BYKdb

Annotate results for A0A1F2YJ88

A0A1F2YJ88 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F2YJ88
DOMAINtad1/86VILTGKTNQANTLRTADGLWNISIYTQDQLNDVYLIQKQSLPSAVNNILANYSVAEKGKL
TGILGLNYQGTDKTHITQVLNAILVS
DOMAINcd362/549SGPAPEVGKSFISTNLATILAQSDKRVLIIDADLRRGYLHKYFNLDTQPGLTELLNGQQS
LDTVIRPTEVPGLSVISRGKSPANPSELLSSNQFKNLLEQMSEKFDHVIIDTPPVLAVTD
GIIISQYTGVNLVIARYAKTQMKELELTLNRFEQAGVKVNGFILNDIQRSSAGYGYGYNY
AYAYKANK
SITEWalker A369/371GKS
SITEWalker A'389/396LIIDADLR
SITEWalker B469/475VIIDTPP
SITE-399/-403YLHKY
SITE-440/-442GKS
SITEY Cluster535/545YGYGYNYAYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VILTGKTNQANTLRTADGLWNISIYTQDQLNDVYLIQKQSLPSAVNNILANYSVAEKGKLTGILGLNYQGTDKTHITQVL
VILTGKTNQANTLRTADGLWNISIYTQDQLNDVYLIQKQSLPSAVNNILANYSVAEKGKLTGILGLNYQGTDKTHITQVL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAILVSYSQQNIERRSAETAQTLKFLDEQLPELKQQLDVAEREFNKFRQQYNTVDVTKESELFLTQSVTLETQKAQLEQQ
NAILVS                                                                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAEAGAKYTAEHPVMQQMNAQLGAINKKIGELNSTLKELPDLQRRYLQLYREVEVKQQLYTALLNSYQQLRIAKAGEIGN


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRIVDTAIEPVEPIKPKKLQVLILSLFLGGFLGTLLALLRNMMRSGIKDSTQIENELDLPVYATVPRSPVQESRINILKK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKNIPILAVKNSDDIAIESLRSMRTAIHFALSSARNNLITISGPAPEVGKSFISTNLATILAQSDKRVLIIDADLRRGYL
                                         SGPAPEVGKSFISTNLATILAQSDKRVLIIDADLRRGYL
                                                GKS                 LIIDADLR    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKYFNLDTQPGLTELLNGQQSLDTVIRPTEVPGLSVISRGKSPANPSELLSSNQFKNLLEQMSEKFDHVIIDTPPVLAVT
HKYFNLDTQPGLTELLNGQQSLDTVIRPTEVPGLSVISRGKSPANPSELLSSNQFKNLLEQMSEKFDHVIIDTPPVLAVT
                                                                    VIIDTPP     
       490       500       510       520       530       540       550  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
DGIIISQYTGVNLVIARYAKTQMKELELTLNRFEQAGVKVNGFILNDIQRSSAGYGYGYNYAYAYKANKESD
DGIIISQYTGVNLVIARYAKTQMKELELTLNRFEQAGVKVNGFILNDIQRSSAGYGYGYNYAYAYKANK   
                                                      YGYGYNYAYAY       
© 1998-2021Legal notice