BYKdb

Annotate results for A0A1F3SJM1

A0A1F3SJM1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F3SJM1
DOMAINtad11/157KSYDPLILRTILRRYWWWPLTFVFIFGLLAFSYLRYTKPIYESSMILQLSDKDEAKDVLN
IDNLNVRGDQLSSVVELLRSELLFERAIAHLNLNVSLYSRGKILTEEKYLSSSFHVQPYE
LRDSSLVYEGTEVAVAYNNGKVVLSYL
DOMAINcd589/777SSSISGEGKTFVALNLGGIIAMSGKRTVLLDLDLRKPKIHLAFEVDNTVGMSSLIVGQSE
LDECIQHSVLENFDFITAGPIPPNPSELLLSQRFKDIIEDLKTRYDVVIIDNPPVGLVSD
GVRNLTEADIPIYVFKSHYSKRNFADRVKELFEMQQLKNLNVILNGVQSNRGSVYGYGYG
YGYGYGYGN
SITEWalker A596/598GKT
SITEWalker A'616/623VLLDLDLR
SITEWalker B696/702VIIDNPP
SITE-721/-727YVFKSHY
SITEY Cluster763/779YGYGYGYGYGYGYGNGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSNKKSLIINKSYDPLILRTILRRYWWWPLTFVFIFGLLAFSYLRYTKPIYESSMILQLSDKDEAKDVLNIDNLNVRGDQ
          KSYDPLILRTILRRYWWWPLTFVFIFGLLAFSYLRYTKPIYESSMILQLSDKDEAKDVLNIDNLNVRGDQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSSVVELLRSELLFERAIAHLNLNVSLYSRGKILTEEKYLSSSFHVQPYELRDSSLVYEGTEVAVAYNNGKVVLSYLKNG
LSSVVELLRSELLFERAIAHLNLNVSLYSRGKILTEEKYLSSSFHVQPYELRDSSLVYEGTEVAVAYNNGKVVLSYL   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKKTIRGNLNEHFVNDDMDVVIKSTNKQLFISTSQNDDLYFIFNSVQSVAERMRNGVTITPIDVAAKTISISFRGHNAQL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CHDVTLAISKAFQEFDEESKRQGADNIIRFIDNQLDSLRKELKSSKDSLMFFQRSANLPDPESISGTITENISKLNDELY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLEEEQLSLDILDQKLNAKVSRLNVYRMIPEMLGKSYETALVGHIESLHTLLEKKEDLLYNVTEENEEVVALTKKIKAKI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIQHSVSTIRNRLTTNIAIIRSKIGAEEGEMFELPEKRMEYGRLKNIQELNEKYFTLLTEKKVLYEISDAGYESSNRVL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAPKVSKEPVAPSKKFVYTTFILFGVILGLGVMFLRYLMFNEINLIEDLVSILPERASILGGVPLFKYNMEYSQLIVAEA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PKSMMAEAMRKIRTNLSYIHPNYKTIAISSSISGEGKTFVALNLGGIIAMSGKRTVLLDLDLRKPKIHLAFEVDNTVGMS
                            SSSISGEGKTFVALNLGGIIAMSGKRTVLLDLDLRKPKIHLAFEVDNTVGMS
                                   GKT                 VLLDLDLR                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLIVGQSELDECIQHSVLENFDFITAGPIPPNPSELLLSQRFKDIIEDLKTRYDVVIIDNPPVGLVSDGVRNLTEADIPI
SLIVGQSELDECIQHSVLENFDFITAGPIPPNPSELLLSQRFKDIIEDLKTRYDVVIIDNPPVGLVSDGVRNLTEADIPI
                                                       VIIDNPP                  
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVFKSHYSKRNFADRVKELFEMQQLKNLNVILNGVQSNRGSVYGYGYGYGYGYGYGNGYMDDDTNKFKEAARKMKWYRRI
YVFKSHYSKRNFADRVKELFEMQQLKNLNVILNGVQSNRGSVYGYGYGYGYGYGYGN                       
                                          YGYGYGYGYGYGYGNGY                     
       
....:..
FRRDANK


© 1998-2021Legal notice