BYKdb

Annotate results for A0A1F3KLL5

A0A1F3KLL5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F3KLL5
DOMAINtad13/254DKFDLPIFLMIIRKSIWWIVIIFILALFSAFAFLRYTPPIYQSNSILQINEQNQTAEILG
FKNNFIKPSELPAVMELIRSNEFLKRVFVKLPFEISYFSQGTFLSTETYRTSSYIIEVRN
VEPEMYNNQIYISFLNKNSFTLEYYINGVKSHYSLKPDRWNKINKTEIKININNIDDLLA
DKQNLKQNSFYFIINNPTYLLQAYKANLLVEVLSDEAKTISIKYSDYNAQKTTDIVNVIA
EE
DOMAINcd597/786SSTVSGEGKTFVAINLGGIIAISGKRVILMDLDLRKPKVHMGFNTDNSRGVSTILINKHT
IEECLKFAPIENFHYITAGPIPPNPSELILSQNMDNLVETLKRTYDVVIIDTPPIGIVTD
AIVNFMRADYPIYVMKSNFSKRTFINNINHLITEKNITKLSVVLNSLDTSTFKYGYGYGY
GYGYGYGYGY
SITEWalker A604/606GKT
SITEWalker A'624/631ILMDLDLR
SITEWalker B704/710VIIDTPP
SITE-726/-729YPIY
SITEY Cluster770/794YGYGYGYGYGYGYGYGYGSGYGSGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKQQQRLIPVINDKFDLPIFLMIIRKSIWWIVIIFILALFSAFAFLRYTPPIYQSNSILQINEQNQTAEILGFKNNFIKP
            DKFDLPIFLMIIRKSIWWIVIIFILALFSAFAFLRYTPPIYQSNSILQINEQNQTAEILGFKNNFIKP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SELPAVMELIRSNEFLKRVFVKLPFEISYFSQGTFLSTETYRTSSYIIEVRNVEPEMYNNQIYISFLNKNSFTLEYYING
SELPAVMELIRSNEFLKRVFVKLPFEISYFSQGTFLSTETYRTSSYIIEVRNVEPEMYNNQIYISFLNKNSFTLEYYING

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKSHYSLKPDRWNKINKTEIKININNIDDLLADKQNLKQNSFYFIINNPTYLLQAYKANLLVEVLSDEAKTISIKYSDYN
VKSHYSLKPDRWNKINKTEIKININNIDDLLADKQNLKQNSFYFIINNPTYLLQAYKANLLVEVLSDEAKTISIKYSDYN

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQKTTDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDENEKKIHDFKKSNIDSALQNKLSPLPLFTAKINE
AQKTTDIVNVIAEE                                                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQSEILKTDFELATLKRIEKQLSAGENLKYYDLYSLLSGTKSENVVSRLLEEINKLENDREQMLSDVTANNYKIKVIDKQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVTKKGILVEFVKTTIIRLNDSKNDYLLKIKEFEARLMSKSPSNGKDLEYAKLSRLYSIQEGFYNKLIERKAEYLISSAG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVSNNTILQRSDTPKVPVYPRANIILLVFTLAAFIISLIITLGRYLFFNEITAVGDITAYTDANVIGVIPKYKKHVPVSQ


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLVDKSPKSRLSEAFRNIRSNLQFISNEEGPKVITISSTVSGEGKTFVAINLGGIIAISGKRVILMDLDLRKPKVHMGFN
                                    SSTVSGEGKTFVAINLGGIIAISGKRVILMDLDLRKPKVHMGFN
                                           GKT                 ILMDLDLR         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDNSRGVSTILINKHTIEECLKFAPIENFHYITAGPIPPNPSELILSQNMDNLVETLKRTYDVVIIDTPPIGIVTDAIVN
TDNSRGVSTILINKHTIEECLKFAPIENFHYITAGPIPPNPSELILSQNMDNLVETLKRTYDVVIIDTPPIGIVTDAIVN
                                                               VIIDTPP          
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FMRADYPIYVMKSNFSKRTFINNINHLITEKNITKLSVVLNSLDTSTFKYGYGYGYGYGYGYGYGYGSGYGSGYGYGYGK
FMRADYPIYVMKSNFSKRTFINNINHLITEKNITKLSVVLNSLDTSTFKYGYGYGYGYGYGYGYGY              
                                                 YGYGYGYGYGYGYGYGYGSGYGSGY      
       810       820       830   
....:....|....:....|....:....|...
YGSGYYDDEPKKEKKSILKRFLNLFQREKIDNG


© 1998-2021Legal notice