BYKdb

Annotate results for A0A1F2T1R8

A0A1F2T1R8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F2T1R8
DOMAINcd44/234TSPAAGDGKTVTAVNLAGALARGSDGRVLLIDADLRRPSVATLLGIETTGPGLADVLSGN
RDAAEVFRRIEPFNLSVLPAGATRAGVTEMLRSPRLEQLLQEARREYAYVVIDTPPLLPI
FDASVLAKLADGVLMIVAANQTPRKLLAEALNLLDPAKVLGIVFNQDDRPLFGYYNSYSR
YYREYFTDPTQ
SITEWalker A51/53GKT
SITEWalker A'72/79LLIDADLR
SITEWalker B153/159VVIDTPP
SITE-150/-152YAY
SITEY Cluster217/228YYNSYSRYYREY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPTLDRHLVSLTEPASFAAEQYQGLRLTIERVARARDVKIIAITSPAAGDGKTVTAVNLAGALARGSDGRVLLIDADLRR
                                           TSPAAGDGKTVTAVNLAGALARGSDGRVLLIDADLRR
                                                  GKT                  LLIDADLR 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSVATLLGIETTGPGLADVLSGNRDAAEVFRRIEPFNLSVLPAGATRAGVTEMLRSPRLEQLLQEARREYAYVVIDTPPL
PSVATLLGIETTGPGLADVLSGNRDAAEVFRRIEPFNLSVLPAGATRAGVTEMLRSPRLEQLLQEARREYAYVVIDTPPL
                                                                        VVIDTPP 
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
LPIFDASVLAKLADGVLMIVAANQTPRKLLAEALNLLDPAKVLGIVFNQDDRPLFGYYNSYSRYYREYFTDPTQIASGA
LPIFDASVLAKLADGVLMIVAANQTPRKLLAEALNLLDPAKVLGIVFNQDDRPLFGYYNSYSRYYREYFTDPTQ     
                                                        YYNSYSRYYREY           
© 1998-2021Legal notice