BYKdb

Annotate results for A0A1F2S1W5

A0A1F2S1W5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F2S1W5
DOMAINtad55/239SELSFIHYLQVLYRRRYVAATAFLVVVLSVALYTFTAVRIYEGTVRILIERDDPNVVSFQ
EVLEQNEVTDDYYETQYRLLQGRGLARRTIDALNLWSHPQFTQPARPTVRSVIMMPVNAV
ARWFEPPRPVEPPDAAETRVQSRVINRFLAALDVSAVRYSRLVDVSFRSNDPALAARVSN
ALADQ
DOMAINcd580/769TSSAPGEGKTMVVTNLAVALAQAGHRVLLMDADMRKPRVHEVFGVPSSPGLSNLMVANAT
ASEVIQESSTPGLWVLSAGTHPPNPSELLGSKRFKEFAAFLMQYFDWVLLDTPPVMAVTD
ASIVANLSHGVLFVVGSEMTSRRVAQRAVEQLELGQAKFLGTVLNRVDLEHNSYYYSRYY
RPEYGGYYGP
SITEWalker A587/589GKT
SITEWalker A'607/614LLMDADMR
SITEWalker B687/693VLLDTPP
SITEY Cluster753/767YYYSRYYRPEYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVPSQFERKSPESSVLGLDAAPDAGLAPQPSAATGGSGYGYGYGYSGSMPSGDSELSFIHYLQVLYRRRYVAATAFLVV
                                                      SELSFIHYLQVLYRRRYVAATAFLVV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLSVALYTFTAVRIYEGTVRILIERDDPNVVSFQEVLEQNEVTDDYYETQYRLLQGRGLARRTIDALNLWSHPQFTQPAR
VLSVALYTFTAVRIYEGTVRILIERDDPNVVSFQEVLEQNEVTDDYYETQYRLLQGRGLARRTIDALNLWSHPQFTQPAR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTVRSVIMMPVNAVARWFEPPRPVEPPDAAETRVQSRVINRFLAALDVSAVRYSRLVDVSFRSNDPALAARVSNALADQY
PTVRSVIMMPVNAVARWFEPPRPVEPPDAAETRVQSRVINRFLAALDVSAVRYSRLVDVSFRSNDPALAARVSNALADQ 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKQSVELRSNTTKEASEFLVQQLAEQRNKVEASEQALQAYRERTGSVSFEERQNVVVQRLADLNAAVTKANTVRIQKEAT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YNQVKAVLENPAAIDTVPAILSNAFVQQQKTELAQLLRQRAQLSEKLGPNHPDMIKVNTAIQLAETRLQAEVAQVLQAMR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NDYEAALTEERTLANELNRQKIEAQQLNRTSIDYSALQRDAAANRQMFEALLKRTQETGVSEELKTGNIRVVDLAENPTG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PISPNIFNSLLMALLGGLTLAVGLAFGLEYADDRIKNPDEMKKHLGLPFLGMVPALFDKGAHTPLIGRGVSALFTESFRS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IRTNVLFSSTEEGGRLVVITSSAPGEGKTMVVTNLAVALAQAGHRVLLMDADMRKPRVHEVFGVPSSPGLSNLMVANATA
                   TSSAPGEGKTMVVTNLAVALAQAGHRVLLMDADMRKPRVHEVFGVPSSPGLSNLMVANATA
                          GKT                 LLMDADMR                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEVIQESSTPGLWVLSAGTHPPNPSELLGSKRFKEFAAFLMQYFDWVLLDTPPVMAVTDASIVANLSHGVLFVVGSEMTS
SEVIQESSTPGLWVLSAGTHPPNPSELLGSKRFKEFAAFLMQYFDWVLLDTPPVMAVTDASIVANLSHGVLFVVGSEMTS
                                              VLLDTPP                           
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRVAQRAVEQLELGQAKFLGTVLNRVDLEHNSYYYSRYYRPEYGGYYGPGAPGGTQTGTGAGPPAANSGGVGTRAARVAA
RRVAQRAVEQLELGQAKFLGTVLNRVDLEHNSYYYSRYYRPEYGGYYGP                               
                                YYYSRYYRPEYGGYY                                 
       810       820       830       840  
....:....|....:....|....:....|....:....|..
ATAAKAASVAATVGSRLVRRTAESASGTLQPGLRTRGDIRHL


© 1998-2021Legal notice