BYKdb

Annotate results for A0A1F2T595

A0A1F2T595 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F2T595
DOMAINtad60/244SELTLVHYLQILYRRRYAAITVFLATVVTVALFTFTATRVYEGSVRILIERDDPNVLSFQ
QVFEQSDGADDYYETQYRILQGRGLARRTIDALDLWRHPSLNQPPRLTIRGILFWPVGKL
ASWFEPARPPQAADAAETRTQTVVINRFLANLGVSAVRYSRLVDVSFRSADPGLAAKVAN
EHSKQ
DOMAINcd585/774TSSAPGEGKTVVSTNLSIALAEAGHRVLLLDADMRKPRVHEIFSRRVDPGLSNLLVGNAT
ASESIFESEIPGLWLMPAGTHPPNPAELIGSRRFRDFTAFLLQHFDWIIVDTPPVMVVTD
ATIAANFAHGVLFVVGAEMVSRRVAQRAVEQLELGQAKFVGAVLNRVDLEHNAYYYSRYY
RPDYGGYYGP
SITEWalker A592/594GKT
SITEWalker A'612/619LLLDADMR
SITEWalker B692/698IIVDTPP
SITEY Cluster758/772YYYSRYYRPDYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSTQIPPEFSQKAPASQGSGSESPVFNAVPSNGSGGSGYGSGSYGGYSGYGYGTSVTSDSELTLVHYLQILYRRRYAAIT
                                                           SELTLVHYLQILYRRRYAAIT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VFLATVVTVALFTFTATRVYEGSVRILIERDDPNVLSFQQVFEQSDGADDYYETQYRILQGRGLARRTIDALDLWRHPSL
VFLATVVTVALFTFTATRVYEGSVRILIERDDPNVLSFQQVFEQSDGADDYYETQYRILQGRGLARRTIDALDLWRHPSL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQPPRLTIRGILFWPVGKLASWFEPARPPQAADAAETRTQTVVINRFLANLGVSAVRYSRLVDVSFRSADPGLAAKVANE
NQPPRLTIRGILFWPVGKLASWFEPARPPQAADAAETRTQTVVINRFLANLGVSAVRYSRLVDVSFRSADPGLAAKVANE

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HSKQYIEQSLEFRTTTTREASDFLTQQLAEQRKKVEASERALQEYRERTDSVSLEERQNIVVQKLQELNAAVTRANTARI
HSKQ                                                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKEAVYNQVRTVLEDPAAMDTVPAILSNTFVQQQKAALADLQRQRAQMSEKLGPNHPEMVKINVALRGAETRLQNEIAQI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQAIRSEYEAALAEERSLSASLNQQKIEAQSLNRAGIEYGALERDATANRQMFEALLKRTQETGVTEELRTGNIRVVDPA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EMPTGPVSPNIINNLLLALFGGMVLAVGLAFTLEYADDRIKNPDELKKLLGLPFLGMIPALSGNRASPPLISEGVPGVFS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ECFRSIRTNVLFSSTDEGGRMIAVTSSAPGEGKTVVSTNLSIALAEAGHRVLLLDADMRKPRVHEIFSRRVDPGLSNLLV
                        TSSAPGEGKTVVSTNLSIALAEAGHRVLLLDADMRKPRVHEIFSRRVDPGLSNLLV
                               GKT                 LLLDADMR                     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GNATASESIFESEIPGLWLMPAGTHPPNPAELIGSRRFRDFTAFLLQHFDWIIVDTPPVMVVTDATIAANFAHGVLFVVG
GNATASESIFESEIPGLWLMPAGTHPPNPAELIGSRRFRDFTAFLLQHFDWIIVDTPPVMVVTDATIAANFAHGVLFVVG
                                                   IIVDTPP                      
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEMVSRRVAQRAVEQLELGQAKFVGAVLNRVDLEHNAYYYSRYYRPDYGGYYGPPGGGGGGGTVAEPVVARPAAASILGG
AEMVSRRVAQRAVEQLELGQAKFVGAVLNRVDLEHNAYYYSRYYRPDYGGYYGP                          
                                     YYYSRYYRPDYGGYY                            
       810       820       830       840      
....:....|....:....|....:....|....:....|....:.
AGAGARAARVAASAGTSFTRRTLASVFRSVQSGVRSAQNFRIERHL


© 1998-2021Legal notice