BYKdb

Annotate results for A0A1F2UPP7

A0A1F2UPP7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F2UPP7
DOMAINtad3/143EQIEIVQFLKIIAKRKGIVIIGTVLCVLLAMIATMYMTPQYNATAKILVAQAQAPVNNQS
SSESYQAVLLGQQLAKTFSEIMVSRTLAERVIARLELPLLPDDLMKKVKAQPIRDTQLIV
LKVTDTNPKRAKDIVNAYVEE
DOMAINcd266/454ASPETGDGKTTVASNLAIVFAQAGQNVLLVDCDLRRPSISQVFHLPDARGLSNVLIGAAD
ADSVILSSGVDGLSVITSGPIPPNPADLLNSERMDELLARFEGRFDIVILDCPPVLALSD
TVILASKADAVLMVSSFGKSKKADMLAARNALTKVGARILGFVINGARTSKQNGYYNQPY
TSRQALRDA
SITE-403/-405GKS
SITEWalker A'293/300LLVDCDLR
SITEWalker B373/379VILDCPP
SITEY Cluster440/445YYNQPY
SITEWalker A273/275GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEEQIEIVQFLKIIAKRKGIVIIGTVLCVLLAMIATMYMTPQYNATAKILVAQAQAPVNNQSSSESYQAVLLGQQLAKTF
  EQIEIVQFLKIIAKRKGIVIIGTVLCVLLAMIATMYMTPQYNATAKILVAQAQAPVNNQSSSESYQAVLLGQQLAKTF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEIMVSRTLAERVIARLELPLLPDDLMKKVKAQPIRDTQLIVLKVTDTNPKRAKDIVNAYVEEFIDFIPSTVPTTSQMKV
SEIMVSRTLAERVIARLELPLLPDDLMKKVKAQPIRDTQLIVLKVTDTNPKRAKDIVNAYVEE                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAIELAVVPLKPVTPKPLLNTVLALVLGLSMSVGFAFVLEKLDVTVKESDMLEQLLGITSLGLVSKSQQPLLLGDNNTDT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SESMRRIRTNLQYLNFDQSIRSFAVASPETGDGKTTVASNLAIVFAQAGQNVLLVDCDLRRPSISQVFHLPDARGLSNVL
                         ASPETGDGKTTVASNLAIVFAQAGQNVLLVDCDLRRPSISQVFHLPDARGLSNVL
                                GKT                 LLVDCDLR                    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IGAADADSVILSSGVDGLSVITSGPIPPNPADLLNSERMDELLARFEGRFDIVILDCPPVLALSDTVILASKADAVLMVS
IGAADADSVILSSGVDGLSVITSGPIPPNPADLLNSERMDELLARFEGRFDIVILDCPPVLALSDTVILASKADAVLMVS
                                                    VILDCPP                     
       410       420       430       440       450       460     
....:....|....:....|....:....|....:....|....:....|....:....|....:
SFGKSKKADMLAARNALTKVGARILGFVINGARTSKQNGYYNQPYTSRQALRDAPLNQPRDIRGV
SFGKSKKADMLAARNALTKVGARILGFVINGARTSKQNGYYNQPYTSRQALRDA           
                                       YYNQPY                    
© 1998-2021Legal notice