BYKdb

Annotate results for A0A1F4PXF3

A0A1F4PXF3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F4PXF3
DOMAINcd52/241TSAIPREGKTTTVANLGITMALAGSKTLLIDADLRRPGLHRYFQLSGKVGLTSVLGDQAE
LREAIQRTKLAELSLLPCGPAVANPAELLGSRRMAELVNHLAAQYDLLVFDSSPVITVAD
ALVLAGVSDGVILVVRSGGAPHEVVSRAKKQLESVKANIVGAVLNAFDAKGEGYYSPYYY
RYGYGYGDSN
SITEWalker A59/61GKT
SITEWalker A'79/86LLIDADLR
SITEWalker B159/165LVFDSSP
SITEY Cluster225/237YYSPYYYRYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASPAEKKKSPTPGFPSILSDAGSALTEAFRGLRTNLLFSGVDEPHRRILVTSAIPREGKTTTVANLGITMALAGSKTLL
                                                   TSAIPREGKTTTVANLGITMALAGSKTLL
                                                          GKT                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADLRRPGLHRYFQLSGKVGLTSVLGDQAELREAIQRTKLAELSLLPCGPAVANPAELLGSRRMAELVNHLAAQYDLLV
IDADLRRPGLHRYFQLSGKVGLTSVLGDQAELREAIQRTKLAELSLLPCGPAVANPAELLGSRRMAELVNHLAAQYDLLV
IDADLR                                                                        LV
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDSSPVITVADALVLAGVSDGVILVVRSGGAPHEVVSRAKKQLESVKANIVGAVLNAFDAKGEGYYSPYYYRYGYGYGDS
FDSSPVITVADALVLAGVSDGVILVVRSGGAPHEVVSRAKKQLESVKANIVGAVLNAFDAKGEGYYSPYYYRYGYGYGDS
FDSSP                                                           YYSPYYYRYGYGY   
        
....:...
NSDGQKAK
N       

© 1998-2021Legal notice