BYKdb

Annotate results for A0A1F2S3Q7

A0A1F2S3Q7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F2S3Q7
DOMAINcd47/235SSPAAGDGKTVTAINLAGTLARGSDDRVLLVDADLRRPSVASLLAIPGGGLGLADALGSG
RGAADVVRTVDGCLLDVIPAGSPRAGISEILRSPRLDAFLQELRQRYAYIVLDTPPLLPV
FDAALIAKSVDGVLMVVSANRTPRKLLGEALNLLDASKVLGIVFNRDAHPLFGYYDAYCR
QYFPGVSRI
SITEWalker A54/56GKT
SITEWalker A'75/82LLVDADLR
SITEWalker B156/162IVLDTPP
SITE-153/-155YAY
SITEY Cluster220/228YYDAYCRQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHSMATRDTLLVSLTAPASFAAEQYQGLRLAVERLARARDVRTIAVSSPAAGDGKTVTAINLAGTLARGSDDRVLLVDAD
                                              SSPAAGDGKTVTAINLAGTLARGSDDRVLLVDAD
                                                     GKT                  LLVDAD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRRPSVASLLAIPGGGLGLADALGSGRGAADVVRTVDGCLLDVIPAGSPRAGISEILRSPRLDAFLQELRQRYAYIVLDT
LRRPSVASLLAIPGGGLGLADALGSGRGAADVVRTVDGCLLDVIPAGSPRAGISEILRSPRLDAFLQELRQRYAYIVLDT
LR                                                                         IVLDT
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
PPLLPVFDAALIAKSVDGVLMVVSANRTPRKLLGEALNLLDASKVLGIVFNRDAHPLFGYYDAYCRQYFPGVSRIAGQA
PPLLPVFDAALIAKSVDGVLMVVSANRTPRKLLGEALNLLDASKVLGIVFNRDAHPLFGYYDAYCRQYFPGVSRI    
PP                                                         YYDAYCRQY           
© 1998-2021Legal notice