPGEGKTTTTANLAIVLA-NAG-ALVLIVD
A0A1S1CQC5      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARSLA-DAG-SPVILID
A0A1E9T6I0      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARSLA-DAG-SPVILID
A0A1F1GHA7      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARSLA-DAG-SPVILID
A0A1S1CAD0      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
G5ET14          --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1E9DXX2      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1E8S156      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1E8S5S2      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1S1DFA8      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A2I1Z490      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1F0DAA9      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1F0PHK9      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1F0VZG6      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1E9G8X4      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1E9IAW2      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1E9ZBC9      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1E9ZDP4      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1F0R6B5      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1F0Z7N5      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1F1D897      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
D2NP38          --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1F1FV74      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1E9M791      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A291DEI8      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1S1D5T1      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1E8TRD6      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1F0XT88      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1F1EVP5      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
C6R548          --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A0K2RXS2      --------------DTP----PRSFIVTSAVPGEGKSTVSLSLARAMA-DAG-SPVILID
A0A1F0KX60      --------------DTP----PRSFIVTSAVPGEGKSTVSLALARAMA-DAG-SPVILID
A0A542I3V2      --------------DHR----PRIILVTSPMTSDGKSTVTGNLAVTMA-ATG-EPVVVVD
A0A2T0UZ65      --------------DAP----PQSIVVTSASPSEGKSTVSSTLASIIA-EDG-RPVVIID
A0A1R4JTI6      --------------DNP----PRIIVVTSAAPAEGKSTVAANAAITLA-QSD-VPTVLVD
A0A4R7TM52      --------------DRP----PRIIVVTSPLPGDGKSTTSANLAIILA-ASG-QRVVLVD
A0A542XE74      --------------DAP----PRSVVVTSPAPGDGKSTIAAQLARLMA-VAG-QPVVLID
A0A0Q7QDF6      --------------DRV----SNVYVVTSSVAGEGKTTTASNLAISLA-QSG-QNVVLVD
A0A5R8L819      --------------DHP----PRILVVTSPLPGDGKSTTSANLAVTLA-ASG-QPVVLVD
A0A7K0PFV4      --------------DG-----CRRILVTSASSGDGKTTAVLNLAFALV-SAG-HRVVLVD
A0A0G3V3F3      --------------AGR----PRTVAVVSNTQDAGKSFISINLAQSAS-ALD-DKVVLID
A0A7K0MUQ7      --------------AGR----PRTVAVVSNTQDAGKSFISINLAQSAS-ALD-DKVVLID
A0A7K0U619      --------------AGR----PRTVAVVSNTQDAGKSFVSINLAQSAS-ALD-DKVVLID
A0A6I3DFP2      --------------AGR----PRTVAVVSNTQDAGKSFVSINLAQSAS-ALD-DKVVLID
A0A7K0SI36      --------------AGR----PRTVAVVSNTQDAGKSFVSINLAQSAS-ALD-DKVVLID
A0A7K0V140      --------------AGR----PRTVAVVSNTQDAGKSFVSINLAQSAS-ALD-DKVVLID
A0A261FQA1      --------------DKTDM--SNVIVVASSDASEGKTTIAVNLAAAIA-ERG-RTVLLID
A0A1Q2CJ92      --------------DNP----AKSIVITSSNEGEGKSTLAANIAAMFA-DAG-EPTVLID
A0A2T0S3C8      --------------DRP----VKTLVITSAMPGEGKSSTACTLAGLFA-EAG-QRVLLID
A0A4Y8WZJ3      --------------DEA----VSIVTVTSAHPGEGKSTVAANLAVTVA-ESG-QRVVLVD
A0A285VUW0      --------------ASD---AGHSFVVTSSLSAEGKTTTVVNLGMAMA-ESG-RRVLVLD
A0A2R7Z032      --------------DNP----PRRIVITSALASEGKSTVSSNLARLVA-QAG-EKVVLID
A0A6J4MTQ2      --------------DRP----PRRIVITSALAGEGKSTVSANLARLVA-HAG-ESVVLVD
A0A1I0W453      --------------DNE----PRKIVVTSALAGEGKSTVSSNIARLVA-QAG-TPVLLID
A0A1H4LCS9      --------------DNE----PRRIVVTSALAGEGKSTVSSNIGRLVA-QAG-TPVLLID
A0A4Q2RZP8      --------------DNE----PRRIVVTSALAGEGKSTVSSNIARLVA-QAG-TPVLLID
A0A0Q6VV12      --------------DNE----PRKIVVTSALAGEGKSTVSANIARLVA-QAG-TPVLLID
A0A495NTA9      --------------DNE----PRKIVVTSALAGEGKSTVSSNIARLVA-QAG-TPVLLID
A0A0Q9QB08      --------------DNE----PRRIVVTSALAGEGKSTVSSNVARLVA-QAG-TPVLLID
A0A4Q2SA86      --------------DNE----PRRIVVTSALAGEGKSTVSANIARLVA-HAG-TPVLLID
A0A4Z1C3Z0      --------------DNE----PRRIVVTSALAGEGKSTVSANIARLVA-QAG-TPVLLID
A0A6V8KDX4      --------------DGP----VRTLVVTSAVPGEGKSTTAVNTAITFA-QAD-KRVLLID
A0A444BL03      --------------DDP----PRSIVVTSANAHEGKSTVSSTLARVLG-EAG-QRVVIVD
A0A4Y8X357      --------------DDP----PRVVMVTSSNPGEGKSTVIGSLAQAVA-ASG-QPVILID
R4LD52          --------------DRP----VKTLVVTSAVPGEGKSSTACGIAMLFA-QAG-QRVLIVD
A0A4T2CD79      --------------DSP----PRIIVISSPSPNDGKSTVTANLAVALS-AAG-QKVVVVD
A0A6L6AM03      --------------DNE----PRRIVVTSALAGEGKSTVSSNIARLVA-QAG-TPVLLID
A0A4Q2RU39      --------------DNE----PRKIVVTSALPGEGKSTVSANIARLVA-QAG-TKVLLID
A0A4Q2SK58      --------------DNE----PRKIVVTSALPGEGKSTVSANIARLVA-QAG-TPVLLID
A0A2N3YJR1      --------------DDP----PRSIVVTSANAGEGKSTVSATLARVLG-QSG-QSVVIVD
A0A6G8FYB9      --------------DDP----ARSIVVTSANAGEGKSTVAATLARVLG-ASG-QSVVIID
A0A4Q4D742      --------------DAE----RQAILVSSALPNEGKTLTATNLAISMA-QSG-RSVLLID
A0A1C6T1J1      --------------HEP----ARVIAVTSALQGEGKTTMSCNLAIALA-EAG-WRVLLVD
A0A2W2CFC8      --------------DEP----ARVIAITSALQGEGKTTLSCNLAITLA-EAG-WRVLLVD
A0A2W2A4B0      --------------RPE---GARTLAITSSRPSEGKTTTAANLAVALA-ESG-LRTVVID
A0A4Y9MDA5      --------------GDGDREGGRVTAITSSRPGEGKSTVAVDLAAALA-ETG-ARVLLVD
A0A1H7N9P7      --------------QDEERAGARIVAVTSSRSGEGKSTVAVELAAALA-ETG-TRVLLVD
A0A1M7V0F8      --------------QDEDQGGARVLAVTSSRPGEGKSTVAVNLAAALA-ETG-ARVLLVD
A0A1M3LEY6      --------------EGG----PRSFVVTSSVPSEGKSTTSANLAIVMA-QSG-ARVLLID
A0A538AJI7      --------------EGS----IDLIVVSSPAPADGKTTVTTLLGEALS-RLG-MRVLLID
A0A538AM15      --------------ARD----LRIVAVSSPGVGDGKTTTAINLAGALA-QASEARVLLVD
A0A519GXS6      --------------------------------GEGKTTTAVNLALAYV-ESG-QRVVLVD
A0A520EHH5      --------------DNP----PRILLVTSCIAGEGKSTTAVNLALSLA-ESG-NRVVLVD
A0A4R0U4F1      --------------DEPL---SNVIVVTSAGPSEGKTTLSVNLATAFA-ENG-SKVLLID
A0A1V8PLV6      -----------------------MIVISSVEPSEGKTTVSVNVAAALA-ENG-AKVLLID
A0A357ZCV8      --------------DKP----IKSIAITSSVPNEGKSTIALSLAQAIA-TSG-QTVLVVD
A0A4R1CW45      --------------EEK----IRLVGVTSASPAAGKSFLAVNLAASLS-RVLKVPTFLVD
A0A4R5Z7B0      --------------DKE----LKVLMVTSSGPGEGKSTTAANLAVVFA-QLG-KKVLLVD
A0A542H054      --------------DQH----IRSIVVTSSGPGEGKSTTAANLAVVFA-QEG-KNVLLVD
A0A6M8GFV5      --------------DKK----VKSILVTSSEPSEGKTTTIANLAVTYA-QQG-KKVLLVD
A0A7G8U6J2      --------------DKE----IKTIVVTSSEPNDGKSTTAANLAIVLA-QDE-KKVLLVD
A0A419GS64      --------------DSE----IGSVVVTSPDRGEGKSTICANLAIVMA-QAE-KRVLLID
A0A2V2CXY5      --------------E------VKTIMVTSSLPNEGKSFLVMQLWRMMA-EVG-TPTLLID
A0A2S8MDM2      --------------DSP----PRVLVVTSSVPSEGKSTTAINLALALA-EAD-HKVLLVD
A0A357ZDL3      --------------DNP----VKTIAITSSVPNEGKSTIALNLAQAIA-GSG-KTVLLVD
A0A4Y8ZIU8      --------------DDP----PRTIAFTSANPGEGKSTVIGSLAVAVA-ASG-QPVILID
A0A1I6GVG4      --------------DNP----PRIIVVTSPLPGDGKSTISSNLAVTLA-SSG-QPVVLID
A0A1I6IST1      --------------DNP----PRIIVVTSPLPGDGKSTISSNLAVTLA-SSG-QPVVLID
A0A412JBM5      --------------GDGDP--CTTFLVTSGSPSEGKSLTAANTAISFA-MLG-KKTLLVD
A0A6J4SUA1      --------------SDG----PVVLAVTSPGMGDGKSFVSSNLAMSFA-EAG-HRTLLID
A0A1C2B334      --------------DPA----SRRILVTSASVAEGKTTTAINVAASLA-EYG-HRVVLVD
R7Y679          --------------DNS----VRKILISSPSQSEGKTTTSLNLAASLA-ELG-KSVVLVD
A0A0F0KYJ9      --------------DNP----PRIIVVTSPLPGDGKSTISSNLAVTLA-SSG-QPVVLID
A0A7M2YYB9      --------------GDV----RRPVVFTSADPAEGKSIIAANYAFVAA-QTD-RRVLLVD
A0A538BBM6      --------------GLE----NPIVIVTSPNAGEGKTSTCVPLAQSLA-QAG-SRVVLVD
A0A7K0LE65      --------------AGR----PRTVAVVSNTQDAGKSFISINLAQSAS-ALD-DKVVLID
A0A510HHA8      --------------DAP----PRVISLTSPGPTEGKSTVCANLGVVLA-QAN-KSTLLID
A0A6G8Q9J3      --------------DAP----PKVILLTSPGSREGKSTICANLGVALA-QAD-RATLVID
A0A5Q2F9A3      --------------GQG----GNSFVITSSVPDEGKTSTAINTALVLA-DAG-LRVLLID
A0A4R1BMZ2      --------------DDP----LKVVTFTSPGPGEGKSTTCANLGVVLA-QAN-KNTLILD
A0A023X491      --------------DEP----PHVVAVTSPGQQEGKSTTCANLAVTLA-QAE-KSVLLLD
A0A6G8QDQ0      --------------DNP----PKVVVVTSPGPKEGKSTTCANLGVVLA-QAD-KSTLIID
A0A0K8Q3D9      -------------------------MVTSSMQAEGKSTVTANLAVTMA-AAG-ENVVVVD
A0A2R7RCA1      --------------DQP----PRIIVVTSSVQAEGKSTVTANLAVTLA-AAG-ENVVVVD
A0A1Q7WJN6      --------------GTG----PLLVSITSPGRSDGKSFVASNLALAFA-SVG-YRTLLID
A0A6D1QMN1      --------------DRK----LKTIMVTSSNPGEGKSTTVANLAVVMA-QQH-NRVLLVD
A0A1E2SNF6      ------------------------------MPSEGKSTLSANLAVTIA-RGG-QPVVVVD
Q6ADE8          ------------------------------MPSEGKSTLSANLAVTIA-RGG-QPVVVVD
A0A1Q7CZ24      --------------GAN----LQVVAVTSPGVGDGKTTTAINLAGSLA-QAADARVLLVD
A0A2W6VLC6      ---------------------PTTFVITSSVPGEGKTSSGINIARALA-DVG-THTLLVD
A0A519G798      --------------DSR----PRALVITSAVPSEGKTSTATNLAIALA-QTG-LRVLLVD
                                                  **:                   .::*

A0A6N6NKS9      TDMRRRCIAGLL---G--------------IHTEC-G---LYSV--LVGQ-A--P---LK
A0A538BYZ4      LDLRRGSVREHL---G--------------LGGRQ-SPGLVDAI--LKPA-L--A---LE
A0A348NU28      ADLRRPRVADYF---G--------------LEGSV-G---LTTV--LLGD-V--S---IE
A0A2N4T4Q5      GDLRRPVMTELF---G--------------LVPGV-G---ITDV--LVGE-A--E---VD
A0A4Q5APW3      ADLRHPSVANKL---D--------------IDGSA-G---LTHV--LSGQ-A--S---VK
A0A4Q5B0V3      ADLRHPSVANKL---D--------------IDGSA-G---LTHV--LSGQ-A--S---VK
A0A022KX11      ADLRNPSVAKTL---G--------------MEGSV-G---LTTL--LLGD-A--D---LD
A0A4Q5A868      ADLRHPSVANKL---D--------------IDGSA-G---LTHV--LSGQ-A--S---VK
A0A6N4VXX3      GDMRRSMIQDYL---K--------------LDGSV-G---LSTV--LSGA-V--P---LS
A0A1H4I042      GDMRRSIAHKHL---N--------------VDGAV-G---LSTV--LSGA-V--S---LS
A0A4R7A6D9      GDMRRSIAHKHL---N--------------VDGAV-G---LSTV--LSGA-V--S---LS
A0A1Q2CRV2      ADLRRPRVAAQL---Q--------------LEGAV-G---LTTV--LIGD-A--R---LG
A0A7K0NRJ7      ADLRRPTIHEQL---S--------------VPRTP-G---LTSV--LLGS-D------LS
K6WHS4          ADLRNPSVAGRV---N--------------LTGSV-G---LTTI--LSTG-A--T---LT
A0A1L2ZMQ6      GDLRRPVVSEMF---S--------------LPGDA-G---LTDV--LAGQ-A--E---LD
A0A3E2DN22      ADMRRPVQHKAF---G--------------AEAGV-G---LSQV--LAGD-V--T---LD
A0A3Q9ULZ9      ADMRRPMQHTAF---G--------------IDSRV-G---LSQV--LAGD-V--S---LS
A0A3S9JFL2      ADMRRPMQHTAF---S--------------IDSHV-G---LSQV--LAGD-V--S---LE
A0A7K0NTR2      GDFRRPQVHKYF---S--------------NITTP-N---LSDLPHLATS-S--D---LE
A0A1H6WL79      ADLRRPTVHQVF---D--------------VLPDV-G---VTDI--LSGR-A--S---ID
A0A101LAM5      ADLRRPTVHQVF---G--------------VLPDV-G---VTDV--LSGR-A--S---ID
A0A4Y3NEG0      ADLRRPTVHQVF---G--------------VLPDV-G---VTDI--LSAR-A--S---ID
A0A1Q2CI19      ADLRSPDVHEKL---D--------------VPQGA-G---VSDL--LVDG-Q--G--SLN
A0A512T3M3      ADLRSPDTHNVF---D--------------VPQGA-G---ISDY--LTDP-D--FG-PLS
W6JTW4          ADLRSPDAHNLF---D--------------VPQGA-G---ISDY--LVDS-A--LE-HLQ
A0A0A0JTY0      ADLRSPDVHNVF---D--------------VPQGA-G---ISDY--LSDV-S--GDASLA
A0A0A0JXF2      ADLRSPDVHNVF---D--------------VPQGA-G---ISDY--LSD--P--GGTSLE
E6S8H2          GDLRSPDTHNIF---D--------------VPQGA-G---ISDY--LTGP-D--DT-PLG
A0A0A0JGH0      ADLRSPNTHTLF---D--------------VPQGA-G---ISDY--ISDN-E--DT-PLE
N0E4U7          ADLRSPDTHSLF---D--------------VPQGA-G---ISDF--ITDP-G--DV-PLE
A0A0A0IYK2      ADLRSPDAHNVF---D--------------VPQGA-G---ISDF--LSDP-S--DDASLG
A0A0Q9L0H3      ADLRSPDIHTAF---D--------------VPQGA-G---ISDY--LSDP-S--DGAALD
A3TMK0          ADLRSPDAHNAF---D--------------VPQGA-G---ISDY--LTDP-G--EG-SLS
A0A543PXP1      ADLRSPDTHDLF---D--------------VPQGA-G---LSDY--LSRP-E--DA-SLE
A3TMH6          ADLRSPDTHTLF---D--------------VPQGA-G---ISDY--LSRH-N--ES-SLE
A0A6I2XCV4      CDYRKPSIGKYL----------------------A-P---IPDL--EHPT-N--P-----
A0A5R8VLL6      GDLRHPSVAKIF---D--------------VVPGI-G---ITDV--LTGK-A--E---VD
A0A3L7ADK2      CDLRRPTLSKIF---N--------------AVEGA-G---LTDV--LSGR-A--E---LQ
A0A538JQF8      SDLRAPQAHRLF---G--------------VQVEP-G---LSDV--LSGS-P--DA-PSL
A0A1H6YPK1      ADLRRPTLAKAL---G--------------VSPEA-G---LTSV--LASQ-A--S---IE
A0A0Q9TBP0      ADFRRASVAPRF---G--------------LGDPP-G---LSDL--LVSE-E--D---PS
A0A0G3V3M7      GDFRRPQMYKYF---S--------------GATTP-N---LTDI--PHQG-T--AA-DVL
A0A6I3DD56      GDFRRPQMHKYF---S--------------GATSP-N---LTDI--PYQG-T--AA-DVS
A0A5Q2FA83      GDLRNPSVAKAM---G--------------LEGNV-G---LTTV--LLGR-A--T---VA
A0A2R7MGI0      ADLRRPVMGGVF---G--------------FSDDV-G---LSDV--LAAR-A--Q---IE
A0A2T7WQY4      ADLRRPVMGGVF---G--------------FSDDV-G---LSDV--LASR-A--Q---IE
A0A1G6GTN3      ADLRRPVLGGMF---G--------------FSDDV-G---LSDV--LAGR-A--Q---IE
A0A1N7DLV3      ADLRRPVLGATF---G--------------FSDDV-G---LSDV--LAGR-A--R---IE
A0A1V2NSB5      ADLRRPVLGATF---G--------------FSDDV-G---LSDV--LAGR-A--R---IE
A0A0Q5Q5L3      ADLRRPVLGGMF---G--------------FSDDV-G---LSDV--LAGR-A--Q---IE
A0A0Q6DVM4      ADLRRPVLGGMF---G--------------FSDDV-G---LSDV--LAGR-A--Q---IE
A0A1R3WWR6      ADLRRPVLGGVF---G--------------FSDDV-G---LSDV--LAGR-A--Q---IE
A0A2S5WZJ5      ADLRRPTVATVL---G--------------IDGKI-G---LSEV--LSGQ-V--S---LE
A0A0Q5JKD6      ADMRRPVVGGMF---G--------------FSDDV-G---LSDV--LAGR-A--Q---IE
A0A2W6DK08      CDFRGPDAHQYL---G--------------VSPGT-G---LSNL--LRST-T--TV-DLS
A0A2S0LQ32      TDLRKPVVHRIF---D--------------IDGSV-G---LTQV--LAGD-V--P---VS
A0A2N6V1R5      TDLRKPVVHKIF---G--------------LDGSV-G---LTQI--LAGD-M--Q---LS
G9PHS6          TDLRKPVVHKIF---G--------------LDGSV-G---LTQI--LAGD-M--Q---LS
U1PLM7          TDLRKPVVHKIF---G--------------LDGSV-G---LTQI--LAGD-M--Q---LS
A0A346XTB0      ADIRARGLTRVL---G--------------ADDRV-G---LSDL--AAMD-M--E---PN
A0A6I1G2U1      ADLRSPNLHPMF---D--------------VPQGA-G---ISDF--LYDP-A--ST-RLE
A0A351ETF8      GDMRRPRVHRML---G--------------VSNSV-G---LSDV--LAGE-A--T---RR
A0A542FTE6      CDLRKPMIATIY---E--------------KEGAV-G---LTDV--LAGR-A--T---PA
A0A349B7N2      GDFRRPAVHEFLPEAD--------------VGRGN-G---LAPV----DA-P--D---VS
A0A7J5B4S5      ADLRRPTVASVL---G--------------IDGSV-G---LSEV--LSGQ-I--S---LE
A0A4Q2JUT1      GDLRRSMVAKTM---G--------------LPSGA-G---LSDV--LAGR-A--A---LS
A0A6L5R0V7      GDLRRSMVAKTM---G--------------LPSGA-G---LSDV--LAGR-A--A---LS
A0A2S5UYV0      ADLRRPTVASVL---G--------------IDGSV-G---LSEV--LSGQ-V--S---LE
A0A2S5X9U6      ADLRRPTVATVL---G--------------IDGKI-G---LSEV--LSGQ-V--S---LE
A0A2S5ULV5      ADLRRPTVATVL---G--------------IDGKI-G---LSEV--LSGQ-V--S---LE
A0A653YMF0      ADLRRPTVATVL---G--------------IDGKI-G---LSEV--LSGQ-V--S---LE
