BYKdb

Annotate results for A0A1F4YLC6

A0A1F4YLC6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F4YLC6
DOMAINcd56/243TSAIAEEGKTLTSANLATNLASVGRKKVLLVDTDMRKSDIARMFDASPKPGLKEFLAGSV
PLEKIILSSNSVRGLSFISGGEKGTTPPDLLAGETFRSFLQEMRSKFDVVLLDTPPILPV
ADTMSLRDQVDGFILIFRIGLTPYVMLQQALEEIDKNKIIGVVLNGVEMHKYKYYQRYYG
DYYHKKPE
SITEWalker A63/65GKT
SITEWalker A'84/91LLVDTDMR
SITEWalker B165/171VLLDTPP
SITEY Cluster227/238YKYYQRYYGDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKSLIPLKVTQEDFDRGKSYEKDGKELLFLEQFKALRAKFEYQVDIHKYKVVAVTSAIAEEGKTLTSANLATNLASVGR
                                                       TSAIAEEGKTLTSANLATNLASVGR
                                                              GKT               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKVLLVDTDMRKSDIARMFDASPKPGLKEFLAGSVPLEKIILSSNSVRGLSFISGGEKGTTPPDLLAGETFRSFLQEMRS
KKVLLVDTDMRKSDIARMFDASPKPGLKEFLAGSVPLEKIILSSNSVRGLSFISGGEKGTTPPDLLAGETFRSFLQEMRS
   LLVDTDMR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KFDVVLLDTPPILPVADTMSLRDQVDGFILIFRIGLTPYVMLQQALEEIDKNKIIGVVLNGVEMHKYKYYQRYYGDYYHK
KFDVVLLDTPPILPVADTMSLRDQVDGFILIFRIGLTPYVMLQQALEEIDKNKIIGVVLNGVEMHKYKYYQRYYGDYYHK
    VLLDTPP                                                       YKYYQRYYGDYY  
   
...
KPE
KPE

© 1998-2021Legal notice