BYKdb

Annotate results for A0A1F3FZ62

A0A1F3FZ62 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F3FZ62
DOMAINtad10/248TEFDLGLLFKIIQKTILPIFILFIISSTIAFLYLRYTHPVFEASSVIQLSSSNSANKVLQ
TANIYDGENDISKTVELLKSKVFLKRVFSKLNFEVSYYIKGRILNFDVYRNTPFIIEQKV
FNPSIYGINFDIEFKGNNKYILRYLLNEKLNIREFYFNETVKLPEMEFVLKLNPKSSIKT
DLNADEYYFIINNPDLIVNEHINQIDVSILNVLAQTVLINVTNQNATKSADIANAIADE
DOMAINcd595/783TSTVSGEGKTFIAINLAGIMAMSDKRVIIIDLDMRKPKIHLGFGIDNTKGMSTILIGKDT
VEDCIKRSDLANLDIIPAGPPPPNPSELIISKKMDDLIELLKFKYDIVVIDNPPVGVVTD
GIASIIKADYPIYVFKSNYSKKMFILNVEKIVSDYNIQNIGIVLNNVEISRPKYGYGYGR
YRYGSNYTN
SITEWalker A602/604GKT
SITEWalker A'622/629IIIDLDMR
SITEWalker B702/708VVIDNPP
SITE-724/-733YPIYVFKSNY
SITEY Cluster768/792YGYGYGRYRYGSNYTNYGSSYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAAKISQINTEFDLGLLFKIIQKTILPIFILFIISSTIAFLYLRYTHPVFEASSVIQLSSSNSANKVLQTANIYDGENDI
         TEFDLGLLFKIIQKTILPIFILFIISSTIAFLYLRYTHPVFEASSVIQLSSSNSANKVLQTANIYDGENDI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKTVELLKSKVFLKRVFSKLNFEVSYYIKGRILNFDVYRNTPFIIEQKVFNPSIYGINFDIEFKGNNKYILRYLLNEKLN
SKTVELLKSKVFLKRVFSKLNFEVSYYIKGRILNFDVYRNTPFIIEQKVFNPSIYGINFDIEFKGNNKYILRYLLNEKLN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IREFYFNETVKLPEMEFVLKLNPKSSIKTDLNADEYYFIINNPDLIVNEHINQIDVSILNVLAQTVLINVTNQNATKSAD
IREFYFNETVKLPEMEFVLKLNPKSSIKTDLNADEYYFIINNPDLIVNEHINQIDVSILNVLAQTVLINVTNQNATKSAD

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKTESDLDMFKRMNKIPDRLTDMKSPPTYFSRVNDLQSQLL
IANAIADE                                                                        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NIEVEEKMLEELEKNFSSIKDLDVYKLIAFISGTEVNKIVKGNLDAIQSILLQKEKMLYEITPDNRQINALEYQLGIQKK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IMFETLKSYKSNMKKRKSQLDDMLDKYTRLDSEVDTSRGLRRYDVIEYSKLQRMYSINENFYNQLIQKKAEYSISKAGYV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQNTIFEYAITPSSPIAPSKKQVLLISFVIAFIISMAFVVVRYLLHNNIIAMIDIVKYTKIPILGIVPKYKKEIPISQLL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDKRPKSLIAESLRTIRTNLQFISNEPGPKVVAITSTVSGEGKTFIAINLAGIMAMSDKRVIIIDLDMRKPKIHLGFGID
                                  TSTVSGEGKTFIAINLAGIMAMSDKRVIIIDLDMRKPKIHLGFGID
                                         GKT                 IIIDLDMR           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTKGMSTILIGKDTVEDCIKRSDLANLDIIPAGPPPPNPSELIISKKMDDLIELLKFKYDIVVIDNPPVGVVTDGIASII
NTKGMSTILIGKDTVEDCIKRSDLANLDIIPAGPPPPNPSELIISKKMDDLIELLKFKYDIVVIDNPPVGVVTDGIASII
                                                             VVIDNPP            
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KADYPIYVFKSNYSKKMFILNVEKIVSDYNIQNIGIVLNNVEISRPKYGYGYGRYRYGSNYTNYGSSYGYGYGYGYGYGY
KADYPIYVFKSNYSKKMFILNVEKIVSDYNIQNIGIVLNNVEISRPKYGYGYGRYRYGSNYTN                 
                                               YGYGYGRYRYGSNYTNYGSSYGYGY        
       810       820       830     
....:....|....:....|....:....|....:
GYGYGYGYYEDDAKEDDRTIMQRIKDLFKKKDKKK


© 1998-2021Legal notice