BYKdb

Annotate results for A0A1F2U158

A0A1F2U158 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F2U158
DOMAINtad32/221DKDVHILDRLAVVYRYKRIALSVFLLTALALMIQGYSGEQVFQAKAQVLIEDERSTAMPG
IAAADYYQDPIPYYNTQYRILRGRDLARRVVKRIDLQNVAEFNGTAKPAETPVTKARDAG
DRLLRFLARTPTPIAEVPKPDETADESALVSRFLGRVQVVPVAESKLVDVYFTSADPQFA
ATAANALADE
DOMAINcd559/747TSAQPLEGKTTTAANIAMALAYGGARVLLIDADMRRPGLHRSLRLTNDRGLSQILTGQAR
VRDVIQRTVDPNLLAITAGRTPANPSELLSSERMKTLITNLRHGPFDWIVIDTPPVLAVT
DAVILAPMVAGVTFVIGAEMTRRRLAERALETILASHPKMVGVVLNKVDFARNKYYYSRY
YGHQYKSYY
SITEWalker A566/568GKT
SITEWalker A'586/593LLIDADMR
SITEWalker B667/673IVIDTPP
SITEY Cluster733/747YYYSRYYGHQYKSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSESSPAHPTPASAPTSSGAPRAPQPLTYAVDKDVHILDRLAVVYRYKRIALSVFLLTALALMIQGYSGEQVFQAKAQVL
                               DKDVHILDRLAVVYRYKRIALSVFLLTALALMIQGYSGEQVFQAKAQVL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEDERSTAMPGIAAADYYQDPIPYYNTQYRILRGRDLARRVVKRIDLQNVAEFNGTAKPAETPVTKARDAGDRLLRFLAR
IEDERSTAMPGIAAADYYQDPIPYYNTQYRILRGRDLARRVVKRIDLQNVAEFNGTAKPAETPVTKARDAGDRLLRFLAR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPTPIAEVPKPDETADESALVSRFLGRVQVVPVAESKLVDVYFTSADPQFAATAANALADEYVASNLEVKMQGTQSMLDW
TPTPIAEVPKPDETADESALVSRFLGRVQVVPVAESKLVDVYFTSADPQFAATAANALADE                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEKEVATQQSKVEQSERDLAEYRDRENAMSLDEKNNIVLSRLNALNDAVLRARTTRIEKESVNNQIKSLGTTPVDSIPAI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQNAQVQLHKAQLSELQRQKAQLSERYGEKHPDIINVNARLGDEQRQLDLETAKALQTVRNEYERAVLEERTFAANLEEA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKDVQDLGRKSVSYNVLEREARSNRTVYESLLQRENELRVSSNSRANNVRVVERAEVPAGPLTPTGRRTWLLSFAVGLVA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AISVAYGLDYMNDTIKTPEDVTRMLKMTFLGLIPSVRGDKHPVLASSHAPHDFSEAFRSLRTSIASRYPGEGAKTMIVTS
                                                                              TS

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQPLEGKTTTAANIAMALAYGGARVLLIDADMRRPGLHRSLRLTNDRGLSQILTGQARVRDVIQRTVDPNLLAITAGRTP
AQPLEGKTTTAANIAMALAYGGARVLLIDADMRRPGLHRSLRLTNDRGLSQILTGQARVRDVIQRTVDPNLLAITAGRTP
     GKT                 LLIDADMR                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANPSELLSSERMKTLITNLRHGPFDWIVIDTPPVLAVTDAVILAPMVAGVTFVIGAEMTRRRLAERALETILASHPKMVG
ANPSELLSSERMKTLITNLRHGPFDWIVIDTPPVLAVTDAVILAPMVAGVTFVIGAEMTRRRLAERALETILASHPKMVG
                          IVIDTPP                                               
       730       740       750 
....:....|....:....|....:....|.
VVLNKVDFARNKYYYSRYYGHQYKSYYARVG
VVLNKVDFARNKYYYSRYYGHQYKSYY    
            YYYSRYYGHQYKSYY    

© 1998-2021Legal notice