A0A3Q9IY80      GDLRRPMVATIF---R--------------LVDGV-G---VTDV--LAGR-A--T---VE
A0A0F0LP73      GDLRRPTVAEGF---D--------------LDGTV-G---LSEV--LSGQ-M--P---IG
A0A346Y185      ADTRVRGLTRRL---G--------------AKDTG-G---LPAL--ADPR-N--N---LS
A0A4V1VGV9      TDLRRPTVHETF---D--------------LENLV-G---LTEV--LTGQ-A--P---LA
A0A7G8U6P0      TDLRRPTVHETF---D--------------LENLV-G---LTEV--LTGQ-A--P---LA
A0A259S8H9      GDLRRPTIAKGF---E--------------IDEAI-G---LSEV--LSGQ-V--P---IG
A0A2W1Z497      CDLRRPVLSAVF---G--------------VARGA-G---LTDV--LSGR-A--D---LA
A0A0Q5L115      CDLRRPTLSKVL---G--------------VSEGA-G---LTDV--LSGR-A--Q---LH
A0A7G6YY64      CDLRRPTLSKVL---G--------------VSEGA-G---LTDV--LSGR-A--Q---LH
A0A1F1X071      ADLRRPMIAQQF---S--------------VDGEV-G---LSQL--LAAS-V--S---LE
A0A3R8RWC7      ADLRRPMIAQQF---S--------------VDGEV-G---LSQL--LAAS-V--S---LE
A0A4U0RJZ4      TDLRRPVIHETF---D--------------VDNAV-G---LTEV--LTGQ-A--S---LR
A0A4R1FGL9      TDLRRPVIHETF---D--------------VDNAV-G---LTEV--LTGQ-A--S---LR
E3B8H1          TDLRRPVIHETF---D--------------VDNAV-G---LTEV--LTGQ-A--S---LR
A0A7D7WDT9      GDLRRPKVARNF---G--------------LEGTV-G---LSEV--LSGQ-I--T---VR
A0A0Q5AWK6      ADLRRPTVAKML---G--------------IDGAV-G---LSEV--LSHQ-I--P---VE
A0A6P1F176      ADLRRPTVAKLL---G--------------IDGAV-G---LSEV--LSHQ-I--P---VE
A0A3N1NLD3      ADLRRPTVAKLL---G--------------IDGAV-G---LSEV--LSHQ-I--P---VE
A0A3N2FVI8      ADLRRPTVAKLL---G--------------IDGAV-G---LSEV--LSHQ-I--P---VE
A0A2S5XDQ6      ADLRRPSVARML---D--------------IDGAI-G---LSEV--LSHQ-I--P---VD
A0A2S5XNN6      ADLRRPSVARML---D--------------IDGAI-G---LSEV--LSHQ-I--P---VD
A0A3L8NYD3      GDLRRPMVSTIF---E--------------LDPVV-G---LTQV--LAGD-I--D---LR
A0A1M6K628      ADLRRPRVAQLF---G--------------IDGAV-G---LTQV--VAGS-L--T---VA
A0A561E8R3      ADLRKPMVATIF---N--------------LEGSI-G---LTQA--LAGD-I--T---LH
A0A345NSU7      ADLRHPSVGTTL---G--------------LEGGV-G---LTTV--LLGD-A--D---VH
A0A222TG79      ADLRRPMVAVRL---G--------------VNPDI-G---FTDF--LSGR-A--A---LE
A0A0W8I9Y2      GDLRRPVITDLF---G--------------LVPGV-G---VTDV--LTGQ-V--Q---VD
A0A7C6LSF9      ADLRSPDLHLLF---D--------------VPQGA-G---ISDF--LYDPSS--T---QL
A0A255G8R8      ADMRRPTVADNF---G--------------LVGTA-G---LSTI--LAGQ-A--T---LS
A0A6G7Y423      ADLRAPQVAQRM---G--------------LDGAL-G---LSHI--LTGR-G--T---LD
A0A4Q4D4T1      GDLRRPRLHEVF---G--------------AEQNV-G---LTSV--LVGK-V--P---LD
A0A261FE22      ADVRHPSVAKAL---G--------------ISNGV-G---LMQM--LTNQ-V--D---AQ
A0A5C8C085      GDLRRPTVASSF---G--------------LVEGV-G---LTDV--LVGR-A--S---ID
A0A4Y5YMQ6      ADLRRPNVANVL---G--------------LENAV-G---LASV--LVDA-V--T---FD
A0A1E4BP96      GDLRQPVVASLF---D--------------LPEGA-G---LTDI--LAGR-A--T---TG
A0A151BT98      GDLRKPGVGSAI---G--------------IDGSV-G---LTNV--LVHE-V--G---LK
A0A2Y8ZRF8      GDLRKPGVASAV---G--------------IDGSV-G---LTNV--LVHE-L--A---LK
A0A2R9UAT1      GDLRRPMIAAIF---G--------------LVEGA-G---VTDI--LAGR-A--E---VD
A0A4Q5J5D7      GDLRRPTVAEKF---G--------------LVEGA-G---LTDV--LIGR-V--D---FE
A0A3S0V9U6      ADLRRPTIAKIF---G--------------IDSGV-G---LSQV--LSGQ-V--G---IE
A0A1S2N0P2      ADLRRPTQAKIF---S--------------LDDAV-G---LSQV--LSGQ-V--G---PE
A0A0Q3BEY5      ADLRRPTQAKIF---G--------------LDDAV-G---LSQV--LSGQ-I--G---PE
A0A4R6Q3C6      ADLRRPTQAKIF---G--------------LDDAV-G---LSQV--LSGQ-I--G---PE
A0A2X3GKL3      ADLRRPTQAKIF---G--------------LDDAV-G---LSQV--LSGQ-V--G---PE
A0A1Y4CKD6      MDLRSQGDGALL---G--------------CGASH-G---PAEV--LEDSGL--G---VD
A0A0Q7KBQ4      ADMRNPNVADLL---G--------------LENSV-G---LMTV--LIGR-T--S---LD
A0A5Q5BFU2      GDMRRPMLHKYL---G--------------LVGPV-G---FSTV--LSGG-A--S---LS
A0A439DNZ6      GDLRRPRLDKYL---G--------------LVGSV-G---LSTV--LAGR-A--S---LE
A0A7I7UD03      GDMRRPSLHQYL---D--------------LVGGV-G---FSTV--LSGA-A--S---VD
A0A7I7MI62      GDMRRPMLHKYL---D--------------LVGAV-G---FSTV--LSGS-A--S---LS
A0A0J6YE86      GDMRRPTLSKYL---D--------------LMSKV-G---FSTV--LSGA-V--S---ID
A0A7I7K1R9      GDLRRPTAHKYL---D--------------LVGAV-G---FSTV--LSGA-A--T---LD
A0A7I9ZLK4      GDMRRPMLHKYL---D--------------LVGPV-G---FSTV--LSGG-A--S---LD
A0A1F1IHY9      GDLRRPVVAENF---G--------------LISTV-G---LTDV--VLGR-V--E---LA
A0A7H2BCD6      ADLRRPTVAKKF---R--------------IDSKI-G---LTEV--IAGQ-V--E---LS
A0A542HCT5      GDLRRPVIADSF---G--------------LIEGL-G---LTDV--LIGT-V--Q---FD
A0A0Q5M6Z7      CDLRRPMQSTLF---S--------------LRSGV-G---LTDV--LSGR-V--D---LN
A0A7G6YA19      CDLRRPMQSTLY---N--------------LRGGV-G---LTDV--LSGR-V--A---LG
A0A2S8WHZ8      ADLRRPVQTELF---D--------------MMDGA-G---LTDV--LSHS-A--D---LE
A0A537WNY9      GDLRRGRISEMM---N--------------ITRSP-G---LTEV--LIGD-S--S---LD
A0A5B8M469      ADLRRPSVARQF---D--------------MDGTI-G---LSEV--LSGQ-V--P---VQ
A0A1Y4CTD2      GDFRKPAQRRIF---DEQNLERPSFSDYVLEDGVA-G---VGPV--LNGR-S--G---VY
A0A3N3ZPU0      ADLRRPVQTELF---G--------------LTEGA-G---LTDV--LAGA-A--E---LE
A0A359IQX7      ADLRRPSQHRTF---D--------------LDGSV-G---LTQV--LAGD-V--S---ID
A0A433EDP2      ADLRRPTLAKKL---N--------------VDAKV-G---LTQV--LAGQ-V--D---IA
A0A231VTW0      ADLRRPTLAKKL---N--------------VDAKV-G---LTQV--LAGQ-V--D---IA
A0A433ECD0      ADLRRPTLAKKL---N--------------VDAKV-G---LTQV--LAGQ-V--D---IA
U7V3Z1          ADLRRPTLAKKL---N--------------VDAKV-G---LTQV--LAGQ-V--D---IA
A0A1F1J417      ADLRRPTVAKKL---H--------------INAKI-G---LTQV--LAGQ-V--D---IA
A0A2A8D6P2      ADLRRPTVAKKL---H--------------INAKI-G---LTQV--LAGQ-V--D---IA
A0A1F0THV9      ADLRRPTVAKKL---H--------------INAKI-G---LTQV--LAGQ-V--D---IA
A0A5F0M6Y0      ADLRRPTVAKKL---H--------------INAKI-G---LTQV--LAGQ-V--D---IA
E3H5W1          ADLRRPTVAKKL---H--------------INAKI-G---LTQV--LAGQ-V--D---IA
A0A1F1QKB0      ADLRRPTVAKKL---H--------------INAKI-G---LTQV--LAGQ-V--D---IA
A0A509JY23      ADLRRPTVAKKL---H--------------INAKI-G---LTQV--LAGQ-V--D---IA
A0A448USF4      ADLRRPTVAKKL---H--------------INAKI-G---LTQV--LAGQ-V--D---IA
A0A0Q9LZR0      GDLRRPVVAESF---G--------------LIEGL-G---LTDV--LIGS-V--E---FE
A0A1N7E3F1      ADLRRPSVPRYL---G--------------IEGGT-G---LTDV--LIER-A--R---LH
A0A544ZKQ1      ADLRRPSVPRYL---G--------------IEGGT-G---LTDV--LIER-A--R---LH
A0A372P1T1      ADLRRPSVPRYL---G--------------IEGGT-G---LTDV--LIER-A--R---LH
A0A5D0Q2X0      ADLRRPSVPRYL---G--------------IEGGT-G---LTDV--LIER-A--R---LH
A0A5R8Z2E7      ADLRRPSVPRYL---G--------------IEGGT-G---LTDV--LIER-A--R---LH
A0A1L2ZMV4      ADLRRSVQTDIF---Q--------------LQSGA-G---LTDL--LSGA-V--D---LD
A0A6I3F378      GDLRRPRIHTMF---G--------------LSGEA-G---LVDA--LVGR-N--P---LE
A0A1S1CQC5      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1E9T6I0      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1F1GHA7      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1S1CAD0      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
G5ET14          ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1E9DXX2      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1E8S156      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1E8S5S2      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1S1DFA8      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A2I1Z490      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1F0DAA9      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1F0PHK9      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1F0VZG6      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1E9G8X4      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1E9IAW2      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1E9ZBC9      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1E9ZDP4      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1F0R6B5      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1F0Z7N5      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1F1D897      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
D2NP38          ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1F1FV74      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1E9M791      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A291DEI8      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1S1D5T1      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1E8TRD6      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1F0XT88      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1F1EVP5      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
C6R548          ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A0K2RXS2      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A1F0KX60      ADLRRPTVAKKL---K--------------LDAKV-G---LTQV--LAGQ-V--E---IA
A0A542I3V2      GDLRRPRIAGAF---N--------------LVPGV-G---VTNV--LSGQ-A--Q---LV
A0A2T0UZ65      ADLRRPNIANIL---E--------------VSSTV-G---LSEV--LSGQ-M--D---YT
A0A1R4JTI6      ADLRRPTVAGSF---H--------------VEGSV-G---LTNA--VVGN-A--Q---VD
A0A4R7TM52      GDLRRPMVASVF---G--------------LVEGV-G---LTDV--LAGR-A--D---FE
A0A542XE74      CDLRRPTQGDQF---N--------------VDSGV-G---VTQV--LAGD-V--P---LE
A0A0Q7QDF6      GDLRRPRLHEVF---G--------------AEQNV-G---LTSV--LVGK-V--P---LD
A0A5R8L819      ADLRRPMLANIF---G--------------IVADV-G---LTDV--LARR-S--T---WR
A0A7K0PFV4      FDLRKPDLGRQL---G--------------VTGSV-A---LDAT--VAGG-G--P---LT
A0A0G3V3F3      ADLRRPTIHEQL---S--------------VPRTP-G---LTSV--LLGS----D---LS
A0A7K0MUQ7      ADLRRPTIHERL---N--------------VPRTP-G---LTSV--LLGS----D---LS
A0A7K0U619      ADLRRPTIHERL---S--------------VPRTP-G---LTSV--LLGS----D---LS
A0A6I3DFP2      ADLRRPTIHERL---S--------------VPRTP-G---LTSV--LLGS----D---LS
A0A7K0SI36      ADLRRPTIHERL---S--------------VPRTP-G---LTSV--LLGS----D---LS
A0A7K0V140      ADLRRPTIHERL---S--------------VPRTP-G---LTSV--LLGS----D---LS
A0A261FQA1      TDLRKPSMAGVL---G--------------INGKV-G---LAHV--LARQ-A--K---LD
A0A1Q2CJ92      ADLRRPVQAERL---G--------------LDGAV-G---LSQV--LAGT-I--K---LS
A0A2T0S3C8      ADLRRPRIADYL---G--------------LEGAV-G---LTTV--LAGR-A--S---IA
A0A4Y8WZJ3      GDLRRPVVAENF---G--------------LISTV-G---LTDV--VLGR-V--E---LA
A0A285VUW0      ADLRHPSVASEL---G--------------LEGAV-G---LTSV--LAGD-A--R---AE
A0A2R7Z032      ADLRRPMLATTF---D--------------IDGEV-G---LTQV--LAGD-L--R---AG
A0A6J4MTQ2      ADLRRPMLATTF---D--------------IDGEI-G---LTQV--LAGD-V--E---LA
A0A1I0W453      ADLRRPMIATTF---E--------------VDGAV-G---LTQA--LAGD-V--E---IR
A0A1H4LCS9      ADLRRPQIASTF---E--------------IDGAV-G---LTQA--LAGD-V--D---IR
A0A4Q2RZP8      ADLRRPMIASTF---E--------------IDGAV-G---LTQA--LAGD-V--D---IR
A0A0Q6VV12      ADLRRPQIATTF---E--------------IDGTV-G---LTQA--LAGD-V--D---VR
A0A495NTA9      ADLRRPMIASTF---E--------------IDGAV-G---LTQA--LAGD-V--E---VR
A0A0Q9QB08      ADLRRPMIATTF---E--------------IDGAV-G---LTQA--LAGD-V--D---VR
A0A4Q2SA86      ADLRRPMLATTF---D--------------IDGAV-G---LTQA--LAGD-V--E---VR
A0A4Z1C3Z0      ADLRRPMLATTF---E--------------VDGAV-G---LTQA--LAGD-V--D---VR
A0A6V8KDX4      ADLRRPKVAEYL---D--------------LEGAV-G---LSNV--LAGQ-V--G---IE
A0A444BL03      ADLRRPTLAKVF---E--------------APGSI-G---LSHV--LTDQ-V--D---LE
A0A4Y8X357      ADLRRPRQAGQF---G--------------VDGRV-G---LSEV--LSGD-V--F---LA
R4LD52          ADLRRPRIAEYL---G--------------LEGAA-G---LTTV--LAGK-A--A---VD
A0A4T2CD79      GDLRKPMVASTF---N--------------VVGGV-G---VTDL--LIGS-A--E---LD
A0A6L6AM03      ADLRRPMIATTF---E--------------VDGAV-G---LTQA--LAGD-V--D---VR
A0A4Q2RU39      ADLRRPMIATTF---E--------------IDGAV-G---LTQA--LAGD-V--E---VK
A0A4Q2SK58      ADLRRPMIATTF---E--------------IDGAV-G---LTQA--LAGD-V--E---VK
A0A2N3YJR1      ADLRRPTLAKVF---D--------------RENTI-G---LSHV--LTDQ-V--S---LV
A0A6G8FYB9      ADLRRPTLAKVF---D--------------VVGTV-G---LSHV--LTGQ-V--P---VE
A0A4Q4D742      ADMRNPNVAELL---G--------------LENSV-G---LLSV--LVGR-T--T---IE
A0A1C6T1J1      ADLRRPKVADYL---G--------------LDGGV-G---LTDV--LVGD-V--Q---VG
A0A2W2CFC8      ADLRRSKVGDYL---G--------------IDSAV-G---LTDV--LVGD-V--P---VG
A0A2W2A4B0      ADLRRPNLANVF---G--------------IEGSA-G---LSDI--LVGR-V--E---LA
A0A4Y9MDA5      ADLRRPAIAERL---G--------------LEGAA-G---LTTV--LLGR-A--G---LP
A0A1H7N9P7      ADLRRPTIADRL---G--------------LEAAA-G---LTTA--LLGR-A--S---VA
A0A1M7V0F8      ADLRRPAIADRL---G--------------LEAAA-G---LTTV--LLGR-A--T---VA
A0A1M3LEY6      GDLRSPSVADLF---G--------------IEGGV-G---LTDV--LIGR-A--R---LS
A0A538AJI7      GDLRRPGFARIM---R--------------VNPHP-G---LAEV--LRGE-T--P---IM
A0A538AM15      ADLRRPSVARLL---A--------------IGGSD-GPGLVNAI--LDPR-L--P---LE
A0A519GXS6      ADLRRPAVANLL-GL----------------ENAV-G---LTSV--LVES-I--A---VE
A0A520EHH5      ADLRRPHIADYL-GI----------------VGSV-G---VSSV--LAHD-A--G---LD
A0A4R0U4F1      ADVRNPSVSKAL-GI----------------EGAV-G---LTHL--ITNR-V--S---SH
A0A1V8PLV6      ADLRHPSVADHI-GL----------------EGGA-G---LTHV--LSDQ-A--A---VK
A0A357ZCV8      TDMRRRSLAHYM-RL----------------KPSV-G---SYAV--LTGL-A--K---LS
A0A4R1CW45      LDLRRGCVAEEL-GI----------------EFEA-G---VSDY--LLGE-ME-S---LH
A0A4R5Z7B0      ADLRKPTVHRSF-GV----------------NNLF-G---FTTV--LTKQ-A--T---LG
A0A542H054      GDMRKPTSHYTF-NV----------------NNTF-G---LTST--LSRQ-K--S---LR
A0A6M8GFV5      ADLRKPQLHTDF-RL----------------ENFK-G---LTTA--IAQD-K--Q---LK
A0A7G8U6J2      ADLRKPSVHYAF-SI----------------SNIH-G---LTSV--LTKK-M--D---LR
A0A419GS64      CDLRLPTQHELF-QI----------------TLDH-G---LTRM--ISTY----D---EG
A0A2V2CXY5      CDYRNSEMRTKY-GIG--------------STEKIIG---GAHY--LAGK-A--D---MA
A0A2S8MDM2      GDMRRPSLHQYL-DL----------------LQPV-G---FSTV--LSGR-A--L---LG
A0A357ZDL3      TDLRRRSLAMYL-NL----------------RAPS-G---LYAV--LAKQ-V--A---LN
A0A4Y8ZIU8      ADLRRPRQALQF-GV----------------DGRV-G---LSEV--LNGD-V--A---LQ
A0A1I6GVG4      GDLRRPMVDTVF-GL----------------PKGA-G---ISDV--LAGR-A--T---IA
A0A1I6IST1      GDLRRPMVDTVF-GL----------------PKGA-G---ISDV--LAGR-A--T---IA
A0A412JBM5      ADVRKPSQQRLWAGR----------------NTST-G---LCKY--LVGL-G--E---LG
A0A6J4SUA1      GDIRRGEQHATF-NV----------------DQQP-G---LMEF--LSGE-A--G---LD
A0A1C2B334      ADLRRPTVAKRL-SL----------------NNSI-G---LTDF--LIGQ-G--D---LP
R7Y679          ADLRRPAVASRLQAV----------------SPDI-G---LTDY--LRGS-A--P---VG
A0A0F0KYJ9      GDLRRPMIGTVF-GL----------------PKGA-G---ISDV--LAGC-A--T---IA
A0A7M2YYB9      ADMRKPTLHKLF-GV----------------RGTP-G---LTEV--IAAG-I--D---YK
A0A538BBM6      LDLRHPDAHRLL-DR----------------PNSV-G---VVDV--LRGN-T--V---VE
A0A7K0LE65      ADLRRPTIHERL-NV----------------PRTP-G---LTSV--LLGS----D---LS
A0A510HHA8      GDLRRPSLHAIF-SL----------------RNIN-G---LVNA--ITGE-R--G---LQ
A0A6G8Q9J3      CDLRGPTLHGIF-GL----------------RDSP-N---LLDV--LARE-D--G---LG
A0A5Q2F9A3      ADMRRPRVGQSL-RL----------------EDAA-G---LSTI--LIGR-A--S---LR
A0A4R1BMZ2      CDFRRPVMHRFF-GL----------------RNVW-G---VVDV--LVGK-R--S---LP
A0A023X491      CDLRKPVVHSIF-EL----------------RNTR-G---VVDA--LVGS-E--N---VE
