BYKdb

Annotate results for A0A1F5FG50

A0A1F5FG50 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F5FG50
DOMAINtad12/233GAPKVSEYLLVLRKRKWIIIFAVLFSLTVAAYQSYTTSPTYVATASLVLETSGQSTDLLQ
GFYTSFQPYRLETELQIISSRTICLGVVERLDLAFHPQVQLPDGVFFQDPFVKVGFPAGR
YRVIEGESGFSVMDDAHNVIGECLYEQPFVSNDGLFGFTLHDPEPHPKRIISFRVTNPIQ
EAESIRQATTVQQSSDSNAFTVSVSHTDPKMVARLANTIAEV
DOMAINcd587/776TSPSKGEGKTTTTANLGVSIAQQGHKTLLVDTDLRKAKMHRFFNIPNTPGFTELILGDRT
DEEVIRPTQVENLFVLPSGHPPPNPSELLSSRRTQDILERFRQEYDKVILDTSPVLAVTD
PAVLGSLVDGTILVIEAEVSEAEAVKEAVNLLKNARAQILGFVLNKVDLTRTYKSNRYYH
YYYYHHDDEA
SITEWalker A594/596GKT
SITEWalker A'614/621LLVDTDLR
SITEWalker B694/700VILDTSP
SITEY Cluster759/770YKSNRYYHYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEQTTNPGRGRGAPKVSEYLLVLRKRKWIIIFAVLFSLTVAAYQSYTTSPTYVATASLVLETSGQSTDLLQGFYTSFQPY
           GAPKVSEYLLVLRKRKWIIIFAVLFSLTVAAYQSYTTSPTYVATASLVLETSGQSTDLLQGFYTSFQPY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLETELQIISSRTICLGVVERLDLAFHPQVQLPDGVFFQDPFVKVGFPAGRYRVIEGESGFSVMDDAHNVIGECLYEQPF
RLETELQIISSRTICLGVVERLDLAFHPQVQLPDGVFFQDPFVKVGFPAGRYRVIEGESGFSVMDDAHNVIGECLYEQPF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSNDGLFGFTLHDPEPHPKRIISFRVTNPIQEAESIRQATTVQQSSDSNAFTVSVSHTDPKMVARLANTIAEVYVDENLR
VSNDGLFGFTLHDPEPHPKRIISFRVTNPIQEAESIRQATTVQQSSDSNAFTVSVSHTDPKMVARLANTIAEV       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WKQERARKAREFIGQQIEVAEVKLRLTEDLLREYKEELGIVSFTDEARELIHRLSVVEENRNSLEQELAELEEQQGTVEN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLNRGEIDLDTLTAMSSWPAFQTDQMLKEFVRTAGELTLEKQQLRQTSGLLNPRLAEIDGELDAVEGGIERRLTYIATSG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALGISIEGAKSKLDETSNSISELTAELSTMPREEMELSIRERKSDVASKIHSLLLERYEEARINESMETGDVRIIDRAIR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTAPVSPNHASDLLLGLAVGLVIGIGLAMIVEMNDTTVKSADEVTGLTGLSPIGTIPKATEEFEELGEGRLIVLENPRSP


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAETYRIIRTNIQYFGIDKQIRVLSITSPSKGEGKTTTTANLGVSIAQQGHKTLLVDTDLRKAKMHRFFNIPNTPGFTEL
                          TSPSKGEGKTTTTANLGVSIAQQGHKTLLVDTDLRKAKMHRFFNIPNTPGFTEL
                                 GKT                 LLVDTDLR                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILGDRTDEEVIRPTQVENLFVLPSGHPPPNPSELLSSRRTQDILERFRQEYDKVILDTSPVLAVTDPAVLGSLVDGTILV
ILGDRTDEEVIRPTQVENLFVLPSGHPPPNPSELLSSRRTQDILERFRQEYDKVILDTSPVLAVTDPAVLGSLVDGTILV
                                                     VILDTSP                    
       730       740       750       760       770       780       790 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
IEAEVSEAEAVKEAVNLLKNARAQILGFVLNKVDLTRTYKSNRYYHYYYYHHDDEAERSKGSIWKRFRGKK
IEAEVSEAEAVKEAVNLLKNARAQILGFVLNKVDLTRTYKSNRYYHYYYYHHDDEA               
                                      YKSNRYYHYYYY                     

© 1998-2021Legal notice