BYKdb

Annotate results for A0A1F2Q9F5

A0A1F2Q9F5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F2Q9F5
DOMAINtad35/214PAADLLSYWRILRKRRWTLASILVVLLVVVLVGTLKQKPVYRAKALLEIEREGPNILTVQ
ELFQIESASDTYLETQYRILESESLARRVVDQLRLDQLAEFSRPGFRLRGGKRETPASPQ
TFAVGAAGVARDPVAYQNALETFSRRLAVAPIKRSRLVGVSFESEDPALAARVVNTLAAN
DOMAINcd580/767SSAQPGEGKTTVTLNLAISLAQLGERVLLVDADLRRPCIHKAFKMAGGRGLVSYLTGQQE
WEAVVHPSPVENLDLVICGPIPPNPAELLSSERLRAFLRQALQRYHFVLLDSPPLLHVAD
ARILAALVEGVVLVVQGGTTPRELVQRAYVYARDVGANVIGAVLNNLDIRSDDYYYGRYY
RYDYYGTG
SITEWalker A587/589GKT
SITEWalker A'607/614LLVDADLR
SITEWalker B687/693VLLDSPP
SITEY Cluster728/764YVYARDVGANVIGAVLNNLDIRSDDYYYGRYYRYDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSDEKSVERYEPAARTLERRRPGVPAPLQTLEMEPAADLLSYWRILRKRRWTLASILVVLLVVVLVGTLKQKPVYRAKAL
                                  PAADLLSYWRILRKRRWTLASILVVLLVVVLVGTLKQKPVYRAKAL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEIEREGPNILTVQELFQIESASDTYLETQYRILESESLARRVVDQLRLDQLAEFSRPGFRLRGGKRETPASPQTFAVGA
LEIEREGPNILTVQELFQIESASDTYLETQYRILESESLARRVVDQLRLDQLAEFSRPGFRLRGGKRETPASPQTFAVGA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGVARDPVAYQNALETFSRRLAVAPIKRSRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLSEQLLE
AGVARDPVAYQNALETFSRRLAVAPIKRSRLVGVSFESEDPALAARVVNTLAAN                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKANLEKSEEQLQAYARQNGLLFLENEAGQPENIVNERLLQLQAELTRAQAERIAKESLