BYKdb

Annotate results for A0A1F5RFI7

A0A1F5RFI7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F5RFI7
DOMAINtad8/171TPTDLREIARVLWRRKTLLLVPWVAAVAAGVAAAFMLQPIYFSTTRLILERAQSLPGALG
GMVPGDVAAHQADVMREQVQSSLFLRSVITSTGARDDAATRAWALAKARTIPGMRPDDMV
EAFLVDFLRDAITVRRLRGDIFEVTIGDLAPMRAREFARAVADQ
DOMAINcd552/740TSATRGEGKTTTAACLAITLARELRERTLLVDFDLRSPALHRALGLPSSSWGLAHILHQR
HFDERYVRSTVLPQLDFLGAGRSEHPASELVDLPAVEWFLAEASARYPLVVVDAAPNLAV
PDPLIIGRAVESVIYVIKAGSTVRKAAEYGVRVQREARENVIGVLINDLGEVLPQYYGYH
SAYGDPAEV
SITEWalker A559/561GKT
SITEWalker A'580/587LLVDFDLR
SITEWalker B661/667VVVDAAP
SITEY Cluster727/734YYGYHSAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDAREGATPTDLREIARVLWRRKTLLLVPWVAAVAAGVAAAFMLQPIYFSTTRLILERAQSLPGALGGMVPGDVAAHQAD
       TPTDLREIARVLWRRKTLLLVPWVAAVAAGVAAAFMLQPIYFSTTRLILERAQSLPGALGGMVPGDVAAHQAD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VMREQVQSSLFLRSVITSTGARDDAATRAWALAKARTIPGMRPDDMVEAFLVDFLRDAITVRRLRGDIFEVTIGDLAPMR
VMREQVQSSLFLRSVITSTGARDDAATRAWALAKARTIPGMRPDDMVEAFLVDFLRDAITVRRLRGDIFEVTIGDLAPMR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AREFARAVADQFVISSKAAQLEAVRATQEFSTEQQQVYKRKLEEVERRLEASRRALLTSTLAGSVVDGSNLARARTLLDQ
AREFARAVADQ                                                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGLEVQDGRRRAAALRSRIAERARGEGADPDLLSSPEAANLAAELAALERQLAQALLSATPGEDGSSVRVLLARATSDLE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATLAANAARALPGLGPDARDALVRYRLGLADLDARAARRGYLAAQVAAYERQVVSAPDRELEIQRLSQDAENARSLHNSF


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQQSAAAQIAEAFENAKISGRFSVLEPANLPLAPGKPNRMMLILLGLIGGAVIGVGAVLVVEQHDQSVRNADEVESLLGL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVLGAIPRLEELQRSGRRSRSAGSGVGLPAPREHGLLHRLKVESPLGLEFRRVYLKLAKTRGRSMPRTLLVTSATRGEGK
                                                                       TSATRGEGK
                                                                              GK
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTTAACLAITLARELRERTLLVDFDLRSPALHRALGLPSSSWGLAHILHQRHFDERYVRSTVLPQLDFLGAGRSEHPASE
TTTAACLAITLARELRERTLLVDFDLRSPALHRALGLPSSSWGLAHILHQRHFDERYVRSTVLPQLDFLGAGRSEHPASE
T                  LLVDFDLR                                                     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDLPAVEWFLAEASARYPLVVVDAAPNLAVPDPLIIGRAVESVIYVIKAGSTVRKAAEYGVRVQREARENVIGVLINDL
LVDLPAVEWFLAEASARYPLVVVDAAPNLAVPDPLIIGRAVESVIYVIKAGSTVRKAAEYGVRVQREARENVIGVLINDL
                    VVVDAAP                                                     
       730       740     
....:....|....:....|....:
GEVLPQYYGYHSAYGDPAEVAGNDG
GEVLPQYYGYHSAYGDPAEV     
      YYGYHSAY           

© 1998-2021Legal notice