BYKdb

Annotate results for A0A1F2R977

A0A1F2R977 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F2R977
DOMAINcd125/311TSALPREGKTLTVTNLALTLSEYFGRRVLLIDGDLRHPSIHEILGLPNTTGLGDGLRSER
VQIPFYELSPTLTVLPAGPLHASSVGGLASNRMKAVIDGAAPRFDWVLVDTPPIGLLSDA
QFLAGLVDGVLLVIGAAKTPYPLVQRAVAALGPDRLIGIVLNRVEEQTITADAYYRHYYP
SSGAKDG
SITEWalker A132/134GKT
SITEWalker A'153/160LLIDGDLR
SITEWalker B231/237VLVDTPP
SITEY Cluster298/303YYRHYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALVMSRIDEALKRVTRAPSPSPRRAESAESRATSFGDSSLDHYPAEHHSVPWTGEGREGNVEPPAPVRPEPAGRRVQLG


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PFDPSIAGKLVTGSMRPVSQEEYRRLAAVLHQMQAEHKVKTLMVTSALPREGKTLTVTNLALTLSEYFGRRVLLIDGDLR
                                            TSALPREGKTLTVTNLALTLSEYFGRRVLLIDGDLR
                                                   GKT                  LLIDGDLR
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HPSIHEILGLPNTTGLGDGLRSERVQIPFYELSPTLTVLPAGPLHASSVGGLASNRMKAVIDGAAPRFDWVLVDTPPIGL
HPSIHEILGLPNTTGLGDGLRSERVQIPFYELSPTLTVLPAGPLHASSVGGLASNRMKAVIDGAAPRFDWVLVDTPPIGL
                                                                      VLVDTPP   
       250       260       270       280       290       300       310 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
LSDAQFLAGLVDGVLLVIGAAKTPYPLVQRAVAALGPDRLIGIVLNRVEEQTITADAYYRHYYPSSGAKDG
LSDAQFLAGLVDGVLLVIGAAKTPYPLVQRAVAALGPDRLIGIVLNRVEEQTITADAYYRHYYPSSGAKDG
                                                         YYRHYY        
© 1998-2021Legal notice