BYKdb

Annotate results for A0A1F4MQ28

A0A1F4MQ28 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F4MQ28
DOMAINtad7/259QGLDIRLIFQVIERKKNYLIGVVLFFLVLVLLYNFLATPVYQSSVLIKKEQIYDYRDPDP
LNRIMSRQTTDEIDTEIEINKSRSVLEKVVLEKKLFLQIESIKLSKGKNINLNYSYPLYE
QWLGIESPWKEQLPRFENIQLKPDEVSHDYHLKLFGDNQYLILDAEKDNVIMSGSDLNNS
AFNLPNLIFTMQWSAASAGSEVYFNVQNLEIVVEQLAERISIRKIGKTKIFQLSVKSDSP
FEAQLLAATVVDK
DOMAINcd612/805TSCEENTGKTTVISNLALSFAKMGKKVLVLDCDLRKGKIGKFFDLPENARGMIDYLSNNQ
NRPEVYNNFSFLTQQTLAVVPNGGYTDDSSELLSAMAVKSMLEDFQKAYDYILIDTPPIT
KVSDVLILGDFVKDIILIVRPFLTYKEAIRGALEEMRQAGLNLQGVVVNGFNVGKSAYYY
RYGHGYNYQTISES
SITEWalker A619/621GKT
SITEWalker A'639/646LVLDCDLR
SITEWalker B723/729ILIDTPP
SITE-720/-722YDY
SITE-785/-787GKS
SITEY Cluster789/799YYYRYGHGYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEHTSAQGLDIRLIFQVIERKKNYLIGVVLFFLVLVLLYNFLATPVYQSSVLIKKEQIYDYRDPDPLNRIMSRQTTDEID
      QGLDIRLIFQVIERKKNYLIGVVLFFLVLVLLYNFLATPVYQSSVLIKKEQIYDYRDPDPLNRIMSRQTTDEID

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEIEINKSRSVLEKVVLEKKLFLQIESIKLSKGKNINLNYSYPLYEQWLGIESPWKEQLPRFENIQLKPDEVSHDYHLKL
TEIEINKSRSVLEKVVLEKKLFLQIESIKLSKGKNINLNYSYPLYEQWLGIESPWKEQLPRFENIQLKPDEVSHDYHLKL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGDNQYLILDAEKDNVIMSGSDLNNSAFNLPNLIFTMQWSAASAGSEVYFNVQNLEIVVEQLAERISIRKIGKTKIFQLS
FGDNQYLILDAEKDNVIMSGSDLNNSAFNLPNLIFTMQWSAASAGSEVYFNVQNLEIVVEQLAERISIRKIGKTKIFQLS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKSDSPFEAQLLAATVVDKFREVRLEQKQQTVKYSYDFADQQLQQIDQKLKAAEDTLSKFKSKHKITSIDDNSAEVVDFL
VKSDSPFEAQLLAATVVDK                                                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKLETEKVNTDLELTEYENKIQEMRREVKNRGYFDQTYLTPESNNESYSPFSVLLRQLSDLELKRLELLQKRKDTHPDVV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TINEQISQIKAQLTDYNQNTIIAYQIIINSLREKQNRLLSLIQKYSGRIESLPAEESQLAELIRQKEVYAKMFSLLLDKR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEMRMAELSKLQDIIVVDPAQKPLKPISPRKSLNVILALLAGVMLGLTAIFVLEHFEKRLTNLDDVERLFSVTLMGILPV


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDAQLREQIRNSKSIEERAVVLIKEQYAFKEMYRLLRTKIGNIPGGKMMMFTSCEENTGKTTVISNLALSFAKMGKKVLV
                                                   TSCEENTGKTTVISNLALSFAKMGKKVLV
                                                          GKT                 LV
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDCDLRKGKIGKFFDLPENARGMIDYLSNNQNRPEVYNNFSFLTQQTLAVVPNGGYTDDSSELLSAMAVKSMLEDFQKAY
LDCDLRKGKIGKFFDLPENARGMIDYLSNNQNRPEVYNNFSFLTQQTLAVVPNGGYTDDSSELLSAMAVKSMLEDFQKAY
LDCDLR                                                                          
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYILIDTPPITKVSDVLILGDFVKDIILIVRPFLTYKEAIRGALEEMRQAGLNLQGVVVNGFNVGKSAYYYRYGHGYNYQ
DYILIDTPPITKVSDVLILGDFVKDIILIVRPFLTYKEAIRGALEEMRQAGLNLQGVVVNGFNVGKSAYYYRYGHGYNYQ
  ILIDTPP                                                           YYYRYGHGYNY 
     
....:
TISES
TISES

© 1998-2021Legal notice