BYKdb

Annotate results for A0A1F4AW17

A0A1F4AW17 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F4AW17
DOMAINtad16/199ETFDLLEYWRTIANRKWSIIGLTIAITLLAALLVYGMQPTYRSTVTLLIEGQKNKVVGIE
EVYSGISANREYYQTQAEILKSRELAAKVVKALKLATHPEFDPRQQTPPFWKAWLGSAGI
DAEALGISPADSAPGEDAINKQVIGRFQRQLAVQPVRASQLVKVGFDSYNPELAAKIANA
LADA
DOMAINcd543/733TSSVPGEGKTTVSTNLALAFAQTKRVVLVDGDMRRPTIGKLFGREANAPGLSSLVAGSAP
ATECTFKVEGTELYVIPSGPIPPNPLELMLSKRFEEALHKLHELFDMVIIDSPPVQLVSD
SMVIARHCTGVVFVVKADDTPYQVARNAVKRLRQAQVHIVGVALNQLDFQRADRYYGEYT
GHSKYGYKRYY
SITEWalker A550/552GKT
SITEWalker A'569/576VLVDGDMR
SITEWalker B650/656VIIDSPP
SITEY Cluster717/736YYGEYTGHSKYGYKRYYGAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPNPQLTGEPAARAEETFDLLEYWRTIANRKWSIIGLTIAITLLAALLVYGMQPTYRSTVTLLIEGQKNKVVGIEEVYSG
               ETFDLLEYWRTIANRKWSIIGLTIAITLLAALLVYGMQPTYRSTVTLLIEGQKNKVVGIEEVYSG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISANREYYQTQAEILKSRELAAKVVKALKLATHPEFDPRQQTPPFWKAWLGSAGIDAEALGISPADSAPGEDAINKQVIG
ISANREYYQTQAEILKSRELAAKVVKALKLATHPEFDPRQQTPPFWKAWLGSAGIDAEALGISPADSAPGEDAINKQVIG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFQRQLAVQPVRASQLVKVGFDSYNPELAAKIANALADAYIESDLEARYQMTQKASNWLSERLGGLRQKVESAERALQQY
RFQRQLAVQPVRASQLVKVGFDSYNPELAAKIANALADA                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RERERIVDVKGVAQSGASRQLEQLTTALVDARNRRNEAENRYNQIRGIGRTPAASYGSVPAIMNNTLVVQMRTAEADAQR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLSELSNRYGREHPRMVQAQGELRAARENTRRAIETVVASITRDYEVARANEASIERSLNQSKSEIQNLNRKEFQLGILE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REVAANKQLYDMFLGRFKETSIAGDLQSTVARVVDPAIPSATPYKPNKRQTVLIAMVAGLFVAVMLALLLERLDSTVKTS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HDVENKLGLPVLATLPIMTERKVKFERIFEQNPQAVFSEGIRTARTGIMLSSIDEPHRVLVVTSSVPGEGKTTVSTNLAL
                                                              TSSVPGEGKTTVSTNLAL
                                                                     GKT        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFAQTKRVVLVDGDMRRPTIGKLFGREANAPGLSSLVAGSAPATECTFKVEGTELYVIPSGPIPPNPLELMLSKRFEEAL
AFAQTKRVVLVDGDMRRPTIGKLFGREANAPGLSSLVAGSAPATECTFKVEGTELYVIPSGPIPPNPLELMLSKRFEEAL
        VLVDGDMR                                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKLHELFDMVIIDSPPVQLVSDSMVIARHCTGVVFVVKADDTPYQVARNAVKRLRQAQVHIVGVALNQLDFQRADRYYGE
HKLHELFDMVIIDSPPVQLVSDSMVIARHCTGVVFVVKADDTPYQVARNAVKRLRQAQVHIVGVALNQLDFQRADRYYGE
         VIIDSPP                                                            YYGE
       730       740     
....:....|....:....|....:
YTGHSKYGYKRYYGAYGGKKRKAAA
YTGHSKYGYKRYY            
YTGHSKYGYKRYYGAY         

© 1998-2021Legal notice