BYKdb

Annotate results for A0A1F4H4E9

A0A1F4H4E9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F4H4E9
DOMAINtad45/243DEIDLKAILRTLLKHKWTIVGTTALCTLAAVVYTLRVTPQYESAALLQIDRAAQKVVGFN
AEVEVDEGPAADQMQLRTQIELLKSRSLAERVIDEMGLYKPESPTGLPEAPAAEPGRLPG
EADAEAEEPGFVAKLGNNFTTLFKASSEDERVLSRAQTVGAFERSVTVEPIRNSRLVQIK
VLNADPELAARIANTLAKA
DOMAINcd582/771TSCGKSEGKTTTAIALAINFAQLGQRVLLIDADMRKSAVHKALRMPNERGLSNLLSGDRG
SEMLIQPTAIPNLSVLLAGPTPPDPVELLMGPKLAMLMEKAQELGFAQVVIDGPPLLGIA
DAVVLGNQIQHVVFAVKASSTKKDSIKDAMRRLRNAGIAPMGVVLTHARNEHSSDYAYES
YYGYGDAHTP
SITEWalker A585/587GKS
SITEWalker A'609/616LLIDADMR
SITEWalker B690/696VVIDGPP
SITEY Cluster757/765YAYESYYGY
SITEWalker A589/591GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSPENLPSLPPQPQPPGALALRPSGALQTQLLAQQQEADAQADDEIDLKAILRTLLKHKWTIVGTTALCTLAAVVYTLR
                                            DEIDLKAILRTLLKHKWTIVGTTALCTLAAVVYTLR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTPQYESAALLQIDRAAQKVVGFNAEVEVDEGPAADQMQLRTQIELLKSRSLAERVIDEMGLYKPESPTGLPEAPAAEPG
VTPQYESAALLQIDRAAQKVVGFNAEVEVDEGPAADQMQLRTQIELLKSRSLAERVIDEMGLYKPESPTGLPEAPAAEPG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLPGEADAEAEEPGFVAKLGNNFTTLFKASSEDERVLSRAQTVGAFERSVTVEPIRNSRLVQIKVLNADPELAARIANTL
RLPGEADAEAEEPGFVAKLGNNFTTLFKASSEDERVLSRAQTVGAFERSVTVEPIRNSRLVQIKVLNADPELAARIANTL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKAFIASNIERKVDSSVYARQFLEDQIKQTKAKLEESERQINDYAKKNQILNLGDKGSAATQNFVDFSAALGKAQQDRIK
AKA                                                                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AETQYNEVKNNPDSAPQALENAAIQAYKEERAKLEAEYAKNLSTYKPEFPTMVQARAQIGELNSRIKAEVDTILASIKGQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FEAAKQQEEALKAKVASTRSEVISVQDRSVDMNLLQRELETNRQVYDALLQRLKEVSVTAGITTNNVSIVDEASAPLFPA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPKPLINLALGLVLGVFLGMVAALLREQMDDSIKHADEIEGSLGLPLLGLIPLTKQEKGSEESIALLAHREPRSGFAEAY


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSMRTALQFSTADGAPKRFMVTSCGKSEGKTTTAIALAINFAQLGQRVLLIDADMRKSAVHKALRMPNERGLSNLLSGDR
                     TSCGKSEGKTTTAIALAINFAQLGQRVLLIDADMRKSAVHKALRMPNERGLSNLLSGDR
                        GKS GKT                 LLIDADMR                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSEMLIQPTAIPNLSVLLAGPTPPDPVELLMGPKLAMLMEKAQELGFAQVVIDGPPLLGIADAVVLGNQIQHVVFAVKAS
GSEMLIQPTAIPNLSVLLAGPTPPDPVELLMGPKLAMLMEKAQELGFAQVVIDGPPLLGIADAVVLGNQIQHVVFAVKAS
                                                 VVIDGPP                        
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STKKDSIKDAMRRLRNAGIAPMGVVLTHARNEHSSDYAYESYYGYGDAHTPRAATPQPAPGMQPAPLAASTRTEPTLGPT
STKKDSIKDAMRRLRNAGIAPMGVVLTHARNEHSSDYAYESYYGYGDAHTP                             
                                    YAYESYYGY                                   
     
....:
ATAEA


© 1998-2021Legal notice