BYKdb

Annotate results for A0A1F3K4G0

A0A1F3K4G0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F3K4G0
DOMAINtad11/251DKFDLAIFLQIVRKNYWAPILFVAVSFVASFLYLRYTQPVYQTQSIIQINETNNTTKVLK
IEDVYQDNDILKVIELLRSKEFLKRTFLKLPIQISYFSEGTFLSTELYRRSPFQIEWKMI
TGKLYDIPVYIEFDGSEKALIYYGDGGVNASYPIEIGKWSAIRADSIRCTVSDYLTIESQ
KENYKGNRFYFVISNPKNIVENHLQNLDIFLLNRSAQTIQISYSGYNAEKASDIVNTIAE
E
DOMAINcd594/782SSTISGEGKTFVAINLAGILAISGKKVIVLDLDLRKPRIHLGFNTSNNKGISTLLIGKNI
LDECIQKSDLSNFDYITAGPVPPNPSELSAGKQMETLLAELEERYDIIIIDTPPVGIVTD
ALSNLQRANYPIYVMKANVSKRHFIDNINNLVKSKNMDNLSIILNGVELHQRSYGSHGYG
YGYGYGYGY
SITEWalker A601/603GKT
SITEWalker A'621/628IVLDLDLR
SITEWalker B701/707IIIDTPP
SITE-723/-726YPIY
SITEY Cluster767/783YGSHGYGYGYGYGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MYQGKIPIINDKFDLAIFLQIVRKNYWAPILFVAVSFVASFLYLRYTQPVYQTQSIIQINETNNTTKVLKIEDVYQDNDI
          DKFDLAIFLQIVRKNYWAPILFVAVSFVASFLYLRYTQPVYQTQSIIQINETNNTTKVLKIEDVYQDNDI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKVIELLRSKEFLKRTFLKLPIQISYFSEGTFLSTELYRRSPFQIEWKMITGKLYDIPVYIEFDGSEKALIYYGDGGVNA
LKVIELLRSKEFLKRTFLKLPIQISYFSEGTFLSTELYRRSPFQIEWKMITGKLYDIPVYIEFDGSEKALIYYGDGGVNA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SYPIEIGKWSAIRADSIRCTVSDYLTIESQKENYKGNRFYFVISNPKNIVENHLQNLDIFLLNRSAQTIQISYSGYNAEK
SYPIEIGKWSAIRADSIRCTVSDYLTIESQKENYKGNRFYFVISNPKNIVENHLQNLDIFLLNRSAQTIQISYSGYNAEK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFKRENKINTDQFKAEGSPFPLFTTKISEL
ASDIVNTIAEE                                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EDELINIDFELVALQRINQQVANDHDLNIYELIATLSGTKSETIVVNVLNNLQELINKKEQLLNDITRDNLKIKLLEKQI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNQKDLLLEFVNSTIVRMETKKGDYQKKIAEYESKIFNDQNFDELEYSKLERLYTINEGFYHKLIEKKAEYLISQAGYVS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QNTILEVGNVPVEPISPISKKIYPVFILIGLFAGVGYIILRYLLYDEVTSIATIQNFTDAPILGTVPIYKKEIPVSQLLV


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKHPNSIFSEAFRTIRSNLQFISHGAETKIITVSSTISGEGKTFVAINLAGILAISGKKVIVLDLDLRKPRIHLGFNTSN
                                 SSTISGEGKTFVAINLAGILAISGKKVIVLDLDLRKPRIHLGFNTSN
                                        GKT                 IVLDLDLR            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKGISTLLIGKNILDECIQKSDLSNFDYITAGPVPPNPSELSAGKQMETLLAELEERYDIIIIDTPPVGIVTDALSNLQR
NKGISTLLIGKNILDECIQKSDLSNFDYITAGPVPPNPSELSAGKQMETLLAELEERYDIIIIDTPPVGIVTDALSNLQR
                                                            IIIDTPP             
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANYPIYVMKANVSKRHFIDNINNLVKSKNMDNLSIILNGVELHQRSYGSHGYGYGYGYGYGYYTEDDETTIGKKLTRKLQ
ANYPIYVMKANVSKRHFIDNINNLVKSKNMDNLSIILNGVELHQRSYGSHGYGYGYGYGYGY                  
                                              YGSHGYGYGYGYGYGYY                 
    
....
KLKQ


© 1998-2021Legal notice