BYKdb

Annotate results for A0A1F2SVH2

A0A1F2SVH2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F2SVH2
DOMAINtad33/219TEVHLLDYVKVLYKRRWTALTAFLIVVLSVSVYTFTATPVFEARVQILIEKEATNVVTFK
EAYEQNQVTDDYYQTQYKILQSRALARRTLDALKLWDHPQFNPKPDDSLTMRKIALAPVV
LVAGWFKPAQPLEPPLPDESKVQSNTIDRFLRALTVAPVRNSRLVDVRFDSPDAAFSATV
ANALARA
DOMAINcd560/749TSTGPSEGKTVVATNLAVALAQAGQRVLLMDADMRKSRVHIVFDRSQGPGLSNVLVGNAK
ASEAVHKTAVPGLWVMPAGPHPPNPAELLGSKRFKDFMASLVEHFDWVMIDSPPVMAVTD
SSVIAHLATGVLFVVGAEMTSRHAAQRALEQLEQARAKSIGAVLNRVDLQHNSYYYSQYY
RREYSDYYQN
SITEWalker A567/569GKT
SITEWalker A'587/594LLMDADMR
SITEWalker B667/673VMIDSPP
SITEY Cluster733/747YYYSQYYRREYSDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSEESPRIAMAGEDARAQTSPVYGYGSNVLGDTEVHLLDYVKVLYKRRWTALTAFLIVVLSVSVYTFTATPVFEARVQIL
                                TEVHLLDYVKVLYKRRWTALTAFLIVVLSVSVYTFTATPVFEARVQIL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEKEATNVVTFKEAYEQNQVTDDYYQTQYKILQSRALARRTLDALKLWDHPQFNPKPDDSLTMRKIALAPVVLVAGWFKP
IEKEATNVVTFKEAYEQNQVTDDYYQTQYKILQSRALARRTLDALKLWDHPQFNPKPDDSLTMRKIALAPVVLVAGWFKP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQPLEPPLPDESKVQSNTIDRFLRALTVAPVRNSRLVDVRFDSPDAAFSATVANALARAYIEQHLEFKFLSSKEASDWLG
AQPLEPPLPDESKVQSNTIDRFLRALTVAPVRNSRLVDVRFDSPDAAFSATVANALARA                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERLAEQRKQVEASEQAVQRYREQTDSVSLEEKQNIVVQKLSELNAAVTRAKTERIEKEAAYNQIRTVQNDRATLDTIPAI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSNGFIQQQKNVLADLQRQQAQLSDKLGPNHPDMVRLSSAVREAESKIQGEIAKVVQAMRNDYRQTVAQEQSLMSALEQQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSEALSLNRKGIEYGVLARNAASNRQIFESLMQRTKETGISGELKTSNIRVVDAAETPRGPVRPNTRNNLLLALFGGATL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVGLAFFFEYLDNRIKSPDEIKQHLGLPFLGMVPALFDKALENPLISDGVPSNFSESFRNIRTNLLFSSADEGGRSVLIT
                                                                               T

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STGPSEGKTVVATNLAVALAQAGQRVLLMDADMRKSRVHIVFDRSQGPGLSNVLVGNAKASEAVHKTAVPGLWVMPAGPH
STGPSEGKTVVATNLAVALAQAGQRVLLMDADMRKSRVHIVFDRSQGPGLSNVLVGNAKASEAVHKTAVPGLWVMPAGPH
      GKT                 LLMDADMR                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPNPAELLGSKRFKDFMASLVEHFDWVMIDSPPVMAVTDSSVIAHLATGVLFVVGAEMTSRHAAQRALEQLEQARAKSIG
PPNPAELLGSKRFKDFMASLVEHFDWVMIDSPPVMAVTDSSVIAHLATGVLFVVGAEMTSRHAAQRALEQLEQARAKSIG
                          VMIDSPP                                               
       730       740       750     
....:....|....:....|....:....|....:
AVLNRVDLQHNSYYYSQYYRREYSDYYQNEGSART
AVLNRVDLQHNSYYYSQYYRREYSDYYQN      
            YYYSQYYRREYSDYY        

© 1998-2021Legal notice