A0A6G8QDQ0      CDFRRPAMHQVF-GL----------------RNFK-G---VVNV--LANE-L--E---LQ
A0A0K8Q3D9      GDLRRPTLTDVF-NL----------------VPGA-G---VTDV--LSGT-A--D---LD
A0A2R7RCA1      GDLRRPTLVDVF-NL----------------VPGV-G---VTDV--LTGT-A--E---LA
A0A1Q7WJN6      GDVRRGGLHRIL-TV----------------SRKP-G---LTDV--LAGD-V--T---AE
A0A6D1QMN1      TDLRKPTVHFTF-QV----------------PNHV-G---LSNV--VTGQ-S--T---LD
A0A1E2SNF6      ADMRHPTQGKTF-GI----------------PNGA-G---LSDV--LAGR-V--S---LR
Q6ADE8          ADMRHPTQGKTF-GI----------------PNGA-G---LSDV--LAGR-V--S---LR
A0A1Q7CZ24      MDLRRPAVAGQL-GL----------------SGGKRG---LAEA--LLAD-SGLS---LE
A0A2W6VLC6      ADLRRPKTDVYL-GI----------------EGGL-G---LTDV--LIGR-A--R---VE
A0A519G798      GDLRRPKVASVL-GL----------------ERSV-G---LTTV--LVGR-S--E---LQ
                 * *                                                        

A0A6N6NKS9      SAIYPTDR--PN-LYF--MDSEPNIPSPPDV-LSTKRFAALVDTLREMF--DYVIFDSPP
A0A538BYZ4      DVTQLCPS--FN-LSV--VLAGRSPATHYEL-LKSPRLGELLGEARHRY--DYVLLDTPP
A0A348NU28      DARMTRPG--ST-LDV--LPSGSIPPNPAEM-LTSDAMKRLLEEATARY--DYVIIDSPP
A0A2N4T4Q5      DVLQVYDK--FPNLQV--LGAGRTPPNPTEL-LASQAMRTMLAELAEDA---FVLVDAPP
A0A4Q5APW3      DVVQRYWK--PN-LHV--MPAGPKPPNASAL-LNSPIMVELLNNAIERY--DYVLVDTAP
A0A4Q5B0V3      DVVQRYWK--PN-LHV--MPAGPKPPNASAL-LNSPIMVELLNNAIERY--DYVLVDTAP
A0A022KX11      DVIQTWGS--AG-MDV--LPAGPIPPNPSEL-LGSAPMEALLTRLMQEY--DFVLIDSPP
A0A4Q5A868      DVVQRYWK--PN-LHV--MPAGPKPPNASAL-LNSPIMVELLNNAIAQY--DYVLIDTAP
A0A6N4VXX3      EALQQTRF--SG-LTV--LAAGTTPPNPSEL-LASQAAKKLLAELRGQF--DYVIVDSSP
A0A1H4I042      DALQETQF--SG-LTV--LAAGATPPNPSEL-LASHAAKNLLEELRGKF--DYVIVDSCP
A0A4R7A6D9      DALQETQF--SG-LTV--LAAGATPPNPSEL-LASHAAKNLLEELRGKF--DYVIVDSCP
A0A1Q2CRV2      DVVQPYGR--TP-LDV--LTAGRVPPNPAEL-LGHTRMRALLEDASKLY--DTVIIDSPP
A0A7K0NRJ7      EALRKVAE--SPFLRV--LSSGPPVEDPSAI-LGARAFRVVLDTLRA-V--RLVVVDTPP
K6WHS4          DCIQHSSV--A-GLDV--LPSGPIAPNPAEL-LGSRKASDVFGSLRDSF--EYVVVDTPP
A0A1L2ZMQ6      DVLQDFEP--VPNLQV--LAAGRIPPNPSEL-LASKTMGKLLEDLSE-R--AFVIIDAPP
A0A3E2DN22      DALMRTET--K-RLQM--LAAGRIPPNPSEL-LGSQRMKDLLTELRKRG--YFVVIDAPP
A0A3Q9ULZ9      DALTPTDV--P-GLRV--LVAGRIPPNPSEL-LGSVRMHNLISRLTKAG--YFVVLDAPP
A0A3S9JFL2      DALNPTDV--P-GMRV--LVAGRIPPNPSEL-LGSVRMHNLIARLTKAG--YFVILDAPP
A0A7K0NTR2      GILQETGI--P-NIRF--VASAPTRTDPGSA-IEMVRVASRVG--REIA--DLVIVDSPP
A0A1H6WL79      DVLQEWGP--NPRLRI--LTAGRIPPNPSEL-LGSRAMEHLLKDLAQ-R--AIVLIDAPP
A0A101LAM5      DVLQEWGP--NPHLRI--LTAGRIPPNPSEL-LGSRAMEHLLRDLSQ-R--AMVLIDAPP
A0A4Y3NEG0      EVLQEWGP--NPHLRI--LTAGRIPPNPSEL-LGSRAMEHLLNELSQ-R--AMVLIDAPP
A0A1Q2CI19      SVIRPTNI--P-GVRV--VTAGTRLAHPTAL---ASRMGPLVASARKRA--DVVIIDSAP
A0A512T3M3      NLVRPTNL--P-GVKI--ITAGTQLEHPTSL---ASRMVALQEGTRQLA--DVVIVDSAP
W6JTW4          QLVRPTNM--P-GVSI--IVAGTQLDHPTSL---ASRMGPLLEEARGLA--DVVLVDTAP
A0A0A0JTY0      SLMRPTSV--P-GVRI--MSAGSSLAHPAAL---ASRMSHLLDEARGMA--DVVLIDTAP
A0A0A0JXF2      TVVRPTSV--P-GVRI--ITAGTVLTHPASL---ASRMGGLLEEAREMA--DVVLIDTAP
E6S8H2          SLIRPTNV--P-GVRI--ITAGTRLEHPASL---ASRMGGLLTEARGLA--DVVLVDSAP
A0A0A0JGH0      ALIRPTNV--P-AVRI--ITAGTRLTHPASL---ASRMGHLLAEVRELA--DVVIIDSAP
N0E4U7          ALVRPTSV--P-GVRI--ITAGTRLTHPASL---ASRMGHLLEEVRGMA--DVVIIDSAP
A0A0A0IYK2      SVVRPTSV--P-GVRI--ITAGTSLAHPASL---ASRLGSLLEEVRGMA--DVVLIDTAP
A0A0Q9L0H3      AVVRPTSV--P-NVRI--ITAGTSLAHPAAL---ASRMGQMLEQARDLA--DVILIDSAP
A3TMK0          AVVRPTSV--P-GVRI--ITAGTSLAHPASL---ASRMGHLLEEARDMA--DVVLIDTAP
A0A543PXP1      ALIRPTSI--P-DVRI--ITAGTRLSHPASL---ASRMGGLLSETRGLA--DIVLIDTAP
A3TMH6          ALIRPTSI--D-GVRI--MTAGTRLSHPASL---ASLMGGLIAELRDLA--DVVLIDTAP
A0A6I2XCV4      ----QPTR--VENLWF--IPAPRTSASPAIV-I--EELGRVIDSWRDDF--DIVFLDTPP
A0A5R8VLL6      DVLQQRGD--LPNLSI--LGAGRTPPNPSEL-LSSHAMKQLLNSLAE-R--GIVIIDAPP
A0A3L7ADK2      QVIQPCGD--SEKLWI--LGAGRIPPNPSEL-LGSRAMKELLAALGE-Q--SIVILDAPP
A0A538JQF8      ADVAQDTK--VPGVQV--IAAGSRVANPGRL-LA--RAADLVREARNLA--DFVLIDTAP
A0A1H6YPK1      EVTQQVGD--SGRFSV--VTAGVIPPNPSEL-VGSDTMRSLLYSFPE-D--TMVIVDSPP
A0A0Q9TBP0      SYLIDIGV--D-NLTL--LPAGTLPPNPAAL-LASGQMHLVLEELAAKA--DMIVVDSPP
A0A0G3V3M7      AVAQETGI--P-NIRF--IASAPTRTDPGTA-IEMVKVAARLGR--DIA--DLVIVDSPP
A0A6I3DD56      AVAQETGV--P-NIRF--IASAPTRTDPGTA-IELVKVAARLGR--EIA--DLVIVDSPP
A0A5Q2FA83      EAAQKWGD--S-SLHV--LPSGAIPPNPSEL-LGSTAMETLFAELLQAY--DYVLVDSPP
A0A2R7MGI0      QVAHQVDE--EGRLFV--VAAGRTPPNPTEM-VGSQRLQSLARKLAE-E--MVVIVDSPP
A0A2T7WQY4      QVAHQVDD--HGRLFV--VAAGRTPPNPTEM-VGSQRMQALARKLAE-D--MVVIVDSPP
A0A1G6GTN3      QVARQVDQ--NGRLFV--VAAGRTPPNPSEM-VGSQRMQALARKLAD-D--MVVIVDSPP
A0A1N7DLV3      QVAHQVDE--NGRLFV--VAAGRTPPNPSEM-VGSQRMQQLARTLAD-D--MVVIIDSPP
A0A1V2NSB5      QVAHQVDE--HGRLFV--VAAGRTPPNPSEM-VGSQRMQQLARTLAD-D--MVVIIDSPP
A0A0Q5Q5L3      QVAHQVDE--HGRLFV--VAAGRTPPNPSEM-VGSKRMQALSRKLAE-D--LVVIVDSPP
A0A0Q6DVM4      QVAHQVDE--HGRLFV--VAAGRTPPNPSEM-VGSKRMQALSRKLAE-D--LVVIVDSPP
A0A1R3WWR6      QVAHQVDE--NGRLFV--VAAGRTPPNPSEM-VGSQRMQALTRKLAE-E--LVVIIDSPP
A0A2S5WZJ5      DALVASKI--P-GLYV--LPSGRIPPNPSEM-LGSAAMKSIISLLST-D--YIVVIDAPP
A0A0Q5JKD6      QVAHQVDE--HGRLFV--VAAGRTPPNPSEM-VGSQRMQSLARKLAD-D--MVVIIDSPP
A0A2W6DK08      LHVRQSDI--P-RVDV--VTAGTQLERPSTL---PARMGNLVMQARELA--DIVLIDSAP
A0A2S0LQ32      DVAQFVKG--HPHLRV--IPAGRIPPNPSEL-LGSQRMKALLDRLSQ-E--AVVLLDAPP
A0A2N6V1R5      DVAQKIEG--QPNLRV--VPAGRIPPNPSEL-LGSQRMKALMDYLKD-D--AMVIMDAPP
G9PHS6          DVAQKIEG--QPNLRV--VPAGRIPPNPSEL-LGSQRMKALMDYLKD-D--AMVIMDAPP
U1PLM7          DVAQKIEG--QPNLRV--VPAGRIPPNPSEL-LGSQRMKALMDYLKD-D--AMVIMDAPP
A0A346XTB0      EVLRRYKF--SEQSQIPVVTAGQRRGDPAAL-LRTHAFRKGMERIVDSA--ELLIVDSSP
A0A6I1G2U1      ALARPTSV--P-GVKI--ITAGTQLAHPASL---ATRMGTLIDEARPLA--DIVIVDTAP
A0A351ETF8      DARQVFER--D-GIRFDVITSGSKVQDPALL-LRGDRWTSLADELFL-Y--DLVIIDAPP
A0A542FTE6      DVAQRVPG--NLDLTV--FTSGPTPPNPSEL-LGSNAMREFLDSLRRTG--AFVVLDAPP
A0A349B7N2      GLIGRSHI--PGVSAITHLDERLESVQPADL-LSW--IRSTVQQARPTS--DVVLIDTAP
A0A7J5B4S5      DALTATKT--P-GLYA--LPSGRIPPNPSEM-LGSEAMRSIIRLLSQ-D--YIVIIDAPP
A0A4Q2JUT1      EVLQRTPK--SNNLLV--LAAGSVPPNPSEV-LGSERMHTLIADLTK-H--ATVIIDAPP
A0A6L5R0V7      EVLQRTPK--SNNLLV--LAAGSVPPNPSEV-LGSERMHTLIADLTK-H--ATVIIDAPP
A0A2S5UYV0      DALTATKT--P-GLYA--LPSGRIPPNPSEM-LGSEAMRSIIRLLSQ-D--YIVVIDAPP
A0A2S5X9U6      DALVGSKI--P-GLYV--LPSGRIPPNPSEM-LGSEAMKSIVSLLSK-D--YIVVIDAPP
A0A2S5ULV5      DALVGSKI--P-GLYV--LPSGRIPPNPSEM-LGSEAMKSIVSLLSK-D--YIVVIDAPP
A0A653YMF0      DALVGSKI--P-GLYV--LPSGRIPPNPSEM-LGSEAMKSIVSLLSK-D--YIVVIDAPP
A0A3Q9IY80      DVAQRVGR--KGNLLV--LGAGKLPPNPSEV-LGSERMKNLLRTLAK-D--YTVIVDAPP
A0A0F0LP73      PAIRQTSD--P-NLFV--LPAGGIPPNPSEM-LGSTAFQRLLGELRR-D--FFIVIDAPP
A0A346Y185      EIIVPLTA--DEGQYVPFIPAKSLGDDTAAF-FRTPGFRQAITRLREVA--DLIIVDSPP
A0A4V1VGV9      SAIQQGDH--K-NLAV--ITSGRVPPNPSEL-LGSRRMSAVIEALGE-E--YFVVLDAPP
A0A7G8U6P0      SAIQQGDH--K-NLAV--ITSGRVPPNPSEL-LGSRRMSAVIEALGE-E--YFVVLDAPP
A0A259S8H9      SAIRRTEE--A-NLFV--LPAGGIPPNPSEM-LGSAAFQQLLTRLRQ-D--FFIVVDAPP
A0A2W1Z497      DVMQQTDD--VGNLWI--VGSGRVPPNPSEL-LGSRMFRDILASLGE-H--ATVVLDAPP
A0A0Q5L115      QVMQQTEA--ASNLWV--VGAGRIPPNPSEL-LGSQTFQDLVSTLAE-H--ATVILDAPP
A0A7G6YY64      QVMQQTEA--ASNLWV--VGAGRIPPNPSEL-LGSQTFQDLVSTLAE-H--ATVILDAPP
A0A1F1X071      DVAEPTTV--P-LLTL--LPAGQIPPNPSEL-LGSRRMQELIEELSR-Q--YFVIIDAPP
A0A3R8RWC7      DVAEPTTV--P-LLTL--LPAGQIPPNPSEL-LGSRRMQELIEELSR-Q--YFVIIDAPP
A0A4U0RJZ4      QAIQPGDH--K-NLSI--ITSGRIPPNPSEL-LGSRRMSAVIDALEE-E--YFVVLDAPP
A0A4R1FGL9      QAIQPGDH--K-NLSI--ITSGRIPPNPSEL-LGSRRMSAVIDALEE-E--YFVVLDAPP
E3B8H1          QAIQPGDH--K-NLSI--ITSGRIPPNPSEL-LGSRRMSAVIDALEE-E--YFVVLDAPP
A0A7D7WDT9      DAVQSTDA--A-GLFA--LAAGGTPPNPSEM-LGSSAFGNLIKELRK-D--FFIVIDAPP
A0A0Q5AWK6      DAIRPTGT--E-GLFA--LPSGHIPPNPSEM-LGSAAMRTLVERLSK-D--YFVIIDAPP
A0A6P1F176      DAIRPTAT--E-GLFA--LPAGHIPPNPSEM-LGSSAMRALIERLAE-D--YFVIVDAPP
A0A3N1NLD3      DAIRPTAT--E-GLFA--LPAGHIPPNPSEM-LGSSAMRALIERLAE-D--YFVIIDAPP
A0A3N2FVI8      DAIRPTAT--E-GLFA--LPAGHIPPNPSEM-LGSSAMRALIERLAE-D--YFVIIDAPP
A0A2S5XDQ6      DAIRPTGT--A-GLYA--LPAGHIPPNPSEM-LGSEAMRALVARLSK-D--YFVIIDAPP
A0A2S5XNN6      DAIRPTGT--A-GLYA--LPAGHIPPNPSEM-LGSEAMRALVARLSK-D--YFVIIDAPP
A0A3L8NYD3      ATIQDPGL--P-NLDV--IAAGRIPPNPSEL-LGSQRMQSVIEELVAAD--YMVLIDAPP
A0A1M6K628      DALVSTSQ--P-NLSV--LPAGRIPPNPSEI-VGSKRMADLIAHL-SET--HLVIIDAAP
A0A561E8R3      DVMQPTTT--P-DLVV--IPAGRIPPNPSEL-VGSRRMETAITEL-SKD--HLVIIDAPP
A0A345NSU7      DVVQPWGG--NN-LHV--LTAGEVPPNPSEL-LGSSKMHELFERLSEQY--DFILVDTPP
A0A222TG79      DVLQSTSF--SG-VDA--LAGGQIPPNPAEL-LTSQKASEGINSLSSLY--DYVIVDTPP
A0A0W8I9Y2      EVLQTYDK--FPNLQV--LGAGRTAPNPTEL-LSSKAMHAMLETLAEDA---LVLVDAPP
A0A7C6LSF9      AALARPTS--VPGVKI--ITAGTQLAHPASL---ATRMGVLVDEARKVA--DIILIDTAP
A0A255G8R8      DLVQPFSG--HPDLYV--LTSGVVPPNPTEL-LDSAQMRALLDEALAEY--DVVLIDSPP
A0A6G7Y423      GLAIR-TE--PAGLAV--LPAGAVPPNPSEL-LGSDAMAHLITAAERSY--DYVLFDAPP
A0A4Q4D4T1      SAVQGTDV--PG-LDV--LTSGTRPPNPSEI-IQTAAMETVLIELGRRY--DIVLVDAPP
A0A261FE22      TAVQQYWK--PE-FQV--LPVEDNQGTAAVM-LSSAVMENMIDQAAKHY--DHVIIDTAP
A0A5C8C085      DVLQQHHE--LENLSV--LAAGGIPPNPSEL-LGSQAMRRLLTLLSQRA---IVLVDAPP
A0A4Y5YMQ6      DAVISTAG--VD---V--LTAGEHVPNPAQL-LASQKMTELVEGLRPRY--DFVVIDTAP
A0A1E4BP96      DVVQPVQG--SQNLYI--LASGRVPPNPSEV-LGSRRMRDLVTSLTEHA---LVIVDSPP
A0A151BT98      DVLVEPEP--SLPLFV--LPAGPVPPNASEL-LGSSAMQGLFQELVAEF--DFVVFDSPP
A0A2Y8ZRF8      DVLVEPEP--SLPLFV--LPAGPVPPNASEL-LGSAAMRNLFQELVAEF--DFVVFDSPP
A0A2R9UAT1      DVAQTFGH--LDTLRI--VAAGRTPPNPSEV-LGSERMKDLLRELSREA---MVIVDAPP
A0A4Q5J5D7      DVAQEHPD--YPNLLL--LAAGGVPPNPSEL-LGSQTMRQLLTELAKTA---LVIVDAPP
A0A3S0V9U6      EAIQRFHE--SE-LYV--VPAGRIPPNPSEL-LGSAKMRKLIEELAREY---LVLIDAPP
A0A1S2N0P2      EAIQRIGD--TE-LYV--LPAGRIPPNPSEL-LGSSKMQRLIQEMSQEY---LVIIDVPP
A0A0Q3BEY5      EAIQRIGD--TE-LYV--LPAGRIPPNPSEL-LGSSKMQRLIQEMSQEY---LVIIDVPP
A0A4R6Q3C6      EAIQRIGD--TE-LYV--LPAGRIPPNPSEL-LGSSKMQRLIQEMSQEY---LVIIDVPP
A0A2X3GKL3      EAIQRIGD--TE-LYV--LPAGRIPPNPSEL-LGSSKMQRLIQEMSQEY---LVIIDVPP
A0A1Y4CKD6      DCIVLLEE--SG-IGF--WGGAGPVQNPVEV-LSDERLPSLFDGLRGQW--DYIVLDASP
A0A0Q7KBQ4      EATQVHDS--G--ISF--LGTGPKPPNPAEV-LDTQAMRDLLHGLRSEY--DVVVIDAPP
A0A5Q5BFU2      EALQNTRF--PG-LTV--LTSGAIPPNPSEL-LGSQSARRLLNELRAQF--DYVIVDSTP
A0A439DNZ6      DVLQETAF--PG-VTV--VTSGAVPPNPSEL-LGSLAAKKILDELRTGF--DYVVVDSSP
A0A7I7UD03      DALQKTRF--PG-LTL--LTSGAIPPNPSEL-VGSQAARKLLRELRTQF--DYVIIDSSP
A0A7I7MI62      EALQKTRF--PN-LTV--LTSGPVPPNPSEL-LASLSAKKLLSELRAQF--DYVVVDSTP
A0A0J6YE86      DSLQKTRF--PG-LSV--LTSGAVPPNPSEL-LGSQSARKVLAELRSRF--DYVIIDSTP
A0A7I7K1R9      EALQKTRF--AG-LTV--LTSGAVPPNPSEL-LGSQSARKLLHELRGRF--DYVIVDSAP
A0A7I9ZLK4      EALQKTRF--PG-LTV--LTSGTVPPNPSEL-LGSQSARNLLSELRSQH--DYVIVDSTP
A0A1F1IHY9      DALQTVGN--RPSLQV--LASGPIPPNPSEI-LASDRFNDLINALAEDA---LVIIDAPP
A0A7H2BCD6      EAVRQFEN--SQ-LFI--LPAGRIPPNPSEL-LGSDKMRSLIRELSEEF---MVIIDAPP
A0A542HCT5      EVAQQVGG--LPNLRV--LAAGRVPPNPSEM-LGSKAMRRLLERLGETC---TVIVDAPP
A0A0Q5M6Z7      DALQAPSD--SPHLRV--LGAGRVPPNPSEL-LGSRTMRELVSALADVA---IVILDAPP
A0A7G6YA19      DALQAPSE--STHLRV--LGAGRVPPNPSEL-LGSRTMRELIDALSGVA---TVILDAPP
A0A2S8WHZ8      DVLQPYGH--LPNLQV--LCSGRIPPNPSEL-LGSKAMKSLLSELALDA---VVLVDAPP
A0A537WNY9      DAIRKTSN--PS-LNV--LTGGRRLADPGEM-L-TISFGSVLSQLAEMY--ETIVIDGTP
A0A5B8M469      EAVRTVGR--EN-LMV--LPAGGTPPNPSEM-LGAHAFEALLRELRERF---FVVVDAPP
A0A1Y4CTD2      ELFQYKAL--RD---------------PMAV-FSGERLADVMAELSERF--DYIFVDCSP
A0A3N3ZPU0      DVLQDWEP--GSNVHL--LGAGRTPPNPSEL-LGSKTMRNLLARMGQDY---MVVIDSPP
A0A359IQX7      DAIQNSEL--AN-LKV--LSAGRIPPNPSEL-VGSQRMHNLLIALSENR---TVIVDAPP
A0A433EDP2      EAVYQLEE--SN-LFV--LTAGRIPPNPSEL-LGSDKMRQLVRELSEEF---VVVLDAPP
A0A231VTW0      EAVYQLEE--SN-LFV--LTAGRIPPNPSEL-LGSDKMRQLVRELSEEF---VVVLDAPP
A0A433ECD0      EAVYQLEE--SN-LFV--LTAGRIPPNPSEL-LGSDKMRQLVRELSEEF---VVVLDAPP
U7V3Z1          EAVYQLEE--SN-LFV--LTAGRIPPNPSEL-LGSDKMRQLVRELSEEF---VVVLDAPP
A0A1F1J417      EAVHQVED--SK-LFV--LPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPP
A0A2A8D6P2      EAVHQVED--SK-LFV--LPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPP
A0A1F0THV9      EAVHQVED--SK-LFV--LPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPP
A0A5F0M6Y0      EAVHQVED--SK-LFV--LPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPP
E3H5W1          EAVHQVED--SK-LFV--LPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPP
A0A1F1QKB0      EAVHQVED--SK-LFV--LPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPP
A0A509JY23      EAVHQVED--SK-LFV--LPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPP
A0A448USF4      EAVHQVED--SK-LFV--LPAGRIPPNPSEL-LGSDKMRQLIEELSKEF---LVIVDAPP
A0A0Q9LZR0      EVVQQVGG--LPNLSV--LAAGRVPPNPSEM-LGSKAMRRLLEGLGETY---TVIVDAPP
A0A1N7E3F1      EVIQTWGQ--PG-LSV--LPSGRIPPNPSEL-LGSRVMRSVLAQLTEEY--DMVIVDAPP
A0A544ZKQ1      DVIQTWGQ--PG-LSV--LPSGRIPPNPSEL-LGSRGMRSVLAQLTEEY--DMVIIDAPP
A0A372P1T1      DVIQTWGQ--QG-LSV--LPSGRIPPNPSEL-LGSRGMRTVLAQLTEEY--DMVIIDAPP
A0A5D0Q2X0      DVIQTWGQ--QG-LSV--LPSGRIPPNPSEL-LGSRGMRTVLAQLTEEY--DMVIIDAPP
A0A5R8Z2E7      DVIQTWGQ--QG-LSV--LPSGRIPPNPSEL-LGSRGMRTVLAQLTEEY--DMVIIDAPP
A0A1L2ZMV4      DVLQEWSG--DPRLQV--LGAGRVPPNPSEL-LGSRAMKRLLTDLAQES---VVIVDSPP
A0A6I3F378      LVRHTLDG--PD---V--LPAGRSPYNSSEL-LSSRRMGEVLHELAAIY--DFVIIDTPP
A0A1S1CQC5      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLIKELSEEF---IVVVDVPP
A0A1E9T6I0      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLIKELSEEF---IVVVDVPP
A0A1F1GHA7      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLIKELSEEF---IVVVDVPP
A0A1S1CAD0      NAVHQLGE--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
G5ET14          NAVHQVGE--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1E9DXX2      NAVHQLGE--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1E8S156      NAVHQLGE--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1E8S5S2      NAVHQLGE--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1S1DFA8      NAVHQLGE--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A2I1Z490      NAVHQVDE--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVIDVPP
A0A1F0DAA9      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1F0PHK9      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1F0VZG6      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1E9G8X4      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1E9IAW2      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1E9ZBC9      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1E9ZDP4      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1F0R6B5      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1F0Z7N5      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1F1D897      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
D2NP38          NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1F1FV74      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLIKELSEEF---IVVVDVPP
A0A1E9M791      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLIKELSEEF---IVVVDVPP
