BYKdb

Annotate results for A0A1F3Q014

A0A1F3Q014 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F3Q014
DOMAINtad25/267GEFELGLFIFIARKSFFWIILFFILAFLGASAYLRYTTPIFESSSVLQIETTNQASKLLN
VGNITEPDNGLAEGIELLKSKVFLKRVLSQLPLQASYYAEGTFKNNELYTSSPYSVDYKI
INPKISGVKIYIDFVDSTHGTISYSFDNETEQQHNFISNKWMKFPEMDLFISIKNFTEIA
NEQNVVKKNAYYFTLNDLDAIVNESYPKVEVKLLNDQAKTILVSYKGFNPQKAADIVSKM
TEE
DOMAINcd606/795TSTISGEGKTFVAINLAGILAFSGKKVVIIDLDMRKPKIHIGFKADNSRGMSTLLIGKDF
IENTVQHSSLENLDFITAGPIPPNPSELIISQKMDDILTQLKSIYDIIIIDNPPVGLVSD
GIAMIQKADYPIYIFRADYSKRNFIQNVDRLYNETNIKNLSVVLNGVDIERKSYGYNYGY
GYGYGYGYGY
SITEWalker A613/615GKT
SITEWalker A'633/640VIIDLDMR
SITEWalker B713/719IIIDNPP
SITE-735/-744YPIYIFRADY
SITEY Cluster779/798YGYNYGYGYGYGYGYGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQEDISKTNDNFERYKERISNFSGEFELGLFIFIARKSFFWIILFFILAFLGASAYLRYTTPIFESSSVLQIETTNQAS
                        GEFELGLFIFIARKSFFWIILFFILAFLGASAYLRYTTPIFESSSVLQIETTNQAS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLLNVGNITEPDNGLAEGIELLKSKVFLKRVLSQLPLQASYYAEGTFKNNELYTSSPYSVDYKIINPKISGVKIYIDFVD
KLLNVGNITEPDNGLAEGIELLKSKVFLKRVLSQLPLQASYYAEGTFKNNELYTSSPYSVDYKIINPKISGVKIYIDFVD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STHGTISYSFDNETEQQHNFISNKWMKFPEMDLFISIKNFTEIANEQNVVKKNAYYFTLNDLDAIVNESYPKVEVKLLND
STHGTISYSFDNETEQQHNFISNKWMKFPEMDLFISIKNFTEIANEQNVVKKNAYYFTLNDLDAIVNESYPKVEVKLLND

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAKTILVSYKGFNPQKAADIVSKMTEEYSNFDIERKGESSLKVIEFIDHQIDIVYEQLKSSETSIQEFTKNNNVTNTDIE
QAKTILVSYKGFNPQKAADIVSKMTEE                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTAKTTRLNALDDQIISLELEENVLNKIETTLSNSKNIDTYTLIAMLAGTTTESNITSAVEALHKLLIQKEEMLYDVKPN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEATRLIDYQIEIQKKLLKESINSVKNNVKSRKEDLKRKALEFEGKYQKLPENEIEYGRLQRLFSINEKYYNLLLEKKTE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YSISKAGFVTQNVVLEKAEANLVPVSPNRRITFIIYFLIAGLLGIFLIIIRYLAHNEINSLNEISKYTNSSIGILGIVPN


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKQDIPVSQLLVDKSPKSLIAEAFRSIRTNLQFISNTPGPKIIALTSTISGEGKTFVAINLAGILAFSGKKVVIIDLDMR
                                             TSTISGEGKTFVAINLAGILAFSGKKVVIIDLDMR
                                                    GKT                 VIIDLDMR
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPKIHIGFKADNSRGMSTLLIGKDFIENTVQHSSLENLDFITAGPIPPNPSELIISQKMDDILTQLKSIYDIIIIDNPPV
KPKIHIGFKADNSRGMSTLLIGKDFIENTVQHSSLENLDFITAGPIPPNPSELIISQKMDDILTQLKSIYDIIIIDNPPV
                                                                        IIIDNPP 
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLVSDGIAMIQKADYPIYIFRADYSKRNFIQNVDRLYNETNIKNLSVVLNGVDIERKSYGYNYGYGYGYGYGYGYGYYDE
GLVSDGIAMIQKADYPIYIFRADYSKRNFIQNVDRLYNETNIKNLSVVLNGVDIERKSYGYNYGYGYGYGYGYGY     
                                                          YGYNYGYGYGYGYGYGYGYY  
       810   
....:....|...
HTKQKKKKSFFKR


© 1998-2021Legal notice