BYKdb

Annotate results for A0A1F2V330

A0A1F2V330 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F2V330
DOMAINtad8/152KEISVLALLDIVMRRKLFVLIPAAVLIVAVGIYTVYQPPLYRAQALLGVEPGARNYVQTM
DGSVARVQDQLLTIREVLFSRPVLEPVMRNFHLLPMPDGKISDTDLDRMRESIKITVEGS
DSFHLAFEGRGRTQVMNVTNDLSER
DOMAINcd545/728SSVVGGEGKTVTSLNLSLALAGTVSGRVLLIDSDLRKPRVHEYLGLKPGKGFSDLLRAPE
DEIGKYVSKLGDLYIMPGGSSLANPVSLLASQSVRSVFERLRGEFDFIVVDTPPVLPIVD
THILAGLVDGVILVVRARYTRREVLERGLESFQATKLLGAVVNDVDYQRSRYAYAYQYQA
GLPV
SITEWalker A552/554GKT
SITEWalker A'573/580LLIDSDLR
SITEWalker B652/658IVVDTPP
SITEY Cluster711/722YQRSRYAYAYQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPSDGTGKEISVLALLDIVMRRKLFVLIPAAVLIVAVGIYTVYQPPLYRAQALLGVEPGARNYVQTMDGSVARVQDQLLT
       KEISVLALLDIVMRRKLFVLIPAAVLIVAVGIYTVYQPPLYRAQALLGVEPGARNYVQTMDGSVARVQDQLLT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IREVLFSRPVLEPVMRNFHLLPMPDGKISDTDLDRMRESIKITVEGSDSFHLAFEGRGRTQVMNVTNDLSERFIRRLANM
IREVLFSRPVLEPVMRNFHLLPMPDGKISDTDLDRMRESIKITVEGSDSFHLAFEGRGRTQVMNVTNDLSER        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REQQVNEGAGLLNAELETLRSQLNEQEERLKIYKESAVNELPDRLATNLSLFAATQAQLRSSSGLKANDQARLAAVQQEI


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TELEKEGVLDAAPPKEKTPAETNLEERRLHLKQLRSVFTEQYPEVVSTEREIKELEKAVAAAPPKPTVAEPSAARMHYVQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IRAEKESLEQRLTSYGQEERALESEMGRLQRRVQSTPQHEIAITELTRGYEATKTRYNALLAKQQEAGLASRPERMNKTV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFRIVEPASLPKGPSTPRRSRLLLVGLFVGLALGLAVAFVAEQMDTTFGNIVEFQTFTNLPAIAVLPSMSADLDPGVKPL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGTIPLIPPCGGDLSPTLLAFADLHRNHIVMVTDPHSVASEQCRMLALKTRQQLSGVRSPLLAISSVVGGEGKTVTSLNL
                                                                SSVVGGEGKTVTSLNL
                                                                       GKT      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLALAGTVSGRVLLIDSDLRKPRVHEYLGLKPGKGFSDLLRAPEDEIGKYVSKLGDLYIMPGGSSLANPVSLLASQSVRS
SLALAGTVSGRVLLIDSDLRKPRVHEYLGLKPGKGFSDLLRAPEDEIGKYVSKLGDLYIMPGGSSLANPVSLLASQSVRS
            LLIDSDLR                                                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VFERLRGEFDFIVVDTPPVLPIVDTHILAGLVDGVILVVRARYTRREVLERGLESFQATKLLGAVVNDVDYQRSRYAYAY
VFERLRGEFDFIVVDTPPVLPIVDTHILAGLVDGVILVVRARYTRREVLERGLESFQATKLLGAVVNDVDYQRSRYAYAY
           IVVDTPP                                                    YQRSRYAYAY
        
....:...
QYQAGLPV
QYQAGLPV
QY      

© 1998-2021Legal notice