A0A291DEI8      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLIKELSEEF---IVVVDVPP
A0A1S1D5T1      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1E8TRD6      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1F0XT88      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1F1EVP5      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
C6R548          NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A0K2RXS2      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A1F0KX60      NAVHQLGD--SN-LFV--LPAGRIPPNPSEL-LGSDKMRQLINELSEEF---IVVVDVPP
A0A542I3V2      DVIQAPTV--LSNLSV--LGSGPTPPNPSEL-LGTNAMKQLLNTLAAGA---TVLIDAPP
A0A2T0UZ65      DAMQATRH--QD-VFV--IAGGQVPPNPSEL-LGSARMRQLLQELTRDH---FVILDAPP
A0A1R4JTI6      DVLQPVSE--VENLTV--LASGPVPPNPSEI-LGSDRLEAILRSLAQDH---MVIVDAPP
A0A4R7TM52      DVAQPVGQ--GGNLSV--LGAGLLPPNPSEV-LGSARMRDLLQRLAVDS---TVIIDAPP
A0A542XE74      EALVESGT--RG-LQI--LPAGRIPPNPSEL-VGSNAMHRLIERLAADH---MVIIDAPP
A0A0Q7QDF6      SAVQGTDV--PG-LDV--LTSGTRPPNPSEI-IQTAAMETVLIELGRRY--DIVLVDAPP
A0A5R8L819      EVSQPAHT--PN-LTV--LAAGRIPPNPSEL-VGSERMNLLLHELAAEA---IVILDAPP
A0A7K0PFV4      SIMRSVPR--LPPLRL--VDVATGPGDLALLPLLTTRTRAMLQDVDDVA--DYVLLDTAP
A0A0G3V3F3      EALRKVAE--SPFLRV--LSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPP
A0A7K0MUQ7      EALRKVAE--SPFLRV--LSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPP
A0A7K0U619      EALRKVAE--SPFLRV--LSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPP
A0A6I3DFP2      EALRKVAE--SPFLRV--LSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPP
A0A7K0SI36      EALRKVAE--SPFLRV--LSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPP
A0A7K0V140      EALRKVAE--SPFLRV--LSSGPPVEDPSAI-LGARAFRVVLDTLRAVR---LVVVDTPP
A0A261FQA1      EAIQQYWK--PT-FHV--MPAGEQQANPSIL-INSKAMNMLLHAAAKQY--DNVIVDSTP
A0A1Q2CJ92      DAMQATDH--KH-LQV--LPAGRIPPNPAEM-VGSSRMRSLIEHLSKAH---MVIIDAPP
A0A2T0S3C8      DVVQPWSE--G--MWA--LPSGSLPPNPSEL-LGSQHMADLLEQFREQY--DMVIVDCPP
A0A4Y8WZJ3      DALQTVGN--RPSLQV--LASGPIPPNPSEI-LASDRFNDLINALAEDA---LVIIDAPP
A0A285VUW0      DVIQRWRD--TE-MYV--LAGGEIPPNPSEL-LGSRAMERLFKQFLRDF--DFVLVDSPP
A0A2R7Z032      EAMVSSGI--DN-LWL--LPAGRIPPNPSEL-LGSLRMSQLIDELARTH---LVLLDAPP
A0A6J4MTQ2      DALIDPGM--PN-LLL--LPAGRIPPNPSEL-LGSKRMDQLVAELARDH---LVLLDAPP
A0A1I0W453      DVIIDSGM--PN-LSL--LPAGRIPPNPSEL-LGSLRMKQFIDDLAHDY---LVILDAPP
A0A1H4LCS9      DVIVDSGL--TN-LSV--LPAGRIPPNPSEL-LGSLRMKQFIEDLSHDY---FVILDAPP
A0A4Q2RZP8      DVIVGSGL--SN-LSL--LPAGRIPPNPSEL-LGSLRMKQFIEDLSHDY---LVILDAPP
A0A0Q6VV12      DVIVGSGM--AN-LSV--LPAGRIPPNPSEL-LGSLRMKQFIDDLSQDH---LVILDAPP
A0A495NTA9      DVIVGSGL--AN-LSL--LPAGRIPPNPSEL-LGSLRMKQFIDDLAQDH---LVILDAPP
A0A0Q9QB08      DVIVESGV--AN-LSL--LPAGRIPPNPSEL-LGSLRMKQFIDDLSADH---LVILDAPP
A0A4Q2SA86      DVIVESGM--AN-LSL--LPAGRIPPNPSEL-LGSLRMKQFIDELSHDY---FVILDAPP
A0A4Z1C3Z0      DVIVQSGM--AN-LSL--LPAGRIPPNPSEL-LGSLRMKQFIDELSHDY---FVILDAPP
A0A6V8KDX4      DVVQHWGR--HQ-LFV--LPSGSVPPNPSEL-LGSRAMAHLLARQREHY--DLIVIDTPP
A0A444BL03      DAFQPTDQ--EN-VRL--ITSGRTPPNPSEL-LGSARMHELVRELTVDN---IVILDAPP
A0A4Y8X357      DALITLED--G--LVL--LPAGRTPPNPSEQ-LGSSRMRELLEALSETH---MILVDAPP
R4LD52          DVLQRYGD--H--LWV--LPSGFLPPNPSEL-LGSQHMALLMDELRTAF--DTIIVDCPP
A0A4T2CD79      DVLQPWGE--RGNLRV--LGAGSIPPNPSEL-LGSHGMTTLLRELALDA---IVLVDAPP
A0A6L6AM03      EVIIESGM--PN-LSL--LPAGRIPPNPSEL-LGSLRMKQFVDELSVDY---LVILDAPP
A0A4Q2RU39      DVIVDSGM--TN-LSL--LPAGRIPPNPSEL-LGSLRMKQLIDELAEEY---LVILDAPP
A0A4Q2SK58      DVIIDSGM--TN-LSL--LPAGRIPPNPSEL-LGSLRMKQMIDDLALDY---LVILDAPP
A0A2N3YJR1      DALQATDQ--PN-VRL--ITSGRTPPNPSEL-LGSARMHDLVRELSVD---NIVILDAPP
A0A6G8FYB9      DVLLETDE--PN-VRL--VTSGRTPPNPSEL-LGSVRMHELVARLTED---HVVILDAPP
A0A4Q4D742      QAIQPH-V--SG-ISF--MGTGPAAPNPAEV-LESRAMRDLLARVRNEF--DTVIIDAPP
A0A1C6T1J1      DVVQRWGD--KS-LLV--LPSGSTPPNPSEL-LGSKAMADLLLGLRESA--DIVIIDTAP
A0A2W2CFC8      DVVQRWGD--KS-LLV--LPAGSAPPNPSEL-LGSKAMADLLLALRESA--DIVIIDTAP
A0A2W2A4B0      DVLQPWGR--AG-LSV--IPSGTVPPNPSEL-VGSPAFTALIEDVAALF--DVVIVDTPP
A0A4Y9MDA5      DLVQEWGT--SG-LHV--LTAGPVPPNPSEL-LGSPAMRRLLEAAREEY--DHVVVDTAP
A0A1H7N9P7      DLVQEWGT--AG-LHV--LPSGPVPPNPSGL-LGSPVMRRLLERLRDDY--DHVVLDTAP
A0A1M7V0F8      DLVQDWGT--EG-LHV--LASGPVPPNPSEL-LGSPAMRRLLERLRDEY--DHVVLDTAP
A0A1M3LEY6      DVTQAWGL--RN-LSL--LPAGAMPPNPSEL-LGSQAMVNLLRHVEKEY--DVVLIDGPP
A0A538AJI7      EAAQKGWA--EN-VWI--LPTAHDPEA--GD-LLARRLTDVLDEARENF--DLVVIDTPP
A0A538AM15      RVARPLPP--FN-LSV--IPAGQAPPSPYEV-LKSPRLGELLEEARLRY--DYVVLDTPP
A0A519GXS6      DAIIAT----ATGLDV--LTAGEEAPNPAEL-LASQRMRVLLEGLREEY--DLVVVDTAP
A0A520EHH5      EVVQTTG---HTDLWA--LGSGPAPPNPSEL-LGSSTAQSLLRDLGRAF--DYVVVDSPP
A0A4R0U4F1      DAIQRYW---KPNFHV--LPAGKQTMNPSIL-LNSRAMKALVEQVSGAY--DYVIIDTAP
A0A1V8PLV6      DAVQRYW---KPNLHI--LPAGPKPLNASML-LNSKTMSKLLDTALHTY--DYVIVDTAP
A0A357ZCV8      DAVVSTP---IPNLFF--LDTEPNIPSPTDV-LSSKSFAKLVEVLESNF--EYVIFDTPP
A0A4R1CW45      EVGLHID---GTKLAV--FPTHTVSMDSAEA-IASGRFDTLVETMRKHTGEAVVIFDLPP
A0A4R5Z7B0      STVLETE---EKDLYI--LTSGPVPPNPAEL-LSSKSMEQFIEEAKEQF--DYVLFDTPP
A0A542H054      EVVHQTD---IKNLDL--LTCGPIPPNPAEL-LSSRSMEELLKDIYQDY--DMVVFDTPP
A0A6M8GFV5      DFVQKSQ---IENLSI--LTSGPIPPNPSEL-LSSEKMKNLITLMYEQY--DMVLFDAPP
A0A7G8U6J2      KTILNSN---VSNLDI--LTSGPIPPNPSEL-LNSKAIETAIDELKEIY--DYIIFDTPP
A0A419GS64      DDPFAFGDQVMDGLTV--IGSGPPPPNPSEI-ISSRRFRKFIKNASAAY--DTVIIDTPP
A0A2V2CXY5      DVIYQTN---IPNGYM--IPTTSAIANPTIL-LEGTRFSHMIESCAKTF--SYVLVDTPP
A0A2S8MDM2      EALQKTR---FPGLTV--LTSGSIPPNPSEL-LGSQSARRLLSELRSQY--DYVVVDSTP
A0A357ZDL3      DAVMTTQ---AGNLFF--LDAEAGIPNPVDI-LSSNRFKALVKTLREGF--DYVVFDSPP
A0A4Y8ZIU8      DVLVPVG---DHGLLL--LPAGRTPPNPSEQ-LGSARMRDLLTALAE-T--HMVLVDAPP
A0A1I6GVG4      EVAQRFG---NGQLLV--VTAGKVPPNPSEV-LGSARMRELLKSIARE---AIVIIDAPP
A0A1I6IST1      EVAQRFG---NGQLLV--VTAGKVPPNPSEV-LGSARMRELLKSIARE---AIVIIDAPP
A0A412JBM5      --LASIE---GIPLDI--AFCGVIPPNPSEL-LSSTRMKRFLEASRKAY--DYVIVDTAP
A0A6J4SUA1      EIVVPTE---YDRLSL--IPCGTRRRRGPEL-LASANMASLVDLLRTRY--DAILIDSAP
A0A1C2B334      DLLQQGG---LDRLDV--LATGQLPPNPAEL-LGSSRARELFDTLAASY--DYVIVDTPP
R7Y679          DVLQRSG---VGGFDV--LAAGALPPNPAEL-LGSRRTGQLLDELCELY--DYVLVDSPP
A0A0F0KYJ9      EVAQRFG---NGQLLV--VAAGKVPPNPSEV-LGSARMRELLKSIAR-E--AIVIVDAPP
A0A7M2YYB9      TVIKPIQRE-PGVLHL--LAAGTTLPNVGDV-ASSEAMETLFASVTALY--DLVVVDTPP
A0A538BBM6      DALQYVPVTRETGMYF--LSTGSSVSNPTEL-LGAGRTARLLGALAEQA--DLVLVDTAP
A0A7K0LE65      EALRKVAE--SPFLRV--LSSGPPVEDPSAI-LGARAFRVVLDTLRA-V--RLVVVDTPP
A0A510HHA8      EVLSEP----LPNLKV--CPSGPVPPNPAEL-LSSNRFSALVEEARETF--DYVLIDSPP
A0A6G8Q9J3      EAWQEA----APRLKV--VAGGPTPPNPAEL-LGSRRFSELLGRASREF--DYVLLDAPP
A0A5Q2F9A3      EVVQVAG---MGTLQV--LTSGPVPPNPAEL-LGSISMVRLLECATHEY--DAVVIDAPP
A0A4R1BMZ2      DTMQEV----LVGLNV--LTCGPIPPNPAEL-LSSQRFAEFVARVRAEF--DYVLIDAPP
A0A023X491      ELWQTP----LDNLSV--LTSGPVPPNPAEL-LGSERFGALLGDLARRF--EYVLIDVPP
A0A6G8QDQ0      ETWHEP----VPFLKV--ATVGPLPSRPAEL-LGSKRFSELLEKAREQF--DYVLLDAPP
A0A0K8Q3D9      DVLQPWGA--LPNLSV--LGSGRIPPNPSEL-LGSRAMKNMLQALAQ-N--ATVLIDAPP
A0A2R7RCA1      DVLQPWGA--LPNLSV--LGSGRIPPNPSEL-LGSQAMKNMLNALAE-N--AIVLIDAPP
A0A1Q7WJN6      AALQRTP---YSGLSF--IGCGSRRHRGPEL-LSSAAMPRLVASLRPHY--EAIIVDTPP
A0A6D1QMN1      EAALETS---IPRLDV--LPSGPVPPNPSEL-LASKAFERFVKSVSDAY--DYVIFDAPP
A0A1E2SNF6      EVLQDPDVSLHTHIRV--LTAGRTPPNPSEL-LGSRTMRELLAALSE-L--AVVIVDAPP
Q6ADE8          EVLQDPDVSLHTHIRV--LTAGRTPPNPSEL-LGSRTMRELLAALSE-L--AVVIVDAPP
A0A1Q7CZ24      DTVETLA---HFNLSV--LPAGRATVAPYEL-LKSPRLEALLDEARQRY--DYIVLDTPP
A0A2W6VLC6      DVVIDMA---PRGFSV--LPAGRIPPNPSEL-LSSPRMKQLIAQLSLAY--DVVIIDAPP
A0A519G798      DSIQKHT---DSGIYF--LASGPIPPNPTEV-LQSRAAQELFDRVSQMF--DMVIIDGPP
                                                                     :..*  *

A0A6N6NKS9      IGLFVDAAIISNLVDGTLYVIRERAAKRDAVVAGVQQLKAANARILGSVITFSR-EEAN-
A0A538BYZ4      VVVVPDCRVIEKWVDGFLLVVAARKTPRKLLEEALTVMDP--AKILGLVFNGEDRPLSLY
A0A348NU28      VMSVADANLLAPFVDGVIVVVDAGKTRRNQLIQAAASLESAGGRIVGLVLNKVR-RKRK-
A0A2N4T4Q5      LLPVTDAALLTASADGALVVATAQGTTVDELGKALGNIEHVRGRVLGVVLNHVP-TTGA-
A0A4Q5APW3      MVVANDAVIFVRRGGSLIMVCRRDQTLKRDLREISEELTTLDLSANGVIFNCARESKKS-
A0A4Q5B0V3      MVVANDAVIFVRRGGSLIMVCRRDQTLKRDLREISEELTTLDLSANGVIFNCARESKKS-
A0A022KX11      VVPVIDAVVIERLTGGLLMVVGVDRTKKRDLAAALKQLETVGAHVSGFARNFVA-SKGS-
A0A4Q5A868      MVVANDAVIFVRRGGSLVMVCRRDQTLKRDLREISEELATLDLSANGVIFNCARESKKS-
A0A6N4VXX3      LLAVTDASLLAADADGALLLARYGKTRRDQLTHASEALASVGAAMLGTVFTMMP-PR---
A0A1H4I042      LLAVTDAALLAANADGALLLGRYGQTRRDQLKNATDALQNVGAALLGSVFVMTP-PR---
A0A4R7A6D9      LLAVTDAALLAANADGALLLGRYGQTRRDQLKNATDALQNVGAALLGSVFVMTP-PR---
A0A1Q2CRV2      LLPVTDAAVLAGETAGVLVVVGSGIVRRPELTASLEVLERVEARVLGLVFNRVK------
A0A7K0NRJ7      SGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTE-VVN--
K6WHS4          CLPVTDAQVVSRLVDGVLVVVRIDKSAKHELSDTTRQMDTAGVHAMGVVINGTP-VRQS-
A0A1L2ZMQ6      LLPVTDGAVLAKASDGALIVVKAGKPTIDELAKATENLDRVGANKLGVILNQVP-TRGAE
A0A3E2DN22      LLAITDAGLLGAIADGTIYVAVVGKTHRDQVSLVAKRLEQVGAPLLGSVLTRVP-RKKM-
A0A3Q9ULZ9      LLAVTDAGLLATSTDGVIMVHVVGGTHKEQVTLCTKRLEQVGAVLLGSVLTRAP-RKAM-
A0A3S9JFL2      LLAVTDAGLLATSTDGVIMVNVVGGTHKEQVTLCTKRLEQVGAVLLGSVLTRAP-KKAM-
A0A7K0NTR2      ILLANDAAELSTFCDATILMVRAGWTRRGGVVAASDLLRRLEATTVGIVLVGAE-HGAR-
A0A1H6WL79      LLPVTDAAVLSRVADGTLVVARARKTTRDTLYRALSNLTRVQGRVLGVILNCVA-TKGQ-
A0A101LAM5      LLPVTDAAVLSRVADGTLVVARARKTTRDTLYRALGNLTRVRGRVLGVILNCVA-TKGP-
A0A4Y3NEG0      LLPVTDAAVLSRVADGTLVVARARKTTRDTLFRALGNLTRVRGRVLGVILNCVA-TNGP-
A0A1Q2CI19      LLEAAEVFDILPHVDDVVLVARSGRLSAASAQRTKEMLARFNIPVVGAVIVGAP-LRK--
A0A512T3M3      LLAASEVFDLLPLVDTIMLVVRSGRLSETSGNRVSELLGRFRVPVSGVLLIGTS-RSR--
W6JTW4          LLAASDVFDILPLVDTVLVVVRSGRITHAAGSRLAELLGRFKVPVSGVLLIGSK-ASR--
A0A0A0JTY0      LLEASDVFDILPMVDTLLLVVRSGRLTEVAGNRVAELVGRFQVPVSGVLIVGAP-TKR--
A0A0A0JXF2      LLEASDVFDILPMVDTILLVVRSGRLTEPDGNRVAELVGRFQVPVSGVILVGAK-ARR--
E6S8H2          LLAASDVFDVLPLVDTVLLVVRSGRLTEVAGHRVSELLGRFQVPVAGVVVVGAQ-SKR--
A0A0A0JGH0      LLAASDVFDILPIVDTVVLVVRSGRLTDVAARRVAELLGRFQVPISGVVLVGAR-GRR--
N0E4U7          LLAASDVFDVLPIVDTVLLVVRSGRLTDVAAHRVAELLGRFQVPISGVVLVGAR-GRR--
A0A0A0IYK2      LLEASDVFDILPMVDTLLLVVRSGRLTELAGNRVAELVGRFQVPVSGVILLGAP-EKR--
A0A0Q9L0H3      LLEASDVFDVLPTVDTLLLVVRSGRLTEVSGNRVAELVGRFQVPVSGVIIVGAQ-TMR--
A3TMK0          LLEASDVFDILPMVDTLLLVVRHGRLTEVAGNRVAELVGRFQVPVSGVIIVGAK-AKL--
A0A543PXP1      LLAASDVFDLLPLVDTVLMVVRNGRITEVAGRRVSELLGRFNVPVSGVLIVGVR-TE---
A3TMH6          LLAASDVFDVLPVVDTVVVVVRHGRITDVAGRRVAELLGRFHVPVTGVVIVGAP-TRG--
A0A6I2XCV4      MLTTNDATDLLASADLTMLVIRSGQTRTVAAERVSGLLARFGAPVIGTIFNGCS-AADME
A0A5R8VLL6      LLPVTDAVLLAKIADGAIVVVRAGQTTKEQLTKSLGNIRKVNATILGTLLNCVP-AKE--
A0A3L7ADK2      ILPVTDAVVLANSADGVVLVASARNTTYEQFGRAQQLIKRGGAHLLGTVLNRVP-TSGQD
A0A538JQF8      TLIVNDAIDFMPEVDCVIPVLKCGSTTNDAAFRMGELLVRMGARVLGVVLVGVP-TSR--
A0A1H6YPK1      LVPVSDAAVLAARTDGALVVARAGATSADMLEEALRILDRVQGRALGVILDGVA-PVGPR
A0A0Q9TBP0      VLTGADTLELAALADMVVVVTRERVSRRRQLVAVRETLRQVSVESVGIV-----------
A0A0G3V3M7      ILLANDAAELSTFCDATVLMVRAGWTRRGGVVAASDLLRRLEATTVGVVLVGAE-HGAR-
A0A6I3DD56      ILLANDAAELSTFCDATVLMVRAGWTRRGGVVAASDLLRRLEATTVGIVLVGAE-HGAR-
A0A5Q2FA83      VLPVIDPILIDRLVGGMLMVISVNTTLKRDLAQAVKQLRTVDAKVAGFALNRMP------
A0A2R7MGI0      TLAVADAAVIASWADGAVLVVTAGRTTDDMLTRAIENISKTRGRLLGIVLNRVP-LRGPD
A0A2T7WQY4      TLAVADAAVIGSWADGVVLVVTAGRTTDDMLTRAVDNLSKTRGRLLGIVLNRAP-LRGPD
A0A1G6GTN3      TLAVADAAVIASWADGAVLVVTAGRTTDDMLTRATENIAKTRGHLLGVVLNRMP-VRGVD
A0A1N7DLV3      TLAVADAAVIANWADGAVLVVTAGRTTDDMLQRAVGNIAKTRGRLLGVVLNRVP-LRGAD
A0A1V2NSB5      TLAVADAAVIASWADGAVLVVTAGRTTDDMLQRAVGNIAKTRGRLLGVVLNRVP-LRGAD
A0A0Q5Q5L3      TLAVADAAVIASWADGTVLVVTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAP-LRGAD
A0A0Q6DVM4      TLAVADAAVIASWADGTVLVVTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAP-LRGAD
A0A1R3WWR6      TLAVADAAVIASWADGAVLVVTAGRTTDDMLSRATENISKTRGHLLGVVLNRAP-LRGVD
A0A2S5WZJ5      LLPVTDAAVLSTRVDGVVLVATAGRTRREDASAARDMIDQVNGRLLGTVLNMVP-PRDT-
A0A0Q5JKD6      TLAVADAAVIASWADGAVLVVTAGRTTDDMLTRATDNIAKTRGHLLGVVLNRMP-LRGAD
A0A2W6DK08      MLLANDATDLMPYVDTVLVVSYASRTTSEEARRASELLARTRAPAIGVALVG--------
A0A2S0LQ32      LLPVTDAALLSALADGAILTFEVGGTYKEQARLTGKILGQVDARLLGVVLNRAS-RRSMG
A0A2N6V1R5      LLPVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRAS-RRNLG
G9PHS6          LLPVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRAS-RRNLG
U1PLM7          LLPVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRAS-RRNLG
A0A346XTB0      LLAVADATIVAGSVDGIVIVVSHG-TPFSELQKVKERLKFVSTPLLGYVFNRSD-SST--
A0A6I1G2U1      ILAASDGFDILPIVDTVLFVVRSGRLTEAAGLRVSELLGRFHVPVTGAILVGTP-SRR--
A0A351ETF8      VLAVTDAVLIGRAVNGQILLTRLGATKRSDLAEAAKLLATNGSRSLGVVVNRDQ-ES---
A0A542FTE6      LLAVTDGAVLSTIADGVIMTVDAASSTQDQLQRAVGAVHRVGGKILGVVLNRVP-ERGAD
A0A349B7N2      FLTVNDARDLLDVADQVVVVARSGKTSRQSADRMSELLARLSAKVVGVVL----------
A0A7J5B4S5      LLPVTDAAILSTRVDGVVLVATAGRTRREDVGAARDMLSQVHGRLLGTVLNMVP-PRDT-
A0A4Q2JUT1      LLPVTDGAVLAHQADGALVVVTLGKTTYDLLEKALDTLRKARGRALGIVLNKAP-IRGAD
A0A6L5R0V7      LLPVTDGAVLAHQADGALVVVTLGKTTYDLLDKALDTLRKARGRALGIVLNKAP-IRGAD
A0A2S5UYV0      LLPVTDAAILSTRVDGVVLVATAGRTRREDVGAARDMLSQVHGRLLGTVLNMVP-PRDT-
A0A2S5X9U6      LLPVTDAAVLSTRVDGVVLVASAGRTRREDVSAARDMLKQVHSRMLGTVLNMVP-PRDT-
A0A2S5ULV5      LLPVTDAAVLSTRVDGVVLVASAGRTRREDVMAARDMLKQVHSRMLGTVLNMVP-PRDS-
A0A653YMF0      LLPVTDAAVLSTRVDGVVLVASAGRTRREDVAAARDMLKQVHSRMLGTVLNMVP-PRDS-
A0A3Q9IY80      LIPVTDAAVLSHSADGAIIITSVGKTTFEALTKALQNLERAGSRALGVVLNRVP-RKGRG
A0A0F0LP73      VLPVTDASVMSAFVDGVVFVIAMGRTRKTEVVEARTQLAQIRARILGVVLNFVA-MRNS-
A0A346Y185      LLLASDASAIATNVDGIVVVVSRG-TSMKLLEEMRERLDRIGTPVLGYIYTKAK-LDGAG
A0A4V1VGV9      LLPVTDAGLLAVAADGAAVVYQHGRTHREQVGLCAKILEQVGAHYYGSILNMTP-PKQMG
A0A7G8U6P0      LLPVTDAGLLAVAADGAAVVYQHGRTHREQVGLCAKILEQVGAHYYGSILNMTP-PKQMG
A0A259S8H9      VLAVTDASVLSSVVDGLVFVVAMGRTRRVEIVEARTQLEQVRARVLGVVLNLVS-LRGGD
A0A2W1Z497      ILAVTDAVVLAAGADGLVVTVSAQGTTIDQLGRALQLVARGGGTVLGAVLNRVP-TRGQD
A0A0Q5L115      VLAVTDAVVLAAKADGVLMTASAARTTFDQLDRALQLVTRGGGDVLGVVLNRVP-TKGRD
A0A7G6YY64      VLAVTDAVVLAAKADGVLMTASAARTTFDQLDRALQLVTRGGGDVLGVVLNRVP-TKGRD
A0A1F1X071      VLAVTDAQLLTRHSDGAILVAVPGQTRTAAMQKAVEAIRAVNGTVYGAVLNRAS-TGRLN
A0A3R8RWC7      VLAVTDAQLLTRHSDGAILVAVPGQTRTAAMQKAVEAIRAVNGTAYGAVLNRAS-TGRLN
A0A4U0RJZ4      LLPVTDAGLLSVAASGAAVVYHHGTTHKEQIALCTKILDQVGAHYFGSILNMTP-PRSMG
A0A4R1FGL9      LLPVTDAGLLSVAASGAAVVYHHGTTHKEQIALCTKILDQVGAHYFGSILNMTP-PRSMG
E3B8H1          LLPVTDAGLLSVAASGAAVVYHHGTTHKEQIALCTKILDQVGAHYFGSILNMTP-PRSMG
A0A7D7WDT9      VLPVTDATVVSTMVDGVVFVLAVGQTRKTAGAVARAQLEQVNARVLGVVLNLVS-LNG--
A0A0Q5AWK6      ILPVTDASIVATVVDGVVFVVASNRTRRPEVTAARRILAQVRGRVLGTVLNMVT-AQD--
A0A6P1F176      ILPVTDASIVATVVDGIVFVVASNRTRRPEVTAARRIVQQVHGRVLGTVLNMVS-AQD--
A0A3N1NLD3      ILPVTDASIVATVVDGVVFVVASNRTRRPEVTAARRIVQQVRGRVLGTVLNMVS-AQD--
A0A3N2FVI8      ILPVTDASIVATVVDGVVFVVASNRTRRPEVTAARRIVQQVRGRVLGTVLNMVS-AQD--
A0A2S5XDQ6      VLPVTDASIVATVVDGVVFVVASNQTHRPEVVAARRIVQQVRARVLGTVLNMVT-ARD--
