BYKdb

Annotate results for A0A1F3AZM3

A0A1F3AZM3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F3AZM3
DOMAINcd350/539TSAGPGEGKTTIAVNLAAIMAQGGKRVVLVDADLRRPKIHRFLGLSNKVGLSDLFRGVVA
VRMVSQQVQDVETVSVLTSGSLPPNPTELLASVRMEQILQEAEQDADIVIIDSPPSLVAD
VQVLAGKVDGVILIIHPGHTQEDASLATLEMLNRAGARTLGVVLNRIPRGRSDYYGGYRH
YSPYYSGYHY
SITEWalker A357/359GKT
SITEWalker A'377/384VLVDADLR
SITEWalker B458/464VIIDSPP
SITEY Cluster523/540YYGGYRHYSPYYSGYHYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YYAYLDSQQLLQTYIQLLTTEKVLNAASEKLGYPVYAGQASAQQVPDTQFVRLTVTNTDPQRAADIANVLVMVLIDQNEE


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQAVRYLTSEQNLQSQIDQVQSQITTMQTQINDISEATVQDQLVQVKAQIEPLQTQVTTLETEIADLQKNRYPTEEENAQ


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAEKEATLAQVKPILTLYQQLYTNLVVLGQPVDTGTNTSTRLQQLQTTLSLYQGIYVNLLNSLENVRFARVQNTPNVVQV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPAVASTSPISPRPFQSTALAAAVGLMLAAGIAFLIEYLDDTLKTMEDIERVMQLPVVGYIAEIQYESGSDESLYVTRQP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSPVSEAFRLLRTNLEFAGVDRPIRRLLVTSAGPGEGKTTIAVNLAAIMAQGGKRVVLVDADLRRPKIHRFLGLSNKVGL
                             TSAGPGEGKTTIAVNLAAIMAQGGKRVVLVDADLRRPKIHRFLGLSNKVGL
                                    GKT                 VLVDADLR                
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDLFRGVVAVRMVSQQVQDVETVSVLTSGSLPPNPTELLASVRMEQILQEAEQDADIVIIDSPPSLVADVQVLAGKVDGV
SDLFRGVVAVRMVSQQVQDVETVSVLTSGSLPPNPTELLASVRMEQILQEAEQDADIVIIDSPPSLVADVQVLAGKVDGV
                                                         VIIDSPP                
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILIIHPGHTQEDASLATLEMLNRAGARTLGVVLNRIPRGRSDYYGGYRHYSPYYSGYHYYHSMDGQDLKPSRMRRLFGKL
ILIIHPGHTQEDASLATLEMLNRAGARTLGVVLNRIPRGRSDYYGGYRHYSPYYSGYHY                     
                                          YYGGYRHYSPYYSGYHYY                    
       570       580    
....:....|....:....|....
SPFNHNGHKKVEAGVVEENVIEKP


© 1998-2021Legal notice