BYKdb

Annotate results for A0A1F2YCV8

A0A1F2YCV8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F2YCV8
DOMAINcd46/235TSTVKGEGKTSTCANIAIVYAQTNKKVLVIDADMRNPQCQYVFSASNLSGLSNYLARESN
LEACIVKTHLPNIHLLPAGSIPPNPAELLTSEYFEALISAVRALYDMVIIDTPPVLPVAD
AVIISQQVDGVLFVLDSQTTNRFLAERAMNIVRKSQTPILGVILNRLPKRDERYAYDSYY
PGPGSGSIKS
SITEWalker A53/55GKT
SITEWalker A'73/80LVIDADMR
SITEWalker B153/159VIIDTPP
SITEY Cluster219/225YAYDSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPKKMNRTHLITHLLPQSPVSEAYRLLRTNIDFASFNQTRKVLVVTSTVKGEGKTSTCANIAIVYAQTNKKVLVIDADMR
                                             TSTVKGEGKTSTCANIAIVYAQTNKKVLVIDADMR
                                                    GKT                 LVIDADMR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPQCQYVFSASNLSGLSNYLARESNLEACIVKTHLPNIHLLPAGSIPPNPAELLTSEYFEALISAVRALYDMVIIDTPPV
NPQCQYVFSASNLSGLSNYLARESNLEACIVKTHLPNIHLLPAGSIPPNPAELLTSEYFEALISAVRALYDMVIIDTPPV
                                                                        VIIDTPP 
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
LPVADAVIISQQVDGVLFVLDSQTTNRFLAERAMNIVRKSQTPILGVILNRLPKRDERYAYDSYYPGPGSGSIKSGNEV
LPVADAVIISQQVDGVLFVLDSQTTNRFLAERAMNIVRKSQTPILGVILNRLPKRDERYAYDSYYPGPGSGSIKS    
                                                          YAYDSYY              
© 1998-2021Legal notice