A0A2S5XNN6      VLPVTDASIVATVVDGVVFVVASNQTRRPEVVAARRIVQQVRARVLGTVLNMVT-ARD--
A0A3L8NYD3      LLPVTDAGLLSGIVDGSILVLAVGKTYKEQARLAAKVLQQVGGHVLGSVLNRAP-LGGI-
A0A1M6K628      LLPVADAGLVSAVSDGVLLVVQHGKTLREQIALATRNLDNVDAALLGFVMNQVP-KKDL-
A0A561E8R3      LLPVTDAGLLARSADGALLVMHVGRTRAEHIRLCARILTQVGGRLFGGVMNLTP-PKNM-
A0A345NSU7      VLPVTDAMVIEKLTGGMLMVVASGETRKRHVSEAMRVLETTGTHVAGFVLTKAPAQPSA-
A0A222TG79      VLPVTDAVIASRLVDGVIVVVRSGASRRPDLESMLSHLGRANAAVVGVVLGDAQSRAGY-
A0A0W8I9Y2      LLPVTDAALLTASADGAIIVATAQKTTTDELSKALENLHQVHGNVLGVVLNRVP-TTGA-
A0A7C6LSF9      LLAASDVFDLLPIVDTVLFVVRNGRITEGAAQRVSELLGRFHVPVTGAILVGIQTGKGY-
A0A255G8R8      LLPVSDGLVLGKLVGGALLVTGIERVKKPQLAESLAALGTVDVKVQGVVLNMVR-RKER-
A0A6G7Y423      LLPVTDAVVLASQTGGAILVARSGVVRRPQFEGAVDLLKAGDVATLGVVLNDVT-SPEK-
A0A4Q4D4T1      LLPVADAALLSVISDGAILVVRHGRTGHDQVRAASERITTVGGRLLGTIISMSP-KKET-
A0A261FE22      MQVSNDASLFAREGATLLLVVAQTVGRKKVLRDVAHEFKVSRVKISGVAFNRVAHERSR-
A0A5C8C085      LLPVTDGAVLTTMADGAFIVVSAGRTLDNELEASLEHIKAVNGTTLGIVFNGVAARDAY-
A0A4Y5YMQ6      LLSVADATIISQYVDSTIVVVNTRKTTRAQLERCLAALRGVGANLAGLVLNNVR-EQKK-
A0A1E4BP96      TLLVADAAVLSRVTDGALLVTSAGRTTHEMLQRSLENIAKVNGRLLGVVLNKAT-RRGR-
A0A151BT98      MLPVVDALELEKLTGNLILVARGGQVSRRELQITLKALETVDANLSGTVLNYAD----H-
A0A2Y8ZRF8      MLPVVDALELEKLAGNLILVARGGQVSRRELQVTLKALETVDANLSGTVLNYAD----S-
A0A2R9UAT1      LLPVTDAAVLTHSADGAIVVVGAGRTTIDVLKKAMNNLERAGGRALGVVLNRVP-RSGG-
A0A4Q5J5D7      LLPVTDAAVLTAVADGAFVVISSGRTVDTELRDALANLDAVRGRALGVILNRVA-RRDA-
A0A3S0V9U6      LLPVTDGSLLSTSVDGAILVTKVGSTRRDQAEGAKAMIDKVQGNVLGAVMNMAP-AKGI-
A0A1S2N0P2      LLPVTDGSLLSANVDGAILVSVCGRTRKDQAQAAAQALGRVNGHLLGTVMNMTP-EKGL-
A0A0Q3BEY5      LLPVTDGSLLSANVDGAILVNVCGRTRKDQAQAAAQALGRVNGHLLGTVMNMTP-EKGL-
A0A4R6Q3C6      LLPVTDGSLLSANVDGAILVNVCGRTRKDQAQAAAQALGRVNGHLLGTVMNMTP-EKGL-
A0A2X3GKL3      LLPVTDGSLLSANVDGAILVSVCGRTRKDQAQAAAQALGRVNGHLLGTVMNMTP-EKGL-
A0A1Y4CKD6      CGMFQDAAMLANWVDEVLFVVRFDKVGRHNVQDALSMLDGERASVLGYVLNGCPQTAGS-
A0A0Q7KBQ4      MLPVADASILMREVDGALMLVRHGSTTREQLRLAVARIETVGGKLFGTILNRTP-RRAG-
A0A5Q5BFU2      LLAVTDAAILAAGADGVLIMARFGHTTHEQLTHAVGSLESVGAALLGAVFTMIP-TRNN-
A0A439DNZ6      LLAVTDAAILAAASDGVLIVARYGETKREQLAHAVGNLRSVGAPILGAVFTITP-TRGG-
A0A7I7UD03      LLAVTDAAILAAAADGVLIMARFGSTKREQLAHAVGNLESVGAPLLGAVFTLMP-TRGG-
A0A7I7MI62      LLAVTDAAILAAGADGVLIMARYGHTRREQLIHAVESLESVGAPVLGAVFTMVP-TRGS-
A0A0J6YE86      LLAVTDAAILAAGADGVLIMARFGQTKREQLAHAVGSLESVGAPLLGAVFTMVP-TRGT-
A0A7I7K1R9      LLAVTDAAILAAGADGVLLMARFGHTRREQLIHAVGSLESVGAPLLGAVFTLMP-TRGS-
A0A7I9ZLK4      LLAVTDAAILAAAADGVLIIARFGQTKREQLVHAAENLASVGAPLLGAVFTMMP-TRGT-
A0A1F1IHY9      LLPVTDAAILARRFDGCLLVVSAGRTTYDEFSKAVSSIRKIDGEVLGAVLNRVP-ASGT-
A0A7H2BCD6      VLPVTDATLLSKAVDGTVLVATIGGTQREHLREATENLHQVKANLIGLVLNQTP-RGGF-
A0A542HCT5      LLPVTDAAVLTASADGALVVVSAGQTLDTQLRDALANLAAVNGHTLGVVLNRVS-PKSS-
A0A0Q5M6Z7      LLSVTDAAIMGTIADGVVITVGAKQVTGEQLEKAYRSVVRVNGKVLGVVLNKIP-PRGI-
A0A7G6YA19      LLSVTDAAILGTIADGVVITVGAKQVTAEQLQKAYRSVSRVNGKVLGAVLNKIP-PNGV-
A0A2S8WHZ8      LLPVTDAAILSTSADGILVVVRAGSTTGDELGKAIENLKKVDANILGAILNQVP-TKGA-
A0A537WNY9      LAPISDARVIARFADASVIVVSAGSATRRQLRTAIERLSVISVRPTAVVLNDAP------
A0A5B8M469      VLPVTDALLVGAVADGTLFVVAVGQTRKAEVTAARRLLEQAKSRLLGVVLNKVPVNDRD-
A0A1Y4CTD2      VAAAADAELWMRQVDTVVLVVRQDMTDVRVINDTVDVAWKSAGDFSGFVLNA---FQGE-
A0A3N3ZPU0      LLPVTDPSVLAKGADGVVIVTQANKTNLDDLTKAVARLHTVGATILGAVLNQVP-RKGS-
A0A359IQX7      LLPVTDGGLLTAAADGAILVMATGRTYKEQLRVCARILKQVNGRLLGSVMNLAP-LRGI-
A0A433EDP2      LLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAP-RKGL-
A0A231VTW0      LLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAP-RKGL-
A0A433ECD0      LLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAP-RKGL-
U7V3Z1          LLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAP-RKGL-
A0A1F1J417      LLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP-RKGL-
A0A2A8D6P2      LLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP-RKGL-
A0A1F0THV9      LLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP-RKGL-
A0A5F0M6Y0      LLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP-RKGL-
E3H5W1          LLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP-RKGL-
A0A1F1QKB0      LLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP-RKGL-
A0A509JY23      LLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP-RKGL-
A0A448USF4      LLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAP-RKGL-
A0A0Q9LZR0      LLPVTDAAVLTASADGALVVVSAGHTLDTQLRDALANLATVNGHTLGVVLNRVS-PKSS-
A0A1N7E3F1      LLPVTDAAALGAICDGALLVVRHGKTRNEQVLRAGELLSSINARLVGTVLNFVP-AKHG-
A0A544ZKQ1      LLPVTDAAALGAICDGALLVVRHGKTRREQVLRAGELLSSINARLVGTVLNFVP-AKHG-
A0A372P1T1      LLPVTDAAALGAICDGALLVVRHGKTRREQVLRAAELLSSINARLVGTVLNFVP-AKHG-
A0A5D0Q2X0      LLPVTDAAALGAICDGALLVVRHGKTRREQVLRAGELLSSINARLVGTVLNFVP-AKHG-
A0A5R8Z2E7      LLPVTDAAALGAICDGALLVVRHGKTRREQVLRAGELLSSINARLVGTVLNFVP-AKHG-
A0A1L2ZMV4      LLPVTDASVLSTSADGVLVVARAGSTSIEALKKATDRLDRVNGHVLGVVLNQVP-RKGS-
A0A6I3F378      VLPVSESLAVSRHADGTILVVRSGRTRSQQLQRTLGEFDRIGSPVLGIVLNGLD-RKHT-
A0A1S1CQC5      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAP-RKGL-
A0A1E9T6I0      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAP-RKGL-
A0A1F1GHA7      LLPVTDASLLSHSVDGVILVGSIGRSHREQMAEASSILKKVNANLFGLVLNRAP-RKGL-
A0A1S1CAD0      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAP-RKGL-
G5ET14          LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAP-RKGL-
A0A1E9DXX2      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAP-RKGL-
A0A1E8S156      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAP-RKGL-
A0A1E8S5S2      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAP-RKGL-
A0A1S1DFA8      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAP-RKGL-
A0A2I1Z490      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLLGMVLNRAP-RKGL-
A0A1F0DAA9      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAP-RKGL-
A0A1F0PHK9      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAP-RKGL-
A0A1F0VZG6      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAP-RKGL-
A0A1E9G8X4      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP-RKGL-
A0A1E9IAW2      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP-RKGL-
A0A1E9ZBC9      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP-RKGL-
A0A1E9ZDP4      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP-RKGL-
A0A1F0R6B5      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP-RKGL-
A0A1F0Z7N5      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP-RKGL-
A0A1F1D897      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP-RKGL-
D2NP38          LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAP-RKGL-
A0A1F1FV74      LLPVTDASLLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAP-RKGL-
A0A1E9M791      LLPVTDASLLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAP-RKGL-
A0A291DEI8      LLPVTDASLLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAP-RKGL-
A0A1S1D5T1      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAP-RKGL-
A0A1E8TRD6      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAP-RKGL-
A0A1F0XT88      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAP-RKGL-
A0A1F1EVP5      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAP-RKGL-
C6R548          LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAP-RKGL-
A0A0K2RXS2      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNAKLLGMVLNRAP-RKGL-
A0A1F0KX60      LLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNAKLLGMVLNRAP-RKGL-
A0A542I3V2      LLPVTDAAVLSRAADGVIVVAKAGRTTRDEFERSLRALQKVQAPVLGAIFNCVP-TKGV-
A0A2T0UZ65      LLPVTDAALLSGAADGTILVFAVGKTHKDQVEACAKMIQQVGGRILGIVLNMAP-KRGM-
A0A1R4JTI6      LLPVTDAAILAAKYDGCVLVVTAGRTTRDELAKSLGNLEKVNGDVLGTVLNRVP-TRGK-
A0A4R7TM52      LLPVTDAAVLAHNADGAMIVASVGKTTVERLQKAIQNLDRAGARCLGVVINRVP-VRGR-
A0A542XE74      VLAVTDGALLSAAADGTILVTRLGRTHRAALEQSTKLLDQTKARLLGVVLNAAS-KRSL-
A0A0Q7QDF6      LLPVADAALLSVISDGAILVVRHGRTGHDQVRAASERITTVGGRLLGTIISMSP-KKET-
A0A5R8L819      LLPVTDAAVLSRQADGAIIVVTAGKTTYDLLKRALANIEKVGGRALGVVLNRVP-KRGG-
A0A7K0PFV4      VGEVGDALPLLGDVDDVLVVGRPGSTDDRALGAMAGYLRRAGVAPTGWIVTGVD------
A0A0G3V3F3      SGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTE------
A0A7K0MUQ7      SGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTE------
A0A7K0U619      SGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTE------
A0A6I3DFP2      SGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTE------
A0A7K0SI36      SGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTE------
A0A7K0V140      SGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTE------
A0A261FQA1      MSVANDSAVFAKEGGTLLMVVGQGVAQKKTLKASAEEFELVGVKPAGAVVDMVKEQRGK-
A0A1Q2CJ92      LLPVTDATLLSASADGAVVVVQSGTTRREQLEVAAHKLRQVDGNLLGVVLNKVA-KKDL-
A0A2T0S3C8      LLPVTDGAVVAARADGALLLARSHKTTSSQIQTAARALQSVDARLLGCVFNMVS-AKGP-
A0A4Y8WZJ3      LLPVTDAAILARRFDGCLLVVSAGRTTYDEFSKAVSSIRKIDGEVLGAVLNRVP-ASGT-
A0A285VUW0      ILPVTDALVMSRLTGGLLMVVSAASTRRRHLQEALRTLEAAEAEVSGFVLTKTP-AERS-
A0A2R7Z032      LLPVTDAGLLSAFCDGALLVQATGQTYIEQSEHCRRILDQVGSRLLGIVLNKAP-LKGV-
A0A6J4MTQ2      LLPVTDAGLLTAFCDGALLVQTTGKTQIEQSQHCRRILDQVGGRLLGVVLNKAP-VRGV-
A0A1I0W453      LLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQSCRRILDQVGSRLLGVVLNKAP-VKGA-
A0A1H4LCS9      LLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGGRLLGVVLNKAP-IKGA-
A0A4Q2RZP8      LLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGSRLLGVVLNKAP-VKGA-
A0A0Q6VV12      LLPVTDAGLLSAFCDGALLVQAAGRTQIEQSQQCRRILDQVGSRLLGVVLNKAP-VKGA-
A0A495NTA9      LLPVTDAGLLSAFCDGALLVQAAGRTQIEQSQHCRRILDQVGSRLLGVVLNKAP-VKGA-
A0A0Q9QB08      LLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQQCRRILDQVGSRLLGVVLNKAP-VKGA-
A0A4Q2SA86      LLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGSRLLGVVLNKAP-VKGA-
A0A4Z1C3Z0      LLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRILDQVGSRLLGVVLNKAP-VKGA-
A0A6V8KDX4      LVPVTDAAVLTAMADGAVMVARSGKTSTAQIRTGLARLRAVDARVLGCVLNMQA-TKAS-
A0A444BL03      LLPVTDAGVLSASCDGSLLVFAVGRTHKEQAELAARMMGQVGGRVLGVVLNMAP-KRRA-
A0A4Y8X357      VLPVTDSTLLANAVDGTILVVRHGTTRKEHVEVARDMLARVHARVLGVVLNGVP-ASGV-
R4LD52          LLPVTDAAVVAARADGALLLARSHKTTTAQVSNAVTALQSVDARLLGCVLNMVA-AKGP-
A0A4T2CD79      LLPVTDAAILAAISDGAIIVVSAGRTTTDELERALAGISMGGGRTLGVVLNRVP-TKGA-
A0A6L6AM03      LLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQQCRRILDQVGSRLLGVVLNKAP-VKGA-
A0A4Q2RU39      LLPVTDAGLLSAFCDGALLVQASGKTHIEQSQHCRRILDQVGSRLLGVVLNKAP-VKGA-
A0A4Q2SK58      LLPVTDAGLLSAFCDGALLVQASGKTQIEQSQHCRRILDQVGSRLLGVVLNKAP-IKGA-
A0A2N3YJR1      LLPVTDAGVLSASCDGALFVFAVGKTHREQARLAARMMGQVGGRVLGVVLNLAP-KGRA-
A0A6G8FYB9      LLPVTDAGVLAGFCDGTLLVFAVGRTHKEQARLAARMMSQVGGRVLGVVLNLAP-QRKV-
A0A4Q4D742      MLPVADASILLTEVDGALLLVRHGSTTREQLRLAVERVETVGGQLFGCVLNRTP-RRAS-
A0A1C6T1J1      LLAVTDGVVVAVQSDGALLVSQQGRTSRTQVAAAARALHAVSVRLLGCVLNMAK-VPKA-
A0A2W2CFC8      LLAVTDGVVVAVQADGALLISQHGRTARTQVAAAARALNAVSVRLLGCVLNMAK-LAKA-
A0A2W2A4B0      LGSVTDAALVSRAVQNMLLVVASGRVRRAEVSSSIESLATVGASVQGVVVTMAR-SRGA-
A0A4Y9MDA5      VLPVADAAILSRSVDGVLLLANVTRVRRAQLTEALRSLAQVEAGVQGVVLNQVH-REA--
A0A1H7N9P7      VLPVSDAAVLSRSVDGLVVLADVTRVRRAQLSQSLHSLAQVQATVLGVVLNQVR-REA--
A0A1M7V0F8      VLPVADAAILSRSVDGLLVLANATRVRRPQLTETLRSLAQVGGTVLGVVLNQVR-RDE--
A0A1M3LEY6      LLPVTDSALLSKQVRGALLIVAAGRTHRGQVHGSVEALQNVGAHVAGVVLTMLP-TRGP-
A0A538AJI7      LLSTDDARTIATMAKGILLVVTRGTLAR-SVNEAVVAIEALQAPLMGIVANRFK-ESSV-
A0A538AM15      LCPVQDCRVIAHWIDGFLLVVAAHHTPR-RLVEEALNVVE-RGKMLGLVFNGGD-HAPA-
A0A519GXS6      VLSVSDATVISQYVDATVIVVNTRRTGKAKIEQAVAALQSVRANLAGIVLNNVA-VSRR-
A0A520EHH5      LLPVTDAATLATQCDGTILVTRYGDTRREELTRAAANLENVGASLLGVVMSMVP-ATGR-
A0A4R0U4F1      MQVANDAAVFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGLAMNYGE-TEKP-
A0A1V8PLV6      MVVANDAAVFGAKSNGIVLVSGRDMTMKRDLKEIAVQLDNLNVPVMGFVFNFAK-ERKV-
A0A357ZCV8      VGTFVDAAIIGTLVDGVIFVVRPKHTKRKEMAFAYDQLGKADVHILGACANYRE-SVAS-
A0A4R1CW45      VFANDDAVLSTRALDGYIMVVDSGRTSRRQLADAMEMLNPVPC--LGTVLNRYA-GGML-
A0A4R5Z7B0      LLAVADPQILANKVDASVFVVFSGKTEIDQAKKAKELLENAQSKLVGVVLNHKE-VKSN-
A0A542H054      LLAVTDAQVLSNKCDGTVLVLSSGTTEVDSAKKAKELLDTTKGKLLGVILNNRE-MKET-
A0A6M8GFV5      LLAVTDAQIISQICEGTILVVRRGYTSKEKIKKAKELLTLVNANILGVVLNRAE-QEKD-
A0A7G8U6J2      VLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKDLLLKANTSLLGVVLNGVE-TDNS-
A0A419GS64      VGIVSDAAIISTMVDGTILVLDLKGGHRNMSVRAKKTLEKVNANILGLVMNNLK-IDKD-
A0A2V2CXY5      LGSVADALNVAPHCDGTVLVVRSGATPRKLVDNSVQLLKRTETPLLGIVLNRAD-MNSK-
A0A2S8MDM2      LLAVTDAAIMAAGADGVLVIARHGSTKKDQLTHAVSSLHSVGAPVLGAVFTMMP-TRGS-
A0A357ZDL3      LGPFVDAAIVGALVDGVVMVVRPRHTKRKDLLFAYDQLKKSESRILGACASYND-RASA-
A0A4Y8ZIU8      VLPVTDSTLLSTAVDGTVLVVRHGKARKEHVEVARDMLAGVNARVLGVVLNGTP-ASGV-
A0A1I6GVG4      LIPVTDAAVLAHSADGAIIVGTVGKTTFEVLGKAIGNLERAGARALGLVLNKVP-RRGS-
A0A1I6IST1      LIPVTDAAVLAHSADGAIIVGTVGKTTFEVLGKAIGNLERAGARALGLVLNKVP-RRGS-
A0A412JBM5      INTVADAQILSPLVDGVILVALSQKSTRGELNAAIDSVSRAGGNLCGVVINGMD-MKAT-
A0A6J4SUA1      LGAGTDAYALGVAAGSVVLVFREGKTDRRMAQAKLGVLDRLPVHMLGAVLNCVP-ASGG-
A0A1C2B334      ILPVSDGAVVSQWVPNAILVVRADSTKRPELAAAWQQWKATNVRLVGVVVNDAS-DRAG-
R7Y679          VLPVTDAVVVSQWVDGGIIVVRAGGTTRQELVASLAQLHASRVSILGVVLNGVN-LKAR-
A0A0F0KYJ9      LVPVTDAAVLAHSADGAIIVGTVGKTTYEVLGKAIGNLERAGARALGLVLNKVP-RRGS-
A0A7M2YYB9      LLAASDAATLASHVGADVVFVVAHGTKKRRVTRAIGKLDLVGVNVLGFVANREG-DLSE-
A0A538BBM6      VLPVADTLVVGRFAAGALLVIEARATPVPSISRAKDALTRNQTRILGLVLNRLK-AQDS-
A0A7K0LE65      SGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTE-VVNR-
A0A510HHA8      VEPVADPLILATQADGVLVVLDGQRTRKGSLRKALHDLRSVKANVLGTVMNNFD-GGRG-
A0A6G8Q9J3      LELVSDAAILATQADGVLLAMDAQKTRKIALRRAVRGLQLVGANVLGVVVNNVE-DSGE-
A0A5Q2F9A3      LLPVTDAAILSGMTTGALLVVGSGEVRAPQLAAALESLESVEGRLLGIVLNKLR-GKDV-
A0A4R1BMZ2      VGLVSDPVVISTQGDGVMLVLDAHSTGKGALRKSLHSLEAVGANIIGTVMNNVR-GGKG-
A0A023X491      VQVVSDAAIVAAQADGVILVFDAQSTRKLSVRRSIRTIESVGAKVLGTVMNNAR-PARN-
A0A6G8QDQ0      TAPVSDPAILATQGDGVLLVLDAQKTRKASLRKAKRTLDAVGASVLGTVMNNVK-GGQK-
A0A0K8Q3D9      LLPVTDAAVLSRIADGAIVVIRAGKTTQVELENSLGNLQKVRGRVLGAVLNYVP-TKGT-
A0A2R7RCA1      LLPVTDAAVLSRAADGAIVVIRTGRTTQEQLAQSLGNLDKVKGRILGAVLNYVP-TKGT-
A0A1Q7WJN6      LVAGVDAFVLGTVTGALVLVLRAGMSDRDVATAKLDVLDRLPVRLLGAVVNDVR-S----
A0A6D1QMN1      VNAVTDPQIIASLTDGTVLVIRSGVTEIEDAQHAVANLKKVEAHLLGTVLNDRA-VEKS-
A0A1E2SNF6      LLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTGVVLNRVP-RRGA-
Q6ADE8          LLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTGVVLNRVP-RRGA-
A0A1Q7CZ24      FVPVPDCRVITKSVDGFLVVVTVHRTPWGVLTEALDLIDP--AKVVGLVVNGDD-TRRS-
A0A2W6VLC6      LLPVSDAAVLAKQTRGALVLVGAGRVTRNQLQESLEGLRAVGATVAGVVLSMAP-TRGP-
A0A519G798      LLPVSDAAIMARDVDGAILVVRHGKTTKEQLKQATMRLEQVDANLLGVMVNMTP-KRGG-
                     :                                        .             

