BYKdb

Annotate results for A0A1F3PPL5

A0A1F3PPL5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F3PPL5
DOMAINtad10/249ETFDVRIFTYIIKKSMFLVAIIMGISIVGAFLYLRYTPPLYQSITVLQISNNNNADKVLE
IENLREENTIAQTIELLRSQEFLKRVFSKLPIDIQYFNEGTFLSNEMYKSSPFEVKVKIN
NGAIYDKKIYIDFENPTTYHLKINSDDLEFENLSVGKWENINGIDVKVTITNYKGIEELH
KSLNHESFFFILKNPTTLLNEHISKLEIKLQNPEANTIEISYVDNNALKTSEVVNTIAEE
DOMAINcd591/781SSTVPGEGKTFVAINLAGILAISGKKVILIDLDLRKPRIHKGFDIVNDKGVSTILIKKHL
YKDCIKKSRFENLEFITAGPIPPNPSELIISKEMDEFLSELHNEYDFIIIDTPPIGIVSD
GISIFKKAAFPIYVTRANYSRRNYINNINHLIDDKNITKISVVLNGLDTRQTKYGYGYGY
GYGGYGAYGEY
SITEWalker A598/600GKT
SITEWalker A'618/625ILIDLDLR
SITEWalker B698/704IIIDTPP
SITE-723/-734YVTRANYSRRNY
SITEY Cluster764/785YGYGYGYGYGGYGAYGEYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQKKIPLINETFDVRIFTYIIKKSMFLVAIIMGISIVGAFLYLRYTPPLYQSITVLQISNNNNADKVLEIENLREENTIA
         ETFDVRIFTYIIKKSMFLVAIIMGISIVGAFLYLRYTPPLYQSITVLQISNNNNADKVLEIENLREENTIA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTIELLRSQEFLKRVFSKLPIDIQYFNEGTFLSNEMYKSSPFEVKVKINNGAIYDKKIYIDFENPTTYHLKINSDDLEFE
QTIELLRSQEFLKRVFSKLPIDIQYFNEGTFLSNEMYKSSPFEVKVKINNGAIYDKKIYIDFENPTTYHLKINSDDLEFE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLSVGKWENINGIDVKVTITNYKGIEELHKSLNHESFFFILKNPTTLLNEHISKLEIKLQNPEANTIEISYVDNNALKTS
NLSVGKWENINGIDVKVTITNYKGIEELHKSLNHESFFFILKNPTTLLNEHISKLEIKLQNPEANTIEISYVDNNALKTS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSETERQIHSFKKENKISPNSDLNLSAFPIYTSKIHEFDEE
EVVNTIAEE                                                                       

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IMNIEFELVTLNRIKSEVAENKNIDVYELIALLSGTKSEGYISNILESIQQKNDQKDMLLNDVTNNNHKIKIVDKQIENL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKTMIDFIKNTIKTLEKKSIDYEEKILQYQNEIFNTGQVNEVELARLTRIYEINEGFLTQLIEKKAQYSISQAGYVSQNL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILQKSSPPTEPISPRKKMTLIIFLAAGILISLSIVILRYLLHSQITSITDITSYTDAPIIGTIPKYNKEIPVSQLIVNIN


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TKSIISEAFRTLRTNLEFIAHGESNKIITVSSTVPGEGKTFVAINLAGILAISGKKVILIDLDLRKPRIHKGFDIVNDKG
                              SSTVPGEGKTFVAINLAGILAISGKKVILIDLDLRKPRIHKGFDIVNDKG
                                     GKT                 ILIDLDLR               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSTILIKKHLYKDCIKKSRFENLEFITAGPIPPNPSELIISKEMDEFLSELHNEYDFIIIDTPPIGIVSDGISIFKKAAF
VSTILIKKHLYKDCIKKSRFENLEFITAGPIPPNPSELIISKEMDEFLSELHNEYDFIIIDTPPIGIVSDGISIFKKAAF
                                                         IIIDTPP                
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PIYVTRANYSRRNYINNINHLIDDKNITKISVVLNGLDTRQTKYGYGYGYGYGGYGAYGEYGYGYFEEEFKPKLPWYKKI
PIYVTRANYSRRNYINNINHLIDDKNITKISVVLNGLDTRQTKYGYGYGYGYGGYGAYGEY                   
                                           YGYGYGYGYGGYGAYGEYGYGY               
         
....:....
IKRILFFIK


© 1998-2021Legal notice