BYKdb

Annotate results for A0A1F3IU95

A0A1F3IU95 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F3IU95
DOMAINtad11/247DEFDFKLFLNITRKSLIYIIVFSALLFTAVYVYLRYTQPVYESACIVQINTDDKAEKLFD
NKTYYEDDIYRKIEIMRSPVFMQRVVSNLPLGVSVFAKGNILNFELYDDVPFDIKYEIVD
STFYGVPLLIEVHDTGFVITEINGIQTDKSFRFHEPVSLPQVNFVLTPINNDAHAFFKSN
RNKQFIVQFNNLTDIAAQYSQQVNIAVINDVAKTIRISLKDYNPRKAADVVNSVAKE
DOMAINcd582/775SSTVSGEGKTFVAINFAGVLAFNNKNVIVLDFDLRKPKIHLGFNTDNEKGISSILLKINT
VEECIKQSSIPNLHFITAGPTPINPSELILTNETDELLTFLKTKYDYIIMDTPPIGLVSD
AMKPLQYADYPIYVVRANYSKRSYIYNIEKLYHENNLRFMSIILNNVDPEITGAGSSMGF
AYGYGYGYGYNNSK
SITEWalker A589/591GKT
SITEWalker A'609/616IVLDFDLR
SITEWalker B689/695IIMDTPP
SITE-686/-725YDYIIMDTPPIGLVSDAMKPLQYADYPIYVVRANYSKRSY
SITEY Cluster725/779YIYNIEKLYHENNLRFMSIILNNVDPEITGAGSSMGFAYGYGYGYGYNNSKHGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTDSRKIKFNDEFDFKLFLNITRKSLIYIIVFSALLFTAVYVYLRYTQPVYESACIVQINTDDKAEKLFDNKTYYEDDIY
          DEFDFKLFLNITRKSLIYIIVFSALLFTAVYVYLRYTQPVYESACIVQINTDDKAEKLFDNKTYYEDDIY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKIEIMRSPVFMQRVVSNLPLGVSVFAKGNILNFELYDDVPFDIKYEIVDSTFYGVPLLIEVHDTGFVITEINGIQTDKS
RKIEIMRSPVFMQRVVSNLPLGVSVFAKGNILNFELYDDVPFDIKYEIVDSTFYGVPLLIEVHDTGFVITEINGIQTDKS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FRFHEPVSLPQVNFVLTPINNDAHAFFKSNRNKQFIVQFNNLTDIAAQYSQQVNIAVINDVAKTIRISLKDYNPRKAADV
FRFHEPVSLPQVNFVLTPINNDAHAFFKSNRNKQFIVQFNNLTDIAAQYSQQVNIAVINDVAKTIRISLKDYNPRKAADV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQTKDSLQQSSAPSVDSSLDRTALQSRLFELDNLISENSSEV
VNSVAKE                                                                         

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESLEIFYKAFSSGNADIITLLPLISGIESQVYLSPYLQSLKDLEMRKQELLLRVTENSTAIESINAQIEFQNKIIRESTI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLLTKYKRQYQRYVAEKNNILRMLGKPVIGTMDDQSRIERYYSVNEKFYNQLIEKKIEHSIAQAGYVSQLIVLQPAQSNF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APVSPNNKLIWIGAFVFAMVLSFAFLILRYILYNEVVSLRDVKKLTTVPVLGVIPKYKSFIPVSQLIVDTRPRSLLAEAL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAIRTNLQFIKNITQAKVIAISSTVSGEGKTFVAINFAGVLAFNNKNVIVLDFDLRKPKIHLGFNTDNEKGISSILLKIN
                     SSTVSGEGKTFVAINFAGVLAFNNKNVIVLDFDLRKPKIHLGFNTDNEKGISSILLKIN
                            GKT                 IVLDFDLR                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVEECIKQSSIPNLHFITAGPTPINPSELILTNETDELLTFLKTKYDYIIMDTPPIGLVSDAMKPLQYADYPIYVVRANY
TVEECIKQSSIPNLHFITAGPTPINPSELILTNETDELLTFLKTKYDYIIMDTPPIGLVSDAMKPLQYADYPIYVVRANY
                                                IIMDTPP                         
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKRSYIYNIEKLYHENNLRFMSIILNNVDPEITGAGSSMGFAYGYGYGYGYNNSKHGYYDSEDIVKKSWKDRIFEKFRRK
SKRSYIYNIEKLYHENNLRFMSIILNNVDPEITGAGSSMGFAYGYGYGYGYNNSK                         
    YIYNIEKLYHENNLRFMSIILNNVDPEITGAGSSMGFAYGYGYGYGYNNSKHGYY                     
       
....:..
DDGSSNV


© 1998-2021Legal notice