BYKdb

Annotate results for A0A1F4X8I1

A0A1F4X8I1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F4X8I1
DOMAINcd50/240TSATSEEGKTLVAGFLAITIAHYHDCKTLLIDSDLRRPVVHQLFDLESKKGLAEVLEGKL
PLKDCLRKTGIGNLQVLTAGNGEKTPTELLDSPRLTEVLEEAKFYFDLIVVDSAPIIPVS
DVMILMPEVEGALIVVKAGATPREVVKRAADLVQNAGGKILGIVMNNLEGVLPYYYNYNY
YGYEYGYGGKR
SITEWalker A57/59GKT
SITEWalker A'78/85LLIDSDLR
SITEWalker B158/164IVVDSAP
SITEY Cluster223/236YYYNYNYYGYEYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKNSNHPRYPKTILELYDKESPAATEFRRLYSNLRHMDGFADLKSILVTSATSEEGKTLVAGFLAITIAHYHDCKTLLI
                                                 TSATSEEGKTLVAGFLAITIAHYHDCKTLLI
                                                        GKT                  LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSDLRRPVVHQLFDLESKKGLAEVLEGKLPLKDCLRKTGIGNLQVLTAGNGEKTPTELLDSPRLTEVLEEAKFYFDLIVV
DSDLRRPVVHQLFDLESKKGLAEVLEGKLPLKDCLRKTGIGNLQVLTAGNGEKTPTELLDSPRLTEVLEEAKFYFDLIVV
DSDLR                                                                        IVV
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSAPIIPVSDVMILMPEVEGALIVVKAGATPREVVKRAADLVQNAGGKILGIVMNNLEGVLPYYYNYNYYGYEYGYGGKR
DSAPIIPVSDVMILMPEVEGALIVVKAGATPREVVKRAADLVQNAGGKILGIVMNNLEGVLPYYYNYNYYGYEYGYGGKR
DSAP                                                          YYYNYNYYGYEYGY    
       250        
....:....|....:...
DSRTGKLTPSRQKPRSES


© 1998-2021Legal notice