BYKdb

Annotate results for A0A1F4J4A4

A0A1F4J4A4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F4J4A4
DOMAINtad43/241DRIDLKTVWRTLFKHKWAIGSITALCTLGAVVYTLRITPQYQSVALLQIDRAAQKVVGFN
TEVEVDEGPASDQLQLRTQIELLKSRSLAERVIDEMGLYKPDAPAPLPSEADADDAAAPT
GSEPIDQARSLAAKLLRNLRTLFTPSQANQRTLSRTGTVAQFEHAISVEPIRNSRLVELR
VLNPDPELAARIANTMARA
DOMAINcd580/769TSCGKGEGKTTTALALAINFAQLGQKVLLIDADMRKGWVHQMLRVSNERGLSNLLSGDRG
SDGLMQDTTVANLSVITAGPVPPDPVELLMGPRLGQLLEKAQAMGYQQIVIDGPPLLGIA
DAIVLGNQIQHIVFAVKAGGTRKDSIRDALRRLRNAGLAPMGMALTHARNEHTSDYAYAA
YYGYGYGDGY
SITEWalker A587/589GKT
SITEWalker A'607/614LLIDADMR
SITEWalker B688/694IVIDGPP
SITEY Cluster755/769YAYAAYYGYGYGDGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASTDQHPLPAVPGPTGSLALRRESALSAQSMARGEPGALAEDRIDLKTVWRTLFKHKWAIGSITALCTLGAVVYTLRIT
                                          DRIDLKTVWRTLFKHKWAIGSITALCTLGAVVYTLRIT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQYQSVALLQIDRAAQKVVGFNTEVEVDEGPASDQLQLRTQIELLKSRSLAERVIDEMGLYKPDAPAPLPSEADADDAAA
PQYQSVALLQIDRAAQKVVGFNTEVEVDEGPASDQLQLRTQIELLKSRSLAERVIDEMGLYKPDAPAPLPSEADADDAAA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTGSEPIDQARSLAAKLLRNLRTLFTPSQANQRTLSRTGTVAQFEHAISVEPIRNSRLVELRVLNPDPELAARIANTMAR
PTGSEPIDQARSLAAKLLRNLRTLFTPSQANQRTLSRTGTVAQFEHAISVEPIRNSRLVELRVLNPDPELAARIANTMAR

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFIASNIERRMDSSIYARQFLEDQIRQTKAKLEESERVINTYAKKNEILNLGEKGSAATQTFVDFSAALAKAEQDRIKAE
A                                                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLYNQVKLNPESAPQAVTNEAIRAYKEQRARLEAEYARDLAVYKPDYPAMVQARAQIAELEGRIKTEVNNILASIQGQYI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AASRAEEQLKAKVASSRSEVLTVQDRSVDMNLLSRELDTNRQVYDSLLQRLKEVNVTAGITTNNVSIVDEASVPLFPAKP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLKVNIGLGVMLGLFLGMLAALLREQMDDSVKHANEIETLFHLPLLGLIPFTRPKLGRNEPVALLTHRDPRSTFAEAYRS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRTALQFSTAEGAPQRFMVTSCGKGEGKTTTALALAINFAQLGQKVLLIDADMRKGWVHQMLRVSNERGLSNLLSGDRGS
                   TSCGKGEGKTTTALALAINFAQLGQKVLLIDADMRKGWVHQMLRVSNERGLSNLLSGDRGS
                          GKT                 LLIDADMR                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGLMQDTTVANLSVITAGPVPPDPVELLMGPRLGQLLEKAQAMGYQQIVIDGPPLLGIADAIVLGNQIQHIVFAVKAGGT
DGLMQDTTVANLSVITAGPVPPDPVELLMGPRLGQLLEKAQAMGYQQIVIDGPPLLGIADAIVLGNQIQHIVFAVKAGGT
                                               IVIDGPP                          
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKDSIRDALRRLRNAGLAPMGMALTHARNEHTSDYAYAAYYGYGYGDGYTPPSAARPSPAPSPNKPPVPLPAGTRIEPTL
RKDSIRDALRRLRNAGLAPMGMALTHARNEHTSDYAYAAYYGYGYGDGY                               
                                  YAYAAYYGYGYGDGY                               
     
....:
DPSGA


© 1998-2021Legal notice