BYKdb

Annotate results for A0A1F4QJ00

A0A1F4QJ00 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F4QJ00
DOMAINcd103/293TSPTVGDGKTTTAINLAGALGQAPEARVLLVDADLRRPCVGGQLGFGDSPAPGLADAILD
PGVSLDDVVRGCPPFNLSILPAGRPPAAPYEVLKSPRLGELLEAARQRYDYILVDTPPVV
PVPDCRLLAKWVDGFLVVVAAHKTPRPLVAEALTVLDPAKALGLVFNGDDRPFAGYYHAY
GYAPDATRGGG
SITEWalker A110/112GKT
SITEWalker A'131/138LLVDADLR
SITEWalker B214/220ILVDTPP
SITE-211/-213YDY
SITEY Cluster278/284YYHAYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDPDVPENNSSALPAFLFDRILRARLPGEMSGNFQEQGPTDGSRRLAPPSVPGQAVEGPDALDDHLVSLLAPASFEAEQY


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTLRYGLEQMAKAGQFTPIVGITSPTVGDGKTTTAINLAGALGQAPEARVLLVDADLRRPCVGGQLGFGDSPAPGLADAI
                      TSPTVGDGKTTTAINLAGALGQAPEARVLLVDADLRRPCVGGQLGFGDSPAPGLADAI
                             GKT                  LLVDADLR                      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDPGVSLDDVVRGCPPFNLSILPAGRPPAAPYEVLKSPRLGELLEAARQRYDYILVDTPPVVPVPDCRLLAKWVDGFLVV
LDPGVSLDDVVRGCPPFNLSILPAGRPPAAPYEVLKSPRLGELLEAARQRYDYILVDTPPVVPVPDCRLLAKWVDGFLVV
                                                     ILVDTPP                    
       250       260       270       280       290       300       310       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
VAAHKTPRPLVAEALTVLDPAKALGLVFNGDDRPFAGYYHAYGYAPDATRGGGRARAVRAVAAFLGRRRSTWQRGAP
VAAHKTPRPLVAEALTVLDPAKALGLVFNGDDRPFAGYYHAYGYAPDATRGGG                        
                                     YYHAYGY                                 
© 1998-2021Legal notice