A0A6N6NKS9      --------------NDYYYV------YYNSEGKRVSHKDREKQLME--------------
A0A538BYZ4      YG------------GAEYYG----------------------------------------
A0A348NU28      --------------ESAYYT---------------------ANTDA--------------
A0A2N4T4Q5      --------------DAGFYG------YYGKSYYASDDSGGDAPEAP--------------
A0A4Q5APW3      --------------------------LEHSNYYYYYSDSSKKGRFSLK------------
A0A4Q5B0V3      --------------------------LEHGNYYYYYSDSSKKGRFSLK------------
A0A022KX11      -----------------DYR------YGYHRYEEEMTRRARKAART--------------
A0A4Q5A868      --------------------------LEYSNYYYYYSDSNKKRSKKGRFSLK--------
A0A6N4VXX3      --------------NHSSYA------GSYYYY---YGKSRRDTRTS--------------
A0A1H4I042      --------------SRSAYG------GAYYYYGDNRGSNSRHSRKT--------------
A0A4R7A6D9      --------------SRSAYG------GAYYYYGDKRGSNSRHSHKT--------------
A0A1Q2CRV2      --------------RSEGEA------YGYRHSYYSDHPRAAPKKGD--------------
A0A7K0NRJ7      -----------------RSA------YYEA------------------------------
K6WHS4          -----------------PYR------F-------RYYGVNVENNAD--------------
A0A1L2ZMQ6      --------------AS-RYG------YYGK------YYSKKETKAK--------------
A0A3E2DN22      --------------GDVLYG------YGAANYGYGSYYGDYGKRG---------------
A0A3Q9ULZ9      --------------GDVLYG------YGAGSFGYSSYNSYYTDKNG--------------
A0A3S9JFL2      --------------GDVLYG------YGAGSFGYSSYNAYYTDENG--------------
A0A7K0NTR2      --------------AG-YYG------YYGY----YGYGYGYAHPGE--------------
A0A1H6WL79      --------------GDLNYG------YYGA----YVSADESRDTIP--------------
A0A101LAM5      --------------GDLNYG------YYGA----YGSAEDLKDHQP--------------
A0A4Y3NEG0      --------------GDVNYG------YYGA----YGSAENPQDDTP--------------
A0A1Q2CI19      --------------GDIGYG------SGYG----YGYGETKGKAKG--------------
A0A512T3M3      --------------GH-GYG------YGYG----YGESGRRRSEKP--------------
W6JTW4          --------------SR-SYG------YGYG----YG-SPRSTSKKP--------------
A0A0A0JTY0      --------------AD-AYG------YGYG----DDRMSKRKAKRA--------------
A0A0A0JXF2      --------------GD-AYG------YGYG----ETRKAKKKVKRE--------------
E6S8H2          --------------SA-GYG------YGYG----YGYG----------------------
A0A0A0JGH0      --------------AD-GYG------HSYG----YGDTARPQRDSP--------------
N0E4U7          --------------AD-GYG------YGYG----HGDT-KKRKGAR--------------
A0A0A0IYK2      --------------AD-AYG------YGYG----ENRQSKRKAKRA--------------
A0A0Q9L0H3      --------------AD-AYG------YGYG----ENRQSKKKARRG--------------
A3TMK0          --------------GD-TYG------YGYG----DARKTKKKVKRG--------------
A0A543PXP1      -----------------RST------YGYG----RGYGYGYGVSKQ--------------
A3TMH6          --------------AG-RYG------YGYG----SGYGQGYDAERS--------------
A0A6I2XCV4      GYYGYYGAGYYGSGYY-GSG------YYGS----GYYGSGYYSSGE--------------
A0A5R8VLL6      --------------FE-GYS------YYSP----EPDSLDSTSSPE--------------
A0A3L7ADK2      --------------AH-QYG------YYGG----TYYANEETPATT--------------
A0A538JQF8      --------------RV-RSP------YGRP----PQYQLNLPSWKS--------------
A0A1H6YPK1      --------------VK-HYG------YGNT----S-------------------------
A0A0Q9TBP0      --------------YN-GVG------DSAR----ATYSYTSRERAV--------------
A0A0G3V3M7      --------------AG-YYG------YYGY----YGYGYGYAHPGE--------------
A0A6I3DD56      --------------AG-YYG------YYGY----YGYGYGYAHPGE--------------
A0A5Q2FA83      --------------ND-DSA------SRYG----GYYAYGRSKKDK--------------
A0A2R7MGI0      --------------SS-YYG------ARYG----GHYGYGESHA-T--------------
A0A2T7WQY4      --------------SS-YYG------ARYG----GAYGYSEPDA-D--------------
A0A1G6GTN3      --------------SG-YYG------AQYG----GYYGYGAERS----------------
A0A1N7DLV3      --------------SN-YYG------SQYG----GYYGYGAPSSGV--------------
A0A1V2NSB5      --------------SN-YYG------SQYG----GYYGYGAPGSGA--------------
A0A0Q5Q5L3      --------------SG-YYG------MQYG----GYYGYGIGRT----------------
A0A0Q6DVM4      --------------SG-YYG------MQYG----GYYGYGIGRT----------------
A0A1R3WWR6      --------------ST-YYG------GRYG----GYYGYGAPRG----------------
A0A2S5WZJ5      --------------AD-GYE------YRRN----RSYYVTADRKGM--------------
A0A0Q5JKD6      --------------SG-YYG------SQYG----GYYGYGVPSSSP--------------
A0A2W6DK08      --------------VK-GRS------YRNL----MSYSNGSRGSDR--------------
A0A2S0LQ32      SVYY----------GY-GYG------SYGH----HYYYGERPRGWRRL----LPG-----
A0A2N6V1R5      SVYY----------GY-GYG------GYGQ----NYYYYEEDEKRKLLGFIPLPGHRKRK
G9PHS6          SVYY----------GY-GYG------GYGQ----NYYYYEEDEKRKLLGFIPLPGHRKRK
U1PLM7          SVYY----------GY-GYG------GYGQ----NYYYYEEDEKRKLLGFIPLPGHRKRK
A0A346XTB0      --------------AG-AYG------YG--------YGVAEDDDGQ--------------
A0A6I1G2U1      --------------SD-GYG------YG--------YGSASEDPAA--------------
A0A351ETF8      --------------PD-KYS------YYG-------QYAEQTAETA--------------
A0A542FTE6      --------------AQ-YYG------YYGQ----KAYYTPTQRPKV--------------
A0A349B7N2      --------------VG-SGD------TPAT----KRYYYSKDPTSE--------------
A0A7J5B4S5      --------------AD-GYE------YRRN----RSYYVTANKKGM--------------
A0A4Q2JUT1      --------------AA-TYS------YEYR----RDYTSSGSEGTT--------------
A0A6L5R0V7      --------------AA-TYS------YEYR----RDYTSSSGPEAQ--------------
A0A2S5UYV0      --------------AD-GYE------YRRN----RSYYVTADKKGM--------------
A0A2S5X9U6      --------------AD-GYE------YRRN----RSYYVTADKKGM--------------
A0A2S5ULV5      --------------AD-GYE------YRRN----RSYYVTADKKGM--------------
A0A653YMF0      --------------AD-GYE------YRRN----RSYYVTADKKGM--------------
A0A3Q9IY80      -------------------G------Y---------HDYRYAGDYY--------------
A0A0F0LP73      --------------AN-GYG------YYRK----NSHYYAQTSRND--------------
A0A346Y185      YGDY----------AY-RYG------YS--------YAYGYGETPD--------------
A0A4V1VGV9      STIYGYGAGNYG--GA-TYG------YG--------YGSSEDPSAA--------------
A0A7G8U6P0      STIYGYGAGNYG--GA-TYG------YG--------YGSSEDPSAA--------------
A0A259S8H9      ---------------N-GYG------YYRK----NSRYYMKSHRAA--------------
A0A2W1Z497      --------------AR-DYG------YYGG----AYY-----------------------
A0A0Q5L115      --------------AR-EYG------YFGG----SYYYYEGDVGTG--------------
A0A7G6YY64      --------------AR-EYG------YFGG----SYYYYEGEVGTG--------------
A0A1F1X071      RLAYG---------DA-VYG------YSAY----GKYGYGALGGYD--------------
A0A3R8RWC7      RLAYG---------DA-VYG------YSAY----GKYGYGALGGYD--------------
A0A4U0RJZ4      STVYGYGAGNYATAGY-GYG------YG--------YGYGHTDESD--------------
A0A4R1FGL9      STVYGYGAGNYATAGY-GYG------YG--------YGYGHTDESD--------------
E3B8H1          STVYGYGAGNYATAGY-GYG------YG--------YGYGHTDESD--------------
A0A7D7WDT9      --------------AD-GYG------YG--------YGYRQNRNYY--------------
A0A0Q5AWK6      --------------GD-T-G------Y---------YYYDRKNSYY--------------
A0A6P1F176      --------------GD-A-G------YS--------YYYDRKNPYY--------------
A0A3N1NLD3      --------------GD-A-G------YS--------YYYDRKNPYY--------------
A0A3N2FVI8      --------------GD-A-G------YS--------YYYDRKNPYY--------------
A0A2S5XDQ6      --------------GD-T-G------Y---------YYYDRKNAYY--------------
A0A2S5XNN6      --------------GD-T-G------Y---------YYYDRKNAYY--------------
A0A3L8NYD3      --------------GGVVYG------YGHATHS-QDYYSAYDRTGG--------------
A0A1M6K628      --------------GAAAFG------YGYSGAS-PRYYYAEDDGRR--------------
A0A561E8R3      --------------GSAVYG------YGYSGKKYNGYGYGYGDSPA--------------
A0A345NSU7      --------------YYSYYG----------------GEHASTRPDG--------------
A0A222TG79      --------------YANSYA-------------------LEYGQVG--------------
A0A0W8I9Y2      --------------DAGYYG-------YYGKSYYANSDDQPAPKTG--------------
A0A7C6LSF9      --------------G---YG------YGYGSASDDPAAQRRASRKK--------------
A0A255G8R8      --------------GDAYGY------YAYGSEP---------------------------
A0A6G7Y423      --------------GQE-AY------YGRDHRPAGPGAAGARRARR--------------
A0A4Q4D4T1      --------------ARYGYG------YGYDD-----------------------------
A0A261FE22      --------------KGNYYY------YEESETKAKKSSKRSSRKAS--------------
A0A5C8C085      --------------TSAYY-------YSQDADPSAKKRPKADKEPK--------------
A0A4Y5YMQ6      --------------EKYLYTMEP-------------------------------------
A0A1E4BP96      --------------PDYGYA------YGSGA------------ADT--------------
A0A151BT98      --------------FSDDYG------YGSKYGYGEQEMAASGRTRS--------------
A0A2Y8ZRF8      --------------FSDDYG------YGHKYGYGEQPPAARG--QS--------------
A0A2R9UAT1      --------------GYYDYRYTGDYYQADQTPYDEAVHNPPNNVDG--------------
A0A4Q5J5D7      --------------AAGYYG------GTYELSDKDKVPAAVGATDE--------------
A0A3S0V9U6      --------------GSQYYG------FGYGGYRSEYKSYYGRSGQG--------------
A0A1S2N0P2      --------------GSHYYG------FGYGGYRSGYQAYYGQDGEG--------------
A0A0Q3BEY5      --------------GSHYYG------FGYGGYRSGYQAYYGQDGEG--------------
A0A4R6Q3C6      --------------GSHYYG------FGYGGYRSGYQAYYGQDGEG--------------
A0A2X3GKL3      --------------GSHYYG------FGYGGYRSGYQAYYGQDGEG--------------
A0A1Y4CKD6      --------------YGYGYGRYGYGKYGYGSYGDGYGGLADEVDEG--------------
A0A0Q7KBQ4      --------------DVYGYG------YGY-----------GYGQEQ--------------
A0A5Q5BFU2      --------------ASYSYG------YYGYGEEATGQ----QARHG--------------
A0A439DNZ6      --------------ASDNYS------YYGYSYGDGTSNSAVATTPR--------------
A0A7I7UD03      --------------SSYSYN------YSYYGSDSGVIAPKVLRAPD--------------
A0A7I7MI62      --------------ASYGYG------YGYYGEDAARR----QQPRE--------------
A0A0J6YE86      --------------GSYSYN------YGYYGEDEGRRGGNSSTRGG--------------
A0A7I7K1R9      --------------LSYSYD------YSYYGLPEPKRSSRGKTPVS--------------
A0A7I9ZLK4      --------------SSYSYS------YSYYGTEGGERAASRRQPNV--------------
A0A1F1IHY9      --------------AASAYQ------Y--------YGATYYTASQQ--------------
A0A7H2BCD6      --------------GGGYYG------FGYAS-TRGYKSYYGYTSDK--------------
A0A542HCT5      --------------SAGYYS------GSYAALEEHSKQQQTHEPAG--------------
A0A0Q5M6Z7      --------------DSHDYG------YYRSNYYTSNADE-----SG--------------
A0A7G6YA19      --------------DSHDYG------YYRNDYYTSNEAAAIEAPAN--------------
A0A2S8WHZ8      --------------GAAQYG------Y--------YGKYYYSNTEQ--------------
A0A537WNY9      ---------------------------------IGDSSYYHMGPEK--------------
A0A5B8M469      --------------GGYSY-------------YHNNRSYYTRPESG--------------
A0A1Y4CTD2      --------------WSLTHG------RGYSAY----------------------------
A0A3N3ZPU0      --------------GANEYG------YYSDAYYYSSSSRH--------------------
A0A359IQX7      --------------GAVVYG------YGYGT-YTYSSKYYRYARDT--------------
A0A433EDP2      --------------GNSYYG------FGYANSYVGYATYYGYSKDG--------------
A0A231VTW0      --------------GNSYYG------FGYANSYVGYATYYGYSKDG--------------
A0A433ECD0      --------------GNSYYG------FGYANSYVGYATYYGYSKDG--------------
U7V3Z1          --------------GNSYYG------FGYANSYVGYATYYGYSKDG--------------
A0A1F1J417      --------------GNSYYG------FGYANSYVGYASYYGYSKDG--------------
A0A2A8D6P2      --------------GNSYYG------FGYANSYVGYASYYGYSKDG--------------
A0A1F0THV9      --------------GNSYYG------FGYANSYVGYASYYGYSKDG--------------
A0A5F0M6Y0      --------------GNSYYG------FGYANSYVGYASYYGYSKDG--------------
E3H5W1          --------------GNSYYG------FGYANSYVGYASYYGYSKDG--------------
A0A1F1QKB0      --------------GNSYYG------FGYANSYVGYASYYGYSKDG--------------
A0A509JY23      --------------GNSYYG------FGYANSYVGYASYYGYSKDG--------------
A0A448USF4      --------------GNSYYG------FGYANSYVGYASYYGYSKDG--------------
A0A0Q9LZR0      --------------SAGYYS------GNYGPLQETPQRAVRSEAGT--------------
A0A1N7E3F1      --------------SY--YG------YGYGYEADPVEQETSSRTPQ--------------
A0A544ZKQ1      --------------SYYGYG------YGYGYGYDSAAQETVSETPQ--------------
A0A372P1T1      --------------SYYGYG------YGYGYGYDAAAQEATPETPQ--------------
A0A5D0Q2X0      --------------SY--YG------YGYGYGYDAAAQEATPETPQ--------------
A0A5R8Z2E7      --------------SY--YG------YGYGYGYDAAAQEATPETPQ--------------
A0A1L2ZMV4      --------------SAGQYG------YYSDSYYYTSTDGQRTRRQS--------------
A0A6I3F378      --------------RYGYGA------YGYDASK---------------------------
A0A1S1CQC5      --------------GNSYYG------FGYASTYVGYATYYGYGKDG--------------
A0A1E9T6I0      --------------GNSYYG------FGYASTYVGYATYYGYGKDG--------------
A0A1F1GHA7      --------------GNSYYG------FGYASTYVGYATYYGYGKDG--------------
A0A1S1CAD0      --------------GNSYYG------FGYASAYVGYATYYGYGKEG--------------
G5ET14          --------------GNSYYG------FGYASAYVGYATYYGYGKEG--------------
A0A1E9DXX2      --------------GNSYYG------FGYASAYVGYATYYGYGKEG--------------
A0A1E8S156      --------------GNSYYG------FGYASAYVGYATYYGYGKEG--------------
A0A1E8S5S2      --------------GNSYYG------FGYASAYVGYATYYGYGKEG--------------
A0A1S1DFA8      --------------GNSYYG------FGYASAYVGYATYYGYGKEG--------------
A0A2I1Z490      --------------GNSYYG------FGYASAYVGYATYYGYGKEG--------------
A0A1F0DAA9      --------------GNSYYG------FGYASAYVGYATYYGYGKEG--------------
A0A1F0PHK9      --------------GNSYYG------FGYASAYVGYATYYGYGKEG--------------
A0A1F0VZG6      --------------GNSYYG------FGYASAYVGYATYYGYGKEG--------------
A0A1E9G8X4      --------------GNSYYG------FGYASAYVGYATYYGYGKDG--------------
A0A1E9IAW2      --------------GNSYYG------FGYASAYVGYATYYGYGKDG--------------
A0A1E9ZBC9      --------------GNSYYG------FGYASAYVGYATYYGYGKDG--------------
A0A1E9ZDP4      --------------GNSYYG------FGYASAYVGYATYYGYGKDG--------------
A0A1F0R6B5      --------------GNSYYG------FGYASAYVGYATYYGYGKDG--------------
A0A1F0Z7N5      --------------GNSYYG------FGYASAYVGYATYYGYGKDG--------------
A0A1F1D897      --------------GNSYYG------FGYASAYVGYATYYGYGKDG--------------
D2NP38          --------------GNSYYG------FGYASAYVGYATYYGYGKDG--------------
A0A1F1FV74      --------------GNSYYG------FGYASTYVGYATYYGYGKDG--------------
A0A1E9M791      --------------GNSYYG------FGYASTYVGYATYYGYGKDG--------------
A0A291DEI8      --------------GNSYYG------FGYASTYVGYATYYGYGKDG--------------
A0A1S1D5T1      --------------GNSYYG------FGYASSYVGYSTYYGYGKDG--------------
A0A1E8TRD6      --------------GNSYYG------FGYASSYVGYSTYYGYSKDG--------------
A0A1F0XT88      --------------GNSYYG------FGYASSYVGYSTYYGYSKDG--------------
A0A1F1EVP5      --------------GNSYYG------FGYASSYVGYSTYYGYSKDG--------------
C6R548          --------------GNSYYG------FGYASSYVGYSTYYGYGKDG--------------
A0A0K2RXS2      --------------GNSYYG------FGYASAYVGYATYYGYSKDG--------------
A0A1F0KX60      --------------GNSYYG------FGYASAYVGYATYYGYGKEG--------------
A0A542I3V2      --------------DSYAYY------GAYTA-APEAASSGSADRDV--------------
A0A2T0UZ65      --------------GSVMYG------DGYST-YYSHGSYEYYKSGP--------------
A0A1R4JTI6      --------------EAGYYG------YYGKS-YYSSSATPDQDFDV--------------
A0A4R7TM52      --------------G-----------KGYDE-YRYSGDYYAAPAAT--------------
A0A542XE74      --------------TDSA--------YSYTG-YTGYYKDYYAAAEP--------------
A0A0Q7QDF6      --------------ARYGYG------YGYDD-----------------------------
A0A5R8L819      --------------GYYGGH------YGREY-YASAEVQAVSAVPA--------------
A0A7K0PFV4      ----------------AALS------PYYDA-APRRRSGAVWRTAR--------------
A0A0G3V3F3      -------------------------------------------VVN--------------
A0A7K0MUQ7      -------------------------------------------VVN--------------
A0A7K0U619      -------------------------------------------VVN--------------
A0A6I3DFP2      -------------------------------------------VVN--------------
A0A7K0SI36      -------------------------------------------VVN--------------
A0A7K0V140      -------------------------------------------VVN--------------
A0A261FQA1      --------------GDYYYS------DKAAK-HSSQGTSEKSHEPT--------------
A0A1Q2CJ92      --------------GEATFG------YGYGS-YTS--KYYRTDEAQ--------------
A0A2T0S3C8      --------------EG----------YYYEQ-YGMTSQHRRGAWRD--------------
A0A4Y8WZJ3      --------------AAS-------------A-YQYYGATYYTASQQ--------------
A0A285VUW0      --------------GSY-------------N-YQYYGRETPVTAGE--------------
A0A2R7Z032      --------------GAIAYG------DGYG--YGGYGA--QAEYAS--------------
A0A6J4MTQ2      --------------SAVAYG------YGYAS-YGSYGA-YKAEQKT--------------
A0A1I0W453      --------------SAIAYG------GGYGG-YGGYGG-YRAEYTS--------------
A0A1H4LCS9      --------------AAIAYG------GGYGG-YGGYGG-YKSEYAS--------------
A0A4Q2RZP8      --------------AAIAYG------GGYGG-YGGYGG-YKAEYAS--------------
A0A0Q6VV12      --------------SAIAYG------GGYSG-YGGYGG-YRAEEAT--------------
A0A495NTA9      --------------TAIAY-------GGYGG-YGGYGG-YKAEEET--------------
A0A0Q9QB08      --------------ASIAYG------GGYGT-YGGYGG-YEADDTS--------------
A0A4Q2SA86      --------------AAIAYG------GG----YGGYGG-YQAEYAS--------------
A0A4Z1C3Z0      --------------AAIAYG------GG----YGGYGG-YQAEYAS--------------
A0A6V8KDX4      --------------DGY---------YAYYG-QQHDGKHRTRQRDA--------------
A0A444BL03      --------------GGVMYG------YGYGG-YASYASDTKTRKDY--------------
A0A4Y8X357      --------------GSDYYG------GGLGS-HEDEYHAYYRAPAE--------------
R4LD52          --------------DAY---------HYYDE-YSTRGRGSRRAGPV--------------
A0A4T2CD79      --------------GGRGYG------YYHGS-YSEDAPVVGALIAN--------------
A0A6L6AM03      --------------AAIAYG------GGYGS-YGGY-GGYKAEYAS--------------
A0A4Q2RU39      --------------NAIVYG---------GG-YGGYGGGYKSEYKS--------------
A0A4Q2SK58      --------------NAIVYG------GGYGG-YGGYGGGYKSEYKS--------------
A0A2N3YJR1      --------------GAVMYG------YGYGG-YATYASDTKSRRDY--------------
A0A6G8FYB9      --------------GGVVYG-------GY-G-YSSYSSDYASRKAY--------------
A0A4Q4D742      --------------DDA---------YGYGY-GHGYGYGSALPQAV--------------
A0A1C6T1J1      ---------------DA---------YQYEA-YRVVAGLGTPSVPA--------------
A0A2W2CFC8      ---------------EA---------YQYEA-YQVL----SSSLPV--------------
A0A2W2A4B0      --------------RDA---------YAVYG-ADVPPETQRSHRSA--------------
A0A4Y9MDA5      ---------------DV---------YGYAA-DAAAEARRPLPAAR--------------
A0A1H7N9P7      ---------------EV---------YGYAA-DVVAGTDRPVPTAP--------------
A0A1M7V0F8      ---------------DV---------YGYAA-EAQPPA-RVGELPA--------------
A0A1M3LEY6      --------------DAYGYGRYGYGAYGYGYGYGRTAQAGFSQIIS--------------
A0A538AJI7      --------------PYYY------------------------------------------
A0A538AM15      --------------SFYGYYGY---------------YGGAPQTAQ--------------
A0A519GXS6      --------------DSYYYT------SDR-------------------------------
A0A520EHH5      --------------GRDQYG------YDFEPGRVPTPPTQSAPVRT--------------
A0A4R0U4F1      --------------QKGGYY------YYGDESDDNGRKRQIQHKKS--------------
A0A1V8PLV6      --------------SANGNY------YYYYDEGGKKSRKKSKHKS---------------
A0A357ZCV8      --------------ESYYAY------YSADGKRVKDRPAADAASQL--------------
A0A4R1CW45      --------------DSYGYG------SANYDSYYSE------------------------
A0A4R5Z7B0      --------------DYYYYY------GAK-------------------------------
A0A542H054      --------------S-YYYY------GKN-------------------------------
A0A6M8GFV5      --------------GYYYYY------GNEN------------------------------
A0A7G8U6J2      --------------NYYYYK------SQSK------------------------------
A0A419GS64      --------------ARPYQY----------------------------------------
A0A2V2CXY5      --------------SNMYYH------RYYRSSYYYNSYGSRSQKQK--------------
A0A2S8MDM2      --------------SSYGYS------YSYYGTETPRHAPP--------------------
A0A357ZDL3      --------------DSYYAY------YTVTGHRVRDKYNEDGAYEF--------------
A0A4Y8ZIU8      --------------GSDYYG------GGYASKGDDYHAYYQAPRDA--------------
A0A1I6GVG4      --------------GAAYYG------YQYHGDYYRSDEQELPSGTV--------------
A0A1I6IST1      --------------GAAYYG------YQYHGDYYRSDEQELPSGTV--------------
A0A412JBM5      --------------K---YS------YRYKYEDKYGGAKDYGYGYG--------------
A0A6J4SUA1      --------------A---YQ------YYSYLDGYEAEDDP--------------------
A0A1C2B334      --------------A---YH------NTYYGD----TDTP--------------------
R7Y679          --------------D---NR------YGYYAQ----ASRE--------------------
A0A0F0KYJ9      --------------GAAYYG------YQYHGDYYRNDGQELPTGTV--------------
A0A7M2YYB9      --------------YGYS------------------------------------------
A0A538BBM6      --------------G-YSYG------YYGYGEPEPNGERPAGE-----------------
A0A7K0LE65      --------------SAYYEA----------------------------------------
A0A510HHA8      --------------GYAYH--------QGYTR----------------------------
A0A6G8Q9J3      --------------GYPL---------AGYASG---------------------------
A0A5Q2F9A3      --------------GYSAYR------NRSGQGPEPRRVARRAAGEE--------------
A0A4R1BMZ2      --------------GYYRYG------YGGYTYK---------------------------
A0A023X491      --------------GT----------YGGYTYSYGEAAGS--------------------
A0A6G8QDQ0      --------------GL----------YSAYSY----------------------------
A0A0K8Q3D9      --------------DAYAY--------HGTYTS---------------------------
A0A2R7RCA1      --------------DAYSY--------YGTYTS---------------------------
A0A1Q7WJN6      ---------------------------GGDYRQYSYYLAGYEVADE--------------
A0A6D1QMN1      --------------NYYYYY------TEGN------------------------------
A0A1E2SNF6      --------------DAVNYG------YYGAKYGYGYYHDASLTAGP--------------
Q6ADE8          --------------DAVNYG------YYGAKYGYGYYHDASLTAGP--------------
A0A1Q7CZ24      --------------SYYDVY-------AGSSRG---------------------------
A0A2W6VLC6      --------------DAYGYG-------YGSYGTYS-------------------------
A0A519G798      --------------KGYGYG-------YGYGYGYG-------------------------
                                                                            

A0A6N6NKS9      --------------------------------------------NPNARDLAADDIGQWA
A0A538BYZ4      ----------------------EADGRLARGAGIARWLQWAKRGGDALRRQRSRRGP---
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      ----------------------LRPAKEVPDAGTAAPASRAPDTGSTAALETESPADAAV
