BYKdb

Annotate results for A0A1F4LY30

A0A1F4LY30 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F4LY30
DOMAINtad9/264DSINLLDLLDVVLDQRWVIAGVTVLVMALGGAYAYMATPIYEANTLIQVEDSKNGAAGFL
GDAGSLFDIKSPSTAEIEILRSRLVVGQAVDNLKLNLDIRPKYLPIFGQWLARRATEPST
PGFMGFGGYVSGTEMLNVAKLTMPPALEGVRLHLVATAGGFDLLDADGIKLGLGQVNVPM
AFGYGGQPGELLVTELVGLPGAEFYVTKMSHLGVTESLQNSLVISEKGKQSGVISSSLQG
SDPLKTATILNEISAF
DOMAINcd541/730TGPTPGIGKSFASANFAAVLAAGGKRVLLVDADMRKGHIHEAFGLDRGHGLSELISGTQT
LDQVVHKEVSEGLDLIATGPLPPNPAELLMSPAAVQLLHTLSERYDVVVMDTPPVLAVSD
TQVLAPMAGTVFMVARAEVSTLAELQESTKRLARSGVAVRGVIFNDLNLSKRRYGYGYGY
GYGYKYSRYR
SITEWalker A548/550GKS
SITEWalker A'568/575LLVDADMR
SITEWalker B648/654VVMDTPP
SITEY Cluster714/736YGYGYGYGYGYKYSRYRYAQYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQPMQDDEDSINLLDLLDVVLDQRWVIAGVTVLVMALGGAYAYMATPIYEANTLIQVEDSKNGAAGFLGDAGSLFDIKSP
        DSINLLDLLDVVLDQRWVIAGVTVLVMALGGAYAYMATPIYEANTLIQVEDSKNGAAGFLGDAGSLFDIKSP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STAEIEILRSRLVVGQAVDNLKLNLDIRPKYLPIFGQWLARRATEPSTPGFMGFGGYVSGTEMLNVAKLTMPPALEGVRL
STAEIEILRSRLVVGQAVDNLKLNLDIRPKYLPIFGQWLARRATEPSTPGFMGFGGYVSGTEMLNVAKLTMPPALEGVRL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HLVATAGGFDLLDADGIKLGLGQVNVPMAFGYGGQPGELLVTELVGLPGAEFYVTKMSHLGVTESLQNSLVISEKGKQSG
HLVATAGGFDLLDADGIKLGLGQVNVPMAFGYGGQPGELLVTELVGLPGAEFYVTKMSHLGVTESLQNSLVISEKGKQSG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VISSSLQGSDPLKTATILNEISAFYVRQNVERKAAEAEKSISFLNTQLPELRKQLEGSENKFNQFRNKTGTFNLGEEAKG
VISSSLQGSDPLKTATILNEISAF                                                        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLDQSVTLRVKLLEAQQKRQELQSRFTAQHPSVQVLDAQIKLLNTQIADMDGKAKSFPNVEQDLLRLTRDVRVNNELYTG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLNTFQQLRLVKEGKVGNVRIIDVAATPEQPIKPQRSMILALSGVLGVLAGLGLAFLRNSLRPGIKHADDIEQHVGLHVF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATVPHSNDQASLNINSKSKLKGMHLLANVQPNDPCIESLRSLRTALQFAMLDAANNVVLITGPTPGIGKSFASANFAAVL
                                                            TGPTPGIGKSFASANFAAVL
                                                                   GKS          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAGGKRVLLVDADMRKGHIHEAFGLDRGHGLSELISGTQTLDQVVHKEVSEGLDLIATGPLPPNPAELLMSPAAVQLLHT
AAGGKRVLLVDADMRKGHIHEAFGLDRGHGLSELISGTQTLDQVVHKEVSEGLDLIATGPLPPNPAELLMSPAAVQLLHT
       LLVDADMR                                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSERYDVVVMDTPPVLAVSDTQVLAPMAGTVFMVARAEVSTLAELQESTKRLARSGVAVRGVIFNDLNLSKRRYGYGYGY
LSERYDVVVMDTPPVLAVSDTQVLAPMAGTVFMVARAEVSTLAELQESTKRLARSGVAVRGVIFNDLNLSKRRYGYGYGY
       VVMDTPP                                                           YGYGYGY
       730       740
....:....|....:....|
GYGYKYSRYRYAQYEYGQQK
GYGYKYSRYR          
GYGYKYSRYRYAQYEY    

© 1998-2021Legal notice