BYKdb

Annotate results for A0A1F4RMF3

A0A1F4RMF3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F4RMF3
DOMAINtad27/215RQVSIKDYIRVLYKARWVIIISFLLVVISTAYYTFTTEPVYEATAKLMIEEEGGMAQSMF
DLTSMMKKETMINNQVEILKSRTLAENVIRDLMASEYADELRYLGNSPEGKEKKPGIIAS
TRSWLAGLIKNKDDHGLEVSEEDDFDRYVAGLRGSINVSPIRNTDMINITVSAYSPFEAA
YVTDAVANA
DOMAINcd598/788TSSGPKEGKSTSISNLAITFSQMGTNTLLIDGDLRRPILHKLFNLDKKNGLTNVLVGRAN
LDEVVQRNPDLPNLDVLSCGILPPNPAELLGSQQMRRLLTEAKEKYGIILIDTPPTIAVT
DSSVLAPLVDGVLLVVKSGGTQRDAFLRAQEQLHRVGAHILGVILNSIQASNVYGSYYYY
YYYHYYYGQDG
SITEWalker A605/607GKS
SITEWalker A'625/632LLIDGDLR
SITEWalker B706/712ILIDTPP
SITEY Cluster771/784YGSYYYYYYYHYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMMNSNGKGQYSGNGHANAYGSDMQERQVSIKDYIRVLYKARWVIIISFLLVVISTAYYTFTTEPVYEATAKLMIEEEGG
                          RQVSIKDYIRVLYKARWVIIISFLLVVISTAYYTFTTEPVYEATAKLMIEEEGG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAQSMFDLTSMMKKETMINNQVEILKSRTLAENVIRDLMASEYADELRYLGNSPEGKEKKPGIIASTRSWLAGLIKNKDD
MAQSMFDLTSMMKKETMINNQVEILKSRTLAENVIRDLMASEYADELRYLGNSPEGKEKKPGIIASTRSWLAGLIKNKDD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HGLEVSEEDDFDRYVAGLRGSINVSPIRNTDMINITVSAYSPFEAAYVTDAVANAYRRMNQAQSKDEVRQVKNFLEDQLD
HGLEVSEEDDFDRYVAGLRGSINVSPIRNTDMINITVSAYSPFEAAYVTDAVANA                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYRRELSTSEEALKNYKQEAKLVALDQETEELVRKLAEFESLYNGAKTDYQANLKRLEYINGQLQQKQGNFDMESISSQP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLQELKKQIAEKESQLASYMASMAEIGAYDQIKNEIQLRERQIDAVKEKFKQEVTKIAASGFVDPSIVSTSLFSSKIEVE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TELKSLEPKVKALGEIVAQYSKDLESLPAKSLQLARLVRKAQVDEKIYIMLQEKFQESRITEVGQLGNVRMIDPAKEPKF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVKPKKKLNLILGILVGLGLGIGIAFVMEYMDNSLRTMEDIEILGQSIIATIPFIKPEGSNGALSKFKQLEDAEAQDISE


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLVTHLRPKSPISESYRTLRTNIMFSNPDKEIKSIVITSSGPKEGKSTSISNLAITFSQMGTNTLLIDGDLRRPILHKLF
                                     TSSGPKEGKSTSISNLAITFSQMGTNTLLIDGDLRRPILHKLF
                                            GKS                 LLIDGDLR        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLDKKNGLTNVLVGRANLDEVVQRNPDLPNLDVLSCGILPPNPAELLGSQQMRRLLTEAKEKYGIILIDTPPTIAVTDSS
NLDKKNGLTNVLVGRANLDEVVQRNPDLPNLDVLSCGILPPNPAELLGSQQMRRLLTEAKEKYGIILIDTPPTIAVTDSS
                                                                 ILIDTPP        
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLAPLVDGVLLVVKSGGTQRDAFLRAQEQLHRVGAHILGVILNSIQASNVYGSYYYYYYYHYYYGQDGEKKRSKSRRRKA
VLAPLVDGVLLVVKSGGTQRDAFLRAQEQLHRVGAHILGVILNSIQASNVYGSYYYYYYYHYYYGQDG            
                                                  YGSYYYYYYYHYYY                
       810      
....:....|....:.
HKKTHPSDQTIREGDA


© 1998-2021Legal notice