BYKdb

Annotate results for A0A1F3D6P8

A0A1F3D6P8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F3D6P8
DOMAINcd604/787TSSQPKDGKSFISFNLAASIAIVGYKTIIIDCDLRKPTLHEKFKEDNSSGISNFMVKNAT
VTEIIRNTSVENLSFIPAGPLLPNPSELIESGVLDELMNFLKKEYDYIIVDTSPVGLVAD
ATQLIRYATHILLVTRINYTRKDILEHVLKNFSSNRITNYDAVLNSLPLDTSPYRHYTSY
YLKK
SITEWalker A611/613GKS
SITEWalker A'631/638IIIDCDLR
SITEWalker B711/717IIVDTSP
SITE-708/-710YDY
SITEY Cluster777/784YRHYTSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTKETDSGIALIKHYLQDIAYFKYFYIICLVILLTVAFLFNKYSSRLYEVKASIGPVQNDASSLLTSNDLFMGLKALQSN


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNLESGISNFISFPTVSSTISSMNLEIGYFREKHHLFRQVSELYLRSPYVVIMDKSHIQPIDVKLRVFILSDTTFRLVID


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QNTVSLYNYLDNQIVIENVPLKVDTICRFNETIRGKTFKFSVSFNRDFYTRETNMEDFYYFSFFHLDYLTKDYLKKLEVE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PISPKTSLIILKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEISDSLVISESKLRNYRSANQVMD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSFQGKSLYEKLEQIETERANLQIQERYYNYIINNFKSSNDMSGVVPPSAMNVADPIMNQLITQLLLLYSQRSGIASNNA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKNLFLGQIDNKIKVQKQAIIETVTNNLNTLNLSLNELNYRADKLSREISQLPRTELNMVGLQRKFDLSDVIYTYLLQKR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEAAITMASNYPDFEVIEPAREFTKKIIVPRPKLSYLLAIFFGLAIPTTFIFIRNFFNNKISSIYDLESLINQSGMGVIF


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNNYKSEAVVLEAPKSAIAESFRNLRSSLFLKLKSEKSKVIVITSSQPKDGKSFISFNLAASIAIVGYKTIIIDCDLRKP
                                           TSSQPKDGKSFISFNLAASIAIVGYKTIIIDCDLRKP
                                                  GKS                 IIIDCDLR  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLHEKFKEDNSSGISNFMVKNATVTEIIRNTSVENLSFIPAGPLLPNPSELIESGVLDELMNFLKKEYDYIIVDTSPVGL
TLHEKFKEDNSSGISNFMVKNATVTEIIRNTSVENLSFIPAGPLLPNPSELIESGVLDELMNFLKKEYDYIIVDTSPVGL
                                                                      IIVDTSP   
       730       740       750       760       770       780       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
VADATQLIRYATHILLVTRINYTRKDILEHVLKNFSSNRITNYDAVLNSLPLDTSPYRHYTSYYLKK
VADATQLIRYATHILLVTRINYTRKDILEHVLKNFSSNRITNYDAVLNSLPLDTSPYRHYTSYYLKK
                                                        YRHYTSYY   

© 1998-2021Legal notice