BYKdb

Annotate results for A0A1F6QKE9

A0A1F6QKE9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F6QKE9
DOMAINtad1/146MNFYEAIRIHLRLGLLIVFLVPTVSWIIALNITPIYESRARLLIEAKDLGLDSNESSAPF
RSISRLSDPIQTQIEILRSSTILEKVIRQFNLRYRRGPQKGQYLSYLSLSQNLSVSADRN
VDVVELKYKDPDPKKAKDILRAITDS
DOMAINcd511/699TSSTKNEGKSTISVNLAITYAQSGKRVLLLDADIRNPSLYKYLARPKDAVGISNTLINEI
DFYDVVQKSILGIIGFDYLPGGDIPPNPVQLLESDKMRELLETCQHIYDLVIIDTPPIGY
FSDALLLARHADVVALVSRYNQTSRKELSASVSLLKKTNVTALGVILNGIPVGAQGAYGY
YGYGHESER
SITEWalker A518/520GKS
SITEWalker A'538/545LLLDADIR
SITEWalker B621/627VIIDTPP
SITE-550/-552YKY
SITEY Cluster688/693YGYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNFYEAIRIHLRLGLLIVFLVPTVSWIIALNITPIYESRARLLIEAKDLGLDSNESSAPFRSISRLSDPIQTQIEILRSS
MNFYEAIRIHLRLGLLIVFLVPTVSWIIALNITPIYESRARLLIEAKDLGLDSNESSAPFRSISRLSDPIQTQIEILRSS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TILEKVIRQFNLRYRRGPQKGQYLSYLSLSQNLSVSADRNVDVVELKYKDPDPKKAKDILRAITDSYIEKTIELKASDTA
TILEKVIRQFNLRYRRGPQKGQYLSYLSLSQNLSVSADRNVDVVELKYKDPDPKKAKDILRAITDS              

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAIRFLKKERNKAEREALEASKRLREFEQRSKTAGRDFNSELIKSSYGLKSLRLSIDTEYVKAKTAAEQVSKQLMSNIDD


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALLENTINQDPFLAALKKDLFERQTQLVKIQTKVKPGHYQLEEIKQQIQGDNKLIAERVKELIGHDVNPNTIPYSQDPLR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGLIKNLLETKTAELAIEQELMVVDEAIAELQKKIDKLPNEKYIYNQLLRQNEIAEKRLQEIEVKLIESRMKGVIASHIT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NIRLIDPPSFAARPKWPNISSTLMTSFIFGLLLAGLVIYLVEYFDDVIKSVDTLPKDLGCPFLGQLPYIHVSDLPTVYQE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRSEYTEAIHALRTNLSFLSLAGNKKLLLVTSSTKNEGKSTISVNLAITYAQSGKRVLLLDADIRNPSLYKYLARPKDAV
                              TSSTKNEGKSTISVNLAITYAQSGKRVLLLDADIRNPSLYKYLARPKDAV
                                     GKS                 LLLDADIR               
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GISNTLINEIDFYDVVQKSILGIIGFDYLPGGDIPPNPVQLLESDKMRELLETCQHIYDLVIIDTPPIGYFSDALLLARH
GISNTLINEIDFYDVVQKSILGIIGFDYLPGGDIPPNPVQLLESDKMRELLETCQHIYDLVIIDTPPIGYFSDALLLARH
                                                            VIIDTPP             
       650       660       670       680       690       700       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
ADVVALVSRYNQTSRKELSASVSLLKKTNVTALGVILNGIPVGAQGAYGYYGYGHESERYIREQPAA
ADVVALVSRYNQTSRKELSASVSLLKKTNVTALGVILNGIPVGAQGAYGYYGYGHESER        
                                               YGYYGY              

© 1998-2021Legal notice