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ----------------------EPRAKQRARG----------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A1Q2CRV2      --------------------------------------------RKSKKRRARAEVAA--
A0A7K0NRJ7      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      -------------------------------------AAADLQEPSVTDNPPTEQIQTPA
A0A3E2DN22      -----------------------------------YSSYGSEEQESRESIAVVQEAQ---
A0A3Q9ULZ9      -----------------------KKKRRKKKMSLEEDYFGAVEPAPLGSHPTQDQPSSEG
A0A3S9JFL2      -----------------------KKKRRKKRMSLEEDYFGRVELAPVNSRPTEDEPT---
A0A7K0NTR2      ------------------------------------------------------------
A0A1H6WL79      --------------------------------------------------PRSGMNPTSQ
A0A101LAM5      --------------------------------------------------PAPSTTTTSA
A0A4Y3NEG0      --------------------------------------------------PVPGTVLSAP
A0A1Q2CI19      -------------------------------------KR-------GGARAVA-------
A0A512T3M3      -------------------------------------VD----H--RAQRGAFDPAADED
W6JTW4          -------------------------------------RSGGHGP--RSAHGTSASRRDRL
A0A0A0JTY0      -------------------------------------RKGARSRQSGPVGP---------
A0A0A0JXF2      -------------------------------------RKLAEKR--GPVAPATPSTSSRP
E6S8H2          -----------------------------------------YGD--KKKGKARKRLPSSA
A0A0A0JGH0      -------------------------------------SPKMELD--PRQQPSAPSVAVPQ
N0E4U7          -------------------------------------SARVEAD--RSLRPTRADAST-Q
A0A0A0IYK2      -------------------------------------RK-RAQS--RSARSAAEQETTFV
A0A0Q9L0H3      -------------------------------------RK-RQQL--RAAEPVA-------
A3TMK0          -------------------------------------RRLADQR--RPAAPVV-------
A0A543PXP1      -------------------------------------KR-GRSI--GGAQGAR-------
A3TMH6          -------------------------------------KGIRRVL--PGRRGTTDG-----
A0A6I2XCV4      ------------------------------------------------------------
A0A5R8VLL6      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A538JQF8      -----------------------PAGGGIRRATKARSAKKAAKKSSARAPAKTGPDTTNA
A0A1H6YPK1      -----------------------PGLSSLGGAPAQHDEDDSWEHDEALRKVFPEDVLHRA
A0A0Q9TBP0      ------------------------------------TGTDAAPDSAPTRAGKDQAGDPVP
A0A0G3V3M7      ------------------------------------------------------------
A0A6I3DD56      ------------------------------------------------------------
A0A5Q2FA83      ---------------------------SKREAVASRHGSLEEAVPVTSAAIPGSPSGTEQ
A0A2R7MGI0      -----------------------GAEGIKRSTRRGARGVAAKSGPAETGPRRRSNAAPDD
A0A2T7WQY4      -----------------------TRKGAKRTRGRDRRPSSVMGAPGATGPRRRSGTASDD
A0A1G6GTN3      -----------------------STKAWWRFRRRGQTTPVAAAEDREAGSRTQPADPPPE
A0A1N7DLV3      -----------------------DRPRWWRRPWRRATVEKKDAGEQAPGPRRRSAELPPS
A0A1V2NSB5      -----------------------ERTRWWRRPWRRQVGDAGDAGASAPGPRRRSAELPPS
A0A0Q5Q5L3      -----------------------EKSTWWRRVLRKSSTEPGAAEEH--GKRRTSADLPAE
A0A0Q6DVM4      -----------------------EKSTWWRRVLRKSSTEPGAAEEH--GKRRTSADLPAE
A0A1R3WWR6      -----------------------TTRSWWRFGRRPRTADSENTTDT--GPRRQSADPPPE
A0A2S5WZJ5      -----------------------PVMKSIKRGHEQPEAFAVQTDASAAQTPQPTFAAVAP
A0A0Q5JKD6      --------------------------NGRWRLGLRRRGKKAEVVDAEQEATPRRRSGGLP
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      --------------------------GRRHTRHQEPAETQEHVPAAS-------------
A0A2N6V1R5      RENQIVSIQEEEVHPLPKDKQSNRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAA
G9PHS6          RENQIVSIQEEEVHPLPKDKQSNRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAA
U1PLM7          RENQIVSIQEEEVHPLPKDKQS-RRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAA
A0A346XTB0      -RR---------------------------------------------------------
A0A6I1G2U1      -KA-----------------------SGRRGRRGARAAGDQPRPRTRREAKERAADGGLS
A0A351ETF8      -DA---------------------------------------------------------
A0A542FTE6      -ED---------------------------------------------------------
A0A349B7N2      -PL---------------------------------------------------------
A0A7J5B4S5      -----------------------PVFKSAKGHVDLLEPQPDTNAPATISLAPRANVAPQN
A0A4Q2JUT1      ------------------------------------------------------------
A0A6L5R0V7      -PE---------------------------------------------------------
A0A2S5UYV0      -----------------------PVFKSSKGHVDLLE---PQPEKNASAAISLAPRPNSQ
A0A2S5X9U6      -----------------------PKFKAVKGHADPSEQFRAQNDAVPAQRESLAP----S
A0A2S5ULV5      -----------------------PKFKAVKGHTDPSEHFGAQPDVAAPQRESLSP----S
A0A653YMF0      -----------------------PKFKAVKGHTDPSEHFGAQPDVVAPQRESLSP----S
A0A3Q9IY80      -RS--------------------KGGEDGFDIDLTEDTAGTMVSAGAPGA----------
A0A0F0LP73      -DA----------------------------AGDDEVAALISEAELSPAAFDGEPPAPEE
A0A346Y185      -DR---------------------------------------------------------
A0A4V1VGV9      -TA--------------------PTPSPEVRDLTLTEGRSSADLPGKEDAARLRQPAPQA
A0A7G8U6P0      -TA--------------------PTPSPEVRDLTLTEGRSSADLPGKEDAARLRQPAPQA
A0A259S8H9      -TAEDGDDAVDAFAAMANLSPAPLGDAAATAEAPRDGGATVEEGTFTTSSGPADIITDGD
A0A2W1Z497      -----------------------AGDDDGSEPAPGTDGG----------AEHGTDGDAEA
A0A0Q5L115      -GA--------------------VGAGAGSGTAPASREAVTAPAPVVAPTPPAAPTPAPV
A0A7G6YY64      -GA--------------------VGAGAGSGTAPASREAVTAPAPVVAPTPPAAPAPAPV
A0A1F1X071      -ES--------------------AVVPDAEEVDVEQAGGPAEPGPASAPA----------
A0A3R8RWC7      -ES--------------------AVVPDSEEVDVEQAGGPAEPGPVSAPAAAVAAPDAPR
A0A4U0RJZ4      -EA--------------------SALTPAHELADITLHAPESSPAAGPQADRGNAGAPFD
A0A4R1FGL9      -EA--------------------SALTPAHELADITLHAPESTPAAGPQVDRGNAGVPLD
E3B8H1          -EA--------------------SALTPAHELADITLHAPESTPAAGPQVDRGNAGVPLD
A0A7D7WDT9      -VT--------------------PK-GKSRGKRKKQASAVSAPAVARASLVPAATRADVV
A0A0Q5AWK6      -TQ--------------------PQQAATENAAVGR------------SARRSPRTQALE
A0A6P1F176      -AE--------------------PDAGRGRGRSNGRRSAGEEPARSLPAVRPSEPARAVE
A0A3N1NLD3      -AE--------------------PDGGRSRGRSAGRRAAAEEPARSLPAVRPAEPARAVE
A0A3N2FVI8      -AE--------------------PDGGRSRGRSTGRRAAAEEPARSLPAVRPAEPARAVE
A0A2S5XDQ6      -AE--------------------PQPATGRKR----------------------------
A0A2S5XNN6      -AE--------------------PQPATGRKR----------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A561E8R3      ------------------------------------------------------------
A0A345NSU7      ----------------------PRKRKRRQGKRDKRMSKSRPHAEAAASARAERAVDGGE
A0A222TG79      ----------------------VRDSAER-------------------------------
A0A0W8I9Y2      ----------------------AQPVVAAPAAKQPWGTAPRAESSDAHQPAGASTRQEPT
A0A7C6LSF9      ----------------------RRSKEREPRPPSLPPAVQPRPTSEPDNDFSADPVDDAG
A0A255G8R8      -----------------------------------------GRQRSSSAATGRRAA----
A0A6G7Y423      ----------------------RRLTYRRGGPSRPSRIRPVGRSNTATAAPSRAAVSVVT
A0A4Q4D4T1      --------------------------------------------GKGRRRR---------
A0A261FE22      ----------------------ASAPATQARPQVQAQAPRSARTAVSGK-----------
A0A5C8C085      ----------------------PKKGKKPAPDSFEPGPGPEPSDQTDNGPDDRPGRRVAS
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      ----------------------RPAFVPR-------------------------------
A0A151BT98      ----------------------RRSDKRG-------------------------------
A0A2Y8ZRF8      ----------------------RRTGKRG-------------------------------
A0A2R9UAT1      ----------------------ITRPVVETQPAATGDPQDQLAPLRRTRRRAG-------
A0A4Q5J5D7      ----------------------ADATEVS---------------SKHRRRTA--------
A0A3S0V9U6      ----------------------SESAGTKK------------------------------
A0A1S2N0P2      ----------------------SGSGSSPAAGGKHGAKGRGRRARTSHSS----------
A0A0Q3BEY5      ----------------------SGSGSSPAAGGKHGAKGRGRRARTSHSS----------
A0A4R6Q3C6      ----------------------SGSGSSPAAGGKHGAKGRGRRARTSHSS----------
A0A2X3GKL3      ----------------------SGSGSSPAAGGKHGAKGRGRRARTSHSS----------
A0A1Y4CKD6      ----------------------VKPVVEPEIVEEEVVPPRGKHFRV--------------
A0A0Q7KBQ4      ----------------------HEPIGEQARRMVGALGRGESRSSSGRRVSR--------
A0A5Q5BFU2      ----------------------LPTETRVEKSSPSSATSAQGDSEVAEPAGTRQTRETD-
A0A439DNZ6      ----------------------MKVMRRLRRYRPAYQSPGTDPASENEN-----------
A0A7I7UD03      ----------------------VAVQESSSSDSVKEVEVEDQDPTTSSSGRRRRRESSD-
A0A7I7MI62      ----------------------LTGPATQDRSSVSDLLVTNVDVAESSGKRRKRADAD--
A0A0J6YE86      ----------------------SAESSKTTSANASESRDRSAGDLPARPVTQRRYKTT--
A0A7I7K1R9      ----------------------D-------RSDPAKINATSDVDRSGASYDKRKSAE---
A0A7I9ZLK4      ----------------------DPTPSPTPQSEKEKISGQNVPRVSGR---RRKRIE---
A0A1F1IHY9      ----------------------QDVAGRS-------------------------------
A0A7H2BCD6      ----------------------PTEGKGL---------------KKLKRASKK-------
A0A542HCT5      ----------------------R-------------------------------------
A0A0Q5M6Z7      ----------------------EAQPVASIEAGGDTSVDGQANEQRSRRASRS-------
A0A7G6YA19      ----------------------EAAPEPVAEDVVPTRRSAQPSRGRSRSDRR--------
A0A2S8WHZ8      ----------------------DPKADAKPSRRLQDPVPVDQPVISSNRFGEIPGLGAHA
A0A537WNY9      ----------------------TSMPRRG---------------RRSSERLASRR-----
A0A5B8M469      ----------------------KRRRDAAKKVTPVPAPHEVASPATAAQARATAAAGRSG
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ----------------------AQQRGRR---------------AGKPKADRPARAK---
A0A433EDP2      ----------------------TKKKVKS---------------RKKAKK----------
A0A231VTW0      ----------------------TKKKVKS---------------RKKAKK----------
A0A433ECD0      ----------------------TKKKVKS---------------RKKAKK----------
U7V3Z1          ----------------------TKKKVKS---------------RKKAKK----------
A0A1F1J417      ----------------------KKKVSSG---------------AHGA------------
A0A2A8D6P2      ----------------------KKKVSSG---------------AHGA------------
A0A1F0THV9      ----------------------KKKVSSG---------------AHGA------------
A0A5F0M6Y0      ----------------------KKKVSSG---------------AHGA------------
E3H5W1          ----------------------KKKVSSG---------------AHGA------------
A0A1F1QKB0      ----------------------KKKVSSG---------------AHGA------------
A0A509JY23      ----------------------KKKVSSG---------------AHGA------------
A0A448USF4      ----------------------KKKVSSG---------------AHGA------------
A0A0Q9LZR0      ----------------------AATR----------------------------------
A0A1N7E3F1      ----------------------PQTPMPV-------------------------------
A0A544ZKQ1      ----------------------PQAPMPV-------------------------------
A0A372P1T1      ----------------------PQAPIPV-------------------------------
A0A5D0Q2X0      ----------------------PQAPIPV-------------------------------
A0A5R8Z2E7      ----------------------PQAPIPV-------------------------------
A0A1L2ZMV4      ----------------------GKRRAAS---------------SSSK------------
A0A6I3F378      ------------------------------------------------------------
A0A1S1CQC5      ----------------------DKKSSKS---------------KSSAPKA---------
A0A1E9T6I0      ----------------------DKKSSKS---------------KSSAPKA---------
A0A1F1GHA7      ----------------------DKKSSKS---------------KSSAPKA---------
A0A1S1CAD0      ----------------------DKKSSKK---------------SSTKK-----------
G5ET14          ----------------------DKKSSKK---------------SSTKK-----------
A0A1E9DXX2      ----------------------DKKSSKK---------------SSAKK-----------
A0A1E8S156      ----------------------DKKSSKK---------------SSTKK-----------
A0A1E8S5S2      ----------------------DKKSSKK---------------SSTKK-----------
A0A1S1DFA8      ----------------------DKKSSKK---------------SSTKK-----------
A0A2I1Z490      ----------------------DKKSSKK---------------SSTKK-----------
A0A1F0DAA9      ----------------------DKKSSKK---------------SSTKK-----------
A0A1F0PHK9      ----------------------DKKSSKK---------------SSTKK-----------
A0A1F0VZG6      ----------------------DKKSSKK---------------SSTKK-----------
A0A1E9G8X4      ----------------------DKKSSKK---------------SSAKK-----------
A0A1E9IAW2      ----------------------DKKSSKK---------------SSAKK-----------
A0A1E9ZBC9      ----------------------DKKSSKK---------------SSAKK-----------
A0A1E9ZDP4      ----------------------DKKSSKK---------------SSAKK-----------
A0A1F0R6B5      ----------------------DKKSSKK---------------SSAKK-----------
A0A1F0Z7N5      ----------------------DKKSSKK---------------SSAKK-----------
A0A1F1D897      ----------------------DKKSSKK---------------SSAKK-----------
D2NP38          ----------------------DKKSSKK---------------SSAKK-----------
A0A1F1FV74      ----------------------DKKSSKK---------------SSAKK-----------
A0A1E9M791      ----------------------DKKSSKK---------------SSAKK-----------
A0A291DEI8      ----------------------DKKSSKK---------------SSAKK-----------
A0A1S1D5T1      ----------------------DKKSSKK---------------SSAKK-----------
A0A1E8TRD6      ----------------------DKKSSKK---------------SSAKK-----------
A0A1F0XT88      ----------------------DKKSSKK---------------SSAKK-----------
A0A1F1EVP5      ----------------------DKKSSKK---------------SSAKK-----------
C6R548          ----------------------DKKSSKK---------------SSAKK-----------
A0A0K2RXS2      ----------------------DKKSSKK---------------SSTKK-----------
A0A1F0KX60      ----------------------DKKSSKK---------------SSTKK-----------
A0A542I3V2      ----------------------ERDRPGT---------------EKDGAEI---------
A0A2T0UZ65      ----------------------KKGRRRA---------------AKKAKDRVGAGRRG--
A0A1R4JTI6      ----------------------TSRNAGSTRE----------------------------
A0A4R7TM52      ----------------------TVPLDSP---------------GAAASPSVTEGEPRVL
A0A542XE74      ----------------------EQQSPERSRADDVEDAEPTSSRAARKRRRSKNTVG---
A0A0Q7QDF6      --------------------------------------------GKGRRRR---------
A0A5R8L819      ----------------------VTPAAGD-----------NPADGQGLRRRSRRSA----
A0A7K0PFV4      ----------------------RIVQGSG-------------------------------
A0A0G3V3F3      ----------------------RSAYYEA-------------------------------
A0A7K0MUQ7      ----------------------RSAYYEA-------------------------------
A0A7K0U619      ----------------------RSAYYEA-------------------------------
A0A6I3DFP2      ----------------------RSAYYEA-------------------------------
A0A7K0SI36      ----------------------RSAYYEA-------------------------------
A0A7K0V140      ----------------------RSAYYEA-------------------------------
A0A261FQA1      ----------------------EKAEQ---------------------------------
A0A1Q2CJ92      ----------------------KPHRRER---------------ARRVTKLVETDDQAAE
A0A2T0S3C8      ----------------------RMRAPAT---------------TELRDLMACGEPESAP
A0A4Y8WZJ3      ----------------------QDVAGRS-------------------------------
A0A285VUW0      ----------------------TRGSRRQ---------------SGGARRLARRKGARAA
A0A2R7Z032      ----------------------REAYSTA---------------GKGKRRSK--------
A0A6J4MTQ2      ----------------------AEAYASASTASTASTASTGGKLGKGRRVRAGK------
A0A1I0W453      ----------------------REAYSTA---------------GKGRRRKEAKAKAAKV
A0A1H4LCS9      ----------------------REAYSTA---------------GKGRRKLLKVGKKD--
A0A4Q2RZP8      ----------------------REAYSTA---------------GKGRRKLTKLGRKS--
A0A0Q6VV12      ----------------------REAYSTA---------------GKGRRRKLVRSSSDKA
A0A495NTA9      ----------------------REKYSTA---------------GKG-RRKLVKSLKG--
A0A0Q9QB08      ----------------------READATA---------------GGGRRRKHPKKAAKNA
A0A4Q2SA86      ----------------------QEADATA---------------GKGWRKKADKGDKAAD
A0A4Z1C3Z0      ----------------------LEAESSA---------------GKGWRKKADKADKPDK
A0A6V8KDX4      ----------------------ADLVRAA-------------------------------
A0A444BL03      ----------------------AKAASRG---------------KHAE------------
A0A4Y8X357      ----------------------SRKAEAP---------------LDGAGTDAAAEARGST
R4LD52          ----------------------APVRVAV---------------GRLPELMGAGRPGKER
A0A4T2CD79      ----------------------GRLTPTI---------------PVTAAESADSTARAES
A0A6L6AM03      ----------------------REAYSTA---------------GKGRRRKQAKSEAKAE
A0A4Q2RU39      ----------------------VEVYSTA---------------GKGRRRKPAKAEKAEK
A0A4Q2SK58      ----------------------REAYSTA---------------GKGRRRREAKVDKADT
A0A2N3YJR1      ----------------------EKAS----------------------------------
A0A6G8FYB9      ----------------------DTAPVAE---------------SDVVEPVVPAGPGVPV
A0A4Q4D742      ----------------------RPEQPEK---------------SGDEASTLSRS-----
A0A1C6T1J1      ----------------------DRATSGR---------------HAEHAAAGVS-DRTQE
A0A2W2CFC8      ----------------------DRATAGR---------------HAEQTAADEPVDNAEE
A0A2W2A4B0      ----------------------VPGSTSE---------------VTP-------------
A0A4Y9MDA5      ----------------------VPAPAAE---------------PVGPVGVGARKK----
A0A1H7N9P7      ----------------------APLPAAR---------------SAEAADRPASRR----
A0A1M7V0F8      ----------------------VPVPAGR---------------IGQL------------
A0A1M3LEY6      ----------------------PAESPGRRQSSAVPPSGPARTTAQARQESV--------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ----------------------TSPNGHDRGRLGRTVARVGHMLQRRRRGGR--------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      ------------------------------------------------------------
A0A4R0U4F1      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A4Y8ZIU8      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A6J4SUA1      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      ------------------------------------------------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
A0A519G798      ------------------------------------------------------------
                                                                            

A0A6N6NKS9      RKAGIDPKQAERRESGERPRRQGSGAGVGAGASPNANAGAGMPPAASPQRATRASADEQF
A0A538BYZ4      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A2N4T4Q5      SDLPADESERFDLAAWQRPGKGTHRA----------------------------------
A0A4Q5APW3      ------------------------------------------------------------
A0A4Q5B0V3      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A4Q5A868      ------------------------------------------------------------
A0A6N4VXX3      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A4R7A6D9      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A7K0NRJ7      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
A0A1L2ZMQ6      SVAS---------------------------------RSRHNEGTRGTSSQSMTVTKPAP
A0A3E2DN22      ----------------------------------------PAEGLVRVPKKDRADTDTEI
A0A3Q9ULZ9      EQED-----------------------------ATSGGSQPSRAVRTNGSDT-DQIPAGL
A0A3S9JFL2      ----------------------------------------PSRVTSSSASRSQENRPADL
A0A7K0NTR2      -----------------------------------VPKMSRLFPWRKPTRGEGTVRRQPD
A0A1H6WL79      PGHAGVSVDGNGFEAHSPWQGPAKAAEITSQAMLSGLGHAIAGPSNSLTNSSDTPSFLAP
A0A101LAM5      SRRS-----------------------------------PDADAVNPVPDIREASPFLGS
A0A4Y3NEG0      AGAL-----------------------------------AD-NPATPLPEPREASTFLAP
A0A1Q2CI19      -------------------------------------------DEKPEASLV-------E
A0A512T3M3      GQSSDIDT--------HG-------------------------SSGPRSAA--------V
W6JTW4          GRAEAPSTIRGGGEARHD-------------------------AAGPRPAV--------V
A0A0A0JTY0      -----------------------------------------------PTGHMGDFF---D
A0A0A0JXF2      TTGPAEETRSRDAV-----------------------------GTADPTTTVDPVLGVDD
E6S8H2          VQGPPELSE----------------------------------ERVPESRS--------A
A0A0A0JGH0      HASAPEVDR----------------------------------WSLPPRVD--------D
N0E4U7          FAGSEDGAR----------------------------------PFSPQADG--------A
A0A0A0IYK2      DSRTPGASPVHSAESRDTSRNPEDAPDDLQLDVTPGGEVPTATDEAHAATR--------G
A0A0Q9L0H3      -------------------------------------------DELHPPTT--------G
A3TMK0          -------------------------------------------TESEPDDF--------L
A0A543PXP1      -------------------------------------------AKRPAHDV--------D
A3TMH6          -------------------------------------------SSTPPHPA--------E
A0A6I2XCV4      ------------------------------------------GQPAQTGQPAQLGQRVRP
A0A5R8VLL6      --------------------------------KAAARDKTASPDKAARPQPANSRETRSP
A0A3L7ADK2      ------------------------------------ATAQPSDESTVVEGDSATPIAAAT
A0A538JQF8      SADE--------------------------------PVVHEAPAAGPGSRVSDGKPRLRW
A0A1H6YPK1      DDVPVLAERDDELVFGQAPEGAEKGPGGHESIDETHSEERPPGEISFGHSVDAVEVAVSG
A0A0Q9TBP0      SAGT--------------------------------------PPPSGDTHHGSAPTGHRD
A0A0G3V3M7      -----------------------------------VPKMSRLFPWRKPTNGAGTVRRKPD
A0A6I3DD56      -----------------------------------VPKMSRLFPWRKPTNGAGTVRRKPD
A0A5Q2FA83      DEET----------VRAARTALSSLFTEDPDDTQFSMPAITSEPVTQGTPLAAPAPASSP
A0A2R7MGI0      ARAL-------------------------------------------HAGE---------
A0A2T7WQY4      ARVG-------------------------------------------ASGE---------
A0A1G6GTN3      NVSG---------------------------LRTLAPVTTPAVPGGEVTDEITVPATSGE
A0A1N7DLV3      NVRG---------------------------LRTLAPGRKGSPVPGDSGGE-GVVPVAAP
A0A1V2NSB5      NVSG---------------------------LRTLSARRNPVAASGDFTGE-GAVAVAPP
A0A0Q5Q5L3      NVSA---------------------------LRPLSHRRTKDRDAGEATSEVEVVRTSEP
A0A0Q6DVM4      NVSA---------------------------LRPLSHRRTKDRDAGEATSEVEVVRTSEP
A0A1R3WWR6      NVRG---------------------------LRTLSHGRTSASNQDDSSGE-NVASVTTA
A0A2S5WZJ5      AAAP----------------------------ARESLAPTRPSASSAPRATPAASQPTPP
A0A0Q5JKD6      PENV---------------------------SGLRTLSQRRMSATAEGEATSEIAVASTA
A0A2W6DK08      ------------------------------DARFAAVISANDRAHSDRHWRRAEMSELIW
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      SPRVSTVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQT
G9PHS6          SPRVSTVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQT
U1PLM7          SPRVSTVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQT
A0A346XTB0      -----------------------------------------------LLPGSRRRNGGNE
A0A6I1G2U1      SADL--------------------------------SSGSAEDAFDPYEGYDVRRDLATT
A0A351ETF8      ------------------------------------------------------------
A0A542FTE6      -------------------------DAPPPQAPPIANTTNLRPEDLPRRTRRNPPTIAPS
A0A349B7N2      ----------------------------------------PPPTDGQEQRGIESDELDAL
A0A7J5B4S5      AGKK------------------------------------AQPQAAPQQTAVAEPPLSNA
A0A4Q2JUT1      -------------------------------------EASPETGKPDSKRRGRKR-AAKD
A0A6L5R0V7      -------------------------------------EGAGETPKATPKRRGHKRNAAKD
A0A2S5UYV0      SSEQ-----------------------------------PPQAVVAQQQAPASETPSDLS
A0A2S5X9U6      QPAQ-----------------------------------VRSAPVVPAQLETQSAEP---
A0A2S5ULV5      RPAQ-----------------------------------PAAEQAAPSQPQAGPVPSSAP
A0A653YMF0      RPSQ-----------------------------------PATGQAVPEQAQAAPVQASAP
A0A3Q9IY80      -------------------------------ASTPSPSSATRPASGVTGSPAATGTATPT
A0A0F0LP73      SGAE----------------------DEGASRERRASRSRTVSDDAASSRATHARPRIAQ
A0A346Y185      ------------------------------------------------------------
A0A4V1VGV9      PTPP---------------------------EPATAVRAPSAPSRAGASEASGPNVAPHG
A0A7G8U6P0      PTPP---------------------------EPATAVRAPSAPSRAGASEASGPNVAPHG
A0A259S8H9      AADA-------GEEASPAIVRPHGSNGRAAAARARRSVPPVEVAEPVGE----RVDGEDE
A0A2W1Z497      RAAR-------GARPSGGSRLTPSLPDRDASVPRSPVVSPYDPSLELPSRRSRRRAAAVG
A0A0Q5L115      PAPA-------GAAAAAAAAAAPGGEPAPARVPASPASPAAPTSPAVPA----SPVEAPG
A0A7G6YY64      PAPA-------GAAAAAAAAAAPGVAPAPARVPASPASPAAPTSPAVPA----SPVEAPG
A0A1F1X071      -------------------------------------EPGPVVEP------------DGH
A0A3R8RWC7      PADT--------------------EAPRRAAQASPRPEAQPVAHPARAADESAPVEHDEN
A0A4U0RJZ4      TTRH---------------------------DPMRGASSEAPSASANVECAPREATPATS
A0A4R1FGL9      TTRH---------------------------DPMRGESSQAPSASANVERAPRQATPATS
E3B8H1          TTRH---------------------------DPMRGESSQAPSASANVERAPRQATPATS
A0A7D7WDT9      AGPR------------------------RTVHDSPSTTNTVSPTPEPAGSSQPDVRDATP
A0A0Q5AWK6      P-------------------------------------------------------VE--
A0A6P1F176      PERI----------------------------AEPERAVGPARTVEPARSTEHVVRAA--
A0A3N1NLD3      PERT------------------------RAAEPERTRVAEPERAVEPARSLEHVVRAA--
A0A3N2FVI8      PERTRAAEPERAAEPERAAEPERAAEPERAAEPERTRVTEPERAAEPARSLEHVVRAA--
A0A2S5XDQ6      ----------------------------AAAAPRRSELAPVESRALP-------------
A0A2S5XNN6      ----------------------------AAAAPRRSELAPVESRALP-------------
A0A3L8NYD3      ---------------------DRSNGNTLRARFLYRRMRRREEREQAQREQTLRERTAAR
A0A1M6K628      ---------------------RPAAEVS-------------GARQGRGRSQSTPRPRRVA
A0A561E8R3      ---------------------PTPAQPS-------------PPATPAAPTATMGTQPATA
A0A345NSU7      ALEFRSRARQRLDRRNGSG-----------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A0W8I9Y2      VPSAEDAAPAPRAERSNGQGSAEHESFGLEAWGRSGSSTGSTAQGH--------------
A0A7C6LSF9      KVGVVGGAGSVEEFDPYAGYDLDRDGLASSTPSEPPIESRRHRRRSSG------------
A0A255G8R8      -------PSGQRPDDLVL------------------------TPRQARE-----------
A0A6G7Y423      AAARSTQPATPAPEGTSAARAAAITPAPTRTASRRAAGAPPPSPRRPRQYHSRTAVR---
A0A4Q4D4T1      ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A5C8C085      WSN---------------------------------------------------------
A0A4Y5YMQ6      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A4Q5J5D7      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A4R6Q3C6      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A5Q5BFU2      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A7I7UD03      ------------------------------------------------------------
A0A7I7MI62      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A7I7K1R9      ------------------------------------------------------------
A0A7I9ZLK4      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A7H2BCD6      ------------------------------------------------------------
A0A542HCT5      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A7G6YA19      ------------------------------------------------------------
A0A2S8WHZ8      GSSEPEFRRLRRRR----------------------------------------------
A0A537WNY9      ------------------------------------------------------------
A0A5B8M469      MPQARLVEPQMPAPVAPAPAAPTPVTSPSAGPVEPKPVDSQQESPWPFTELDLPDPSLSD
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A5F0M6Y0      ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A509JY23      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A544ZKQ1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A5D0Q2X0      ------------------------------------------------------------
A0A5R8Z2E7      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A6I3F378      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A542I3V2      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A4R7TM52      ADQPSRRSRRTSALSQD-------------------------------------------
A0A542XE74      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A5R8L819      ------------------------------------------------------------
A0A7K0PFV4      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A7K0MUQ7      ------------------------------------------------------------
A0A7K0U619      ------------------------------------------------------------
A0A6I3DFP2      ------------------------------------------------------------
A0A7K0SI36      ------------------------------------------------------------
A0A7K0V140      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      LAEPRRPVA---------------------------------------------------
A0A2T0S3C8      ERRLDEPIGSGR------------------------------------------------
A0A4Y8WZJ3      ------------------------------------------------------------
A0A285VUW0      RR----------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A6J4MTQ2      ------------------------------------------------------------
A0A1I0W453      DKVEKVDTAEKPSASEKAGTS---------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A4Q2RZP8      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A495NTA9      ------------------------------------------------------------
A0A0Q9QB08      AKKDAE-------AEAQTEADAGV------------------------------------
A0A4Q2SA86      AEQAE--------AAAEAEKAARS------------------------------------
A0A4Z1C3Z0      ADKPDKPAQAEQAEAGEAEKATRS------------------------------------
A0A6V8KDX4      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A4Y8X357      VAEERRG-----------------------------------------------------
R4LD52          SKVGSAS-----------------------------------------------------
A0A4T2CD79      TELKDPTAAL--------------------------------------------------
A0A6L6AM03      AKAQSKAGSKTEATAAKNADAPEKAAKS--------------------------------
A0A4Q2RU39      AEKSEKAGKS--------------------------------------------------
A0A4Q2SK58      PVTPDKPARPVKAGRTSKR-----------------------------------------
A0A2N3YJR1      -----------RGRHGTD------------------------------------------
A0A6G8FYB9      PVAKPASKVRRTAARKAD------------------------------------------
A0A4Q4D742      ------------------------------------------------------------
A0A1C6T1J1      LTRLPR------------------------------------------------------
A0A2W2CFC8      LTRLSR------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A4Y9MDA5      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A538AJI7      ------------------------------------------------------------
A0A538AM15      ------------------------------------------------------------
A0A519GXS6      ------------------------------------------------------------
A0A520EHH5      --------------------------------NRH-------------------------
A0A4R0U4F1      --------------------------------EKMKKD----------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A4R1CW45      ------------------------------------------------------------
A0A4R5Z7B0      ------------------------------------------------------------
A0A542H054      ------------------------------------------------------------
A0A6M8GFV5      ------------------------------------------------------------
A0A7G8U6J2      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A357ZDL3      --------------------------------LGGEQESVKVEGLSAAVALDTAAPDPAA
A0A4Y8ZIU8      --------------------------------ESRSAGETTPEAGAGR------------
A0A1I6GVG4      --------------------------------RGDS--------PRRRGESEAA------
A0A1I6IST1      --------------------------------RGDSLAPTRPRMPRRASKTRVGS-----
A0A412JBM5      --------------------------------YGYGNSGHRRQARGRSGQS---------
A0A6J4SUA1      ---------------------------------ALPEAQRSRLTAGPVGTR---------
A0A1C2B334      ---------------------------------RMASQRSRSHDIAQVGLRR--------
R7Y679          ---------------------------------GVTA-----------------------
A0A0F0KYJ9      --------------------------------RGDNANIYAKSK----------------
A0A7M2YYB9      ------------------------------------------------------------
A0A538BBM6      ------------------------------------------------------------
A0A7K0LE65      ------------------------------------------------------------
A0A510HHA8      ------------------------------------------------------------
A0A6G8Q9J3      ------------------------------------------------------------
A0A5Q2F9A3      --------------------------------PADRQRVIA-------------------
A0A4R1BMZ2      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A6G8QDQ0      ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------AVAPSVLGEDADLLQRDSDASGS-
A0A2R7RCA1      ------------------------------------APTSA----PGPVAEAEPDLTGPF
A0A1Q7WJN6      --------------------------------DELREPAQSLLRDPQ-------------
A0A6D1QMN1      ------------------------------------------------------------
A0A1E2SNF6      --------------------------------EAAPAPAATPVPTPAEPDAADRDATDPH
Q6ADE8          --------------------------------EAAPAPAATPVPTPAEPDAADRDATDPH
A0A1Q7CZ24      ---------------------------------ARGRGAWSRA-----------------
A0A2W6VLC6      --------------------------------ASVPDTGWSVSHAAAEASAGVAGAARTE
A0A519G798      --------------------------------PDKPRN----------------------
                                                                            

A0A6N6NKS9      PRGAFKPAVPRRADGRAPRHKNTRI
A0A538BYZ4      -------------------------
A0A348NU28      -------------------------
A0A2N4T4Q5      -------------------------
A0A4Q5APW3      -------------------------
A0A4Q5B0V3      -------------------------
A0A022KX11      -------------------------
A0A4Q5A868      -------------------------
A0A6N4VXX3      -------------------------
A0A1H4I042      -------------------------
A0A4R7A6D9      -------------------------
A0A1Q2CRV2      -------------------------
A0A7K0NRJ7      -------------------------
K6WHS4          --DMSVDKVGTSSAS----------
A0A1L2ZMQ6      DNFDEIVFRGTRAKRSDES------
A0A3E2DN22      TP--------RRAK-----------
A0A3Q9ULZ9      RPVGPQPKPARRAR-----------
A0A3S9JFL2      TPVGPRPRPARRAR-----------
A0A7K0NTR2      SKQVGVGASIQGESSSSEAFDDTSA
A0A1H6WL79      ESQWRSPSDG-RGRRSAPPS-----
A0A101LAM5      VSTWRAPQDGSRGRRSAPPS-----
A0A4Y3NEG0      DSPWRAPQDGSRGRRSAPPRQV---
A0A1Q2CI19      PAEDVQAQRSK--------------
A0A512T3M3      PGSGARSPRANRATG----------
W6JTW4          EASPDDSV-SDRSGG----------
A0A0A0JTY0      DAEQPESRRSRRTSSSA--------
A0A0A0JXF2      DDVEPDSRRTRRRASSL--------
E6S8H2          RREASRKRSSRRTSSSA--------
A0A0A0JGH0      PQDAAPSRRSRHSSH----------
N0E4U7          PDDAALSRRARRTSSSA--------
A0A0A0IYK2      EVGEERRRSRRRSSSSA--------
A0A0Q9L0H3      DERPRESRHDRRTSSSL--------
A3TMK0          DDASRESRRTRRASSA---------
A0A543PXP1      SKSDPDSRQTRRTSSSSL-------
A3TMH6          SEPGAESRRDRRTTSA---------
A0A6I2XCV4      TPVAPMDAPQTPTSTNGSAEGDAQS
A0A5R8VLL6      VSEVGRDKFSKSSTSF---------
A0A3L7ADK2      PLAAPEEATSRRTVRRSGH------
A0A538JQF8      SWSAGAEDFLGREGPA---------
A0A1H6YPK1      RSAVRDTMHLRRLFRT---------
A0A0Q9TBP0      TPPVAPAGHGDSRKTAVAEPGDDVA
A0A0G3V3M7      PEQVGVSASNQGANSSSEAFDDPSF
A0A6I3DD56      PEQVGASASNQGAPASTEAFDDTSA
A0A5Q2FA83      DETIDAPSPALSRGRRFAE------
A0A2R7MGI0      ----------VFRDLG---------
A0A2T7WQY4      ----------VRRSRG---------
A0A1G6GTN3      TAAGTLPR--RRTRRG---------
A0A1N7DLV3      AADVPDDRTSRRRQRG---------
A0A1V2NSB5      AAVVADERTPRRRRRG---------
A0A0Q5Q5L3      PVDAGAPR--RRRTTP---------
A0A0Q6DVM4      PVDAGAPR--RRRTTP---------
A0A1R3WWR6      PSPVGRRR--QR-------------
A0A2S5WZJ5      PQTPGSELPSRRSRRGA--------
A0A0Q5JKD6      EPDTVDTMSRRRARRG---------
A0A2W6DK08      HPSTPAPNGFLPERRP---------
A0A2S0LQ32      -------------------------
A0A2N6V1R5      SAAFGAPQASVPTRRSLRERRNG--
G9PHS6          SAAFGAPQASVPTRRSLRERRNG--
U1PLM7          SAAFGAPQASVPTRRSLRERRNG--
A0A346XTB0      GTRGSHRDADRDADRDADPDGEGA-
A0A6I1G2U1      DDSGDPPVLGQTRRQRRASSG----
A0A351ETF8      -------------------------
A0A542FTE6      DEMNDAPAERSHLA-----------
A0A349B7N2      DAEGELPEVHPADR-----------
A0A7J5B4S5      APSDSENAPTRRSRRGA--------
A0A4Q2JUT1      AELVTEPPANERGSRD---------
A0A6L5R0V7      AELVTEPPADERGARD---------
A0A2S5UYV0      STPEVQGAPTRRSRRGA--------
A0A2S5X9U6      ---VSEQPQSRRSRRGA--------
A0A2S5ULV5      TAVATEQPQSRRSRRGA--------
A0A653YMF0      TAVATEQPQSRRSRRGA--------
A0A3Q9IY80      VVATDSTRRSRRSKR----------
A0A0F0LP73      TGQRSTPVRARRAKDANDLDPDATA
A0A346Y185      --RPQKEVKPRRRPGGRHREKATTK
A0A4V1VGV9      RQSGEAPSPQGPRTRRARRRADLGE
A0A7G8U6P0      RQSGEAPSPQGPRTRRARRRADLGE
A0A259S8H9      AHDAAKPRYARRNARP---------
A0A2W1Z497      GTDDTRP------------------
A0A0Q5L115      GALTRREIRERERTR----------
A0A7G6YY64      GALTRREIRERERTR----------
A0A1F1X071      EPEGDSAAAARTSPRGRRAASTWGR
A0A3R8RWC7      EPEGDSAPAARTSPRGRRAASTWGR
A0A4U0RJZ4      GSDGAPPSRRSRRFRANDDA-----
A0A4R1FGL9      DSDGAPPSRRARRFRANDDA-----
E3B8H1          DSDGAPPSRRARRFRANDDA-----
A0A7D7WDT9      PTQSELPQLRRRSSTRA--------
A0A0Q5AWK6      -SRAERPTASRRTLR----------
A0A6P1F176      -PKADVPASFRRPAR----------
A0A3N1NLD3      -PKAEVPSSFRRPAR----------
A0A3N2FVI8      -PKAEVPSSFRRPAR----------
A0A2S5XDQ6      ------PQTSRRAAR----------
A0A2S5XNN6      ------PQTSRRAAR----------
A0A3L8NYD3      ENEHGQPPVELTSIAGKRRSS----
A0A1M6K628      ADDQRVEVVDASADAVVMEPASTQL
A0A561E8R3      GDNITDQELGLSRRDRRSKQGK---
A0A345NSU7      -------------------------
A0A222TG79      -------------------------
A0A0W8I9Y2      -------------------------
A0A7C6LSF9      -------------------------
A0A255G8R8      -------------------------
A0A6G7Y423      -------------------------
A0A4Q4D4T1      -------------------------
A0A261FE22      -------------------------
A0A5C8C085      -------------------------
A0A4Y5YMQ6      -------------------------
A0A1E4BP96      -------------------------
A0A151BT98      -------------------------
A0A2Y8ZRF8      -------------------------
A0A2R9UAT1      -------------------------
A0A4Q5J5D7      -------------------------
A0A3S0V9U6      -------------------------
A0A1S2N0P2      -------------------------
A0A0Q3BEY5      -------------------------
A0A4R6Q3C6      -------------------------
A0A2X3GKL3      -------------------------
A0A1Y4CKD6      -------------------------
A0A0Q7KBQ4      -------------------------
A0A5Q5BFU2      -------------------------
A0A439DNZ6      -------------------------
A0A7I7UD03      -------------------------
A0A7I7MI62      -------------------------
A0A0J6YE86      -------------------------
A0A7I7K1R9      -------------------------
A0A7I9ZLK4      -------------------------
A0A1F1IHY9      -------------------------
A0A7H2BCD6      -------------------------
A0A542HCT5      -------------------------
A0A0Q5M6Z7      -------------------------
A0A7G6YA19      -------------------------
A0A2S8WHZ8      -------------------------
A0A537WNY9      -------------------------
A0A5B8M469      QASDPSQLTSRRSGRRASGLPRGDQ
A0A1Y4CTD2      -------------------------
A0A3N3ZPU0      -------------------------
A0A359IQX7      -------------------------
A0A433EDP2      -------------------------
A0A231VTW0      -------------------------
A0A433ECD0      -------------------------
U7V3Z1          -------------------------
A0A1F1J417      -------------------------
A0A2A8D6P2      -------------------------
A0A1F0THV9      -------------------------
A0A5F0M6Y0      -------------------------
E3H5W1          -------------------------
A0A1F1QKB0      -------------------------
A0A509JY23      -------------------------
A0A448USF4      -------------------------
A0A0Q9LZR0      -------------------------
A0A1N7E3F1      -------------------------
A0A544ZKQ1      -------------------------
A0A372P1T1      -------------------------
A0A5D0Q2X0      -------------------------
A0A5R8Z2E7      -------------------------
A0A1L2ZMV4      -------------------------
A0A6I3F378      -------------------------
A0A1S1CQC5      -------------------------
A0A1E9T6I0      -------------------------
A0A1F1GHA7      -------------------------
A0A1S1CAD0      -------------------------
G5ET14          -------------------------
A0A1E9DXX2      -------------------------
A0A1E8S156      -------------------------
A0A1E8S5S2      -------------------------
A0A1S1DFA8      -------------------------
A0A2I1Z490      -------------------------
A0A1F0DAA9      -------------------------
A0A1F0PHK9      -------------------------
A0A1F0VZG6      -------------------------
A0A1E9G8X4      -------------------------
A0A1E9IAW2      -------------------------
A0A1E9ZBC9      -------------------------
A0A1E9ZDP4      -------------------------
A0A1F0R6B5      -------------------------
A0A1F0Z7N5      -------------------------
A0A1F1D897      -------------------------
D2NP38          -------------------------
A0A1F1FV74      -------------------------
A0A1E9M791      -------------------------
A0A291DEI8      -------------------------
A0A1S1D5T1      -------------------------
A0A1E8TRD6      -------------------------
A0A1F0XT88      -------------------------
A0A1F1EVP5      -------------------------
C6R548          -------------------------
A0A0K2RXS2      -------------------------
A0A1F0KX60      -------------------------
A0A542I3V2      -------------------------
A0A2T0UZ65      -------------------------
A0A1R4JTI6      -------------------------
A0A4R7TM52      -------------------------
A0A542XE74      -------------------------
A0A0Q7QDF6      -------------------------
A0A5R8L819      -------------------------
A0A7K0PFV4      -------------------------
A0A0G3V3F3      -------------------------
A0A7K0MUQ7      -------------------------
A0A7K0U619      -------------------------
A0A6I3DFP2      -------------------------
A0A7K0SI36      -------------------------
A0A7K0V140      -------------------------
A0A261FQA1      -------------------------
A0A1Q2CJ92      -------------------------
A0A2T0S3C8      -------------------------
A0A4Y8WZJ3      -------------------------
A0A285VUW0      -------------------------
A0A2R7Z032      -------------------------
A0A6J4MTQ2      -------------------------
A0A1I0W453      -------------------------
A0A1H4LCS9      -------------------------
A0A4Q2RZP8      -------------------------
A0A0Q6VV12      -------------------------
A0A495NTA9      -------------------------
A0A0Q9QB08      -------------------------
A0A4Q2SA86      -------------------------
A0A4Z1C3Z0      -------------------------
A0A6V8KDX4      -------------------------
A0A444BL03      -------------------------
A0A4Y8X357      -------------------------
R4LD52          -------------------------
A0A4T2CD79      -------------------------
A0A6L6AM03      -------------------------
A0A4Q2RU39      -------------------------
A0A4Q2SK58      -------------------------
A0A2N3YJR1      -------------------------
A0A6G8FYB9      -------------------------
A0A4Q4D742      -------------------------
A0A1C6T1J1      -------------------------
A0A2W2CFC8      -------------------------
A0A2W2A4B0      -------------------------
A0A4Y9MDA5      -------------------------
A0A1H7N9P7      -------------------------
A0A1M7V0F8      -------------------------
A0A1M3LEY6      -------------------------
A0A538AJI7      -------------------------
A0A538AM15      -------------------------
A0A519GXS6      -------------------------
A0A520EHH5      -------------------------
A0A4R0U4F1      -------------------------
A0A1V8PLV6      -------------------------
A0A357ZCV8      -------------------------
A0A4R1CW45      -------------------------
A0A4R5Z7B0      -------------------------
A0A542H054      -------------------------
A0A6M8GFV5      -------------------------
A0A7G8U6J2      -------------------------
A0A419GS64      -------------------------
A0A2V2CXY5      -------------------------
A0A2S8MDM2      -------------------------
A0A357ZDL3      DYVSLAGKGGKKKSKKSRRA-----
A0A4Y8ZIU8      -------------------------
A0A1I6GVG4      -------------------------
A0A1I6IST1      -------------------------
A0A412JBM5      -------------------------
A0A6J4SUA1      -------------------------
A0A1C2B334      -------------------------
R7Y679          -------------------------
A0A0F0KYJ9      -------------------------
A0A7M2YYB9      -------------------------
A0A538BBM6      -------------------------
A0A7K0LE65      -------------------------
A0A510HHA8      -------------------------
A0A6G8Q9J3      -------------------------
A0A5Q2F9A3      -------------------------
A0A4R1BMZ2      -------------------------
A0A023X491      -------------------------
A0A6G8QDQ0      -------------------------
A0A0K8Q3D9      WVGENYEVDHAMIEEYVPPRRRVKS
A0A2R7RCA1      WEGPGESVQ---VPESVSAGRRARG
A0A1Q7WJN6      -------------------------
A0A6D1QMN1      -------------------------
A0A1E2SNF6      STSGSVPEPVPAEPANRGRRAARHG
Q6ADE8          STSGSVPEPVPAEPANRGRRAARHG
A0A1Q7CZ24      -------------------------
A0A2W6VLC6      STAGREGTPHREAPFS---------
A0A519G798      -------------------------
                                         

© 1998-2021Legal notice