BYKdb

Annotate results for A0A1F5AEV3

A0A1F5AEV3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F5AEV3
DOMAINtad13/173LLAQAQHYWHVILKWKWTAVLFFMLAVAVATIYSLLLTPVFTASGSVWIEDDPNILPFED
VQSFGAGSNLQSHARLLRSRTLASDTIDKLKLYENSDFAGKPEKGQARPDPADPIYREVL
TQIFLSNIGVSTAERSRLVDVRFSNRNPKLAADILNALFDG
DOMAINcd568/756TSPLAREGKSSTVSNMGITFAEAGKRVVIVDSDLRKPKQSRIFGVNSGNGPGLSRYLSSH
IEPADVGKPTEIPNLQLITSGPLPANPIELLTSEKMDALIAYLKRSFDFVLFDTPPLLAV
SDALAMGPMADAIILVARGGQTPIPALKQAKQKLDAHKLKCLGVILNGVDLVEQDGYYAR
QYYHYSKPE
SITEWalker A575/577GKS
SITEWalker A'595/602VIVDSDLR
SITEWalker B677/683VLFDTPP
SITEY Cluster744/752YYARQYYHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MATEFPKEPQTGLLAQAQHYWHVILKWKWTAVLFFMLAVAVATIYSLLLTPVFTASGSVWIEDDPNILPFEDVQSFGAGS
            LLAQAQHYWHVILKWKWTAVLFFMLAVAVATIYSLLLTPVFTASGSVWIEDDPNILPFEDVQSFGAGS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLQSHARLLRSRTLASDTIDKLKLYENSDFAGKPEKGQARPDPADPIYREVLTQIFLSNIGVSTAERSRLVDVRFSNRNP
NLQSHARLLRSRTLASDTIDKLKLYENSDFAGKPEKGQARPDPADPIYREVLTQIFLSNIGVSTAERSRLVDVRFSNRNP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLAADILNALFDGYIEMMVRKRYAASEQATAFLNTQIAEIRTDIDKKERELNKYGSEKDILPLTTAEAPTVARIGEVNRA
KLAADILNALFDG                                                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTDATLDRVNKFNAYNQLNAAPLGEIPDAPPGSLIQRLREQYINLSLDYRTRLATVRPEFPAMQRLKSELDAATEALQNE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQNLIRNAYNDYQNALDKEQSYQKLLNDQKNMAYKASSNSVVYNSMRIELENRKALLEALSRRQSETDVSSRLKGLEALN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VWIVDKADYPLRPAFPNKRKNVLMGFLFGLAGGIGLALGLEYLNHTVKTSKDITHSIGVPTLGAIPAFEAEAKPKGPKAE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FARLISMLRGKGERKETKASRRVEDQRVRFLKPNGTDGDSVGGGMRGGKIDLIASREPQSIQAESYRSIRTTLFVSSPPG


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIKTILFTSPLAREGKSSTVSNMGITFAEAGKRVVIVDSDLRKPKQSRIFGVNSGNGPGLSRYLSSHIEPADVGKPTEIP
       TSPLAREGKSSTVSNMGITFAEAGKRVVIVDSDLRKPKQSRIFGVNSGNGPGLSRYLSSHIEPADVGKPTEIP
              GKS                 VIVDSDLR                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLQLITSGPLPANPIELLTSEKMDALIAYLKRSFDFVLFDTPPLLAVSDALAMGPMADAIILVARGGQTPIPALKQAKQK
NLQLITSGPLPANPIELLTSEKMDALIAYLKRSFDFVLFDTPPLLAVSDALAMGPMADAIILVARGGQTPIPALKQAKQK
                                    VLFDTPP                                     
       730       740       750      
....:....|....:....|....:....|....:.
LDAHKLKCLGVILNGVDLVEQDGYYARQYYHYSKPE
LDAHKLKCLGVILNGVDLVEQDGYYARQYYHYSKPE
                       YYARQYYHY    

© 1998-2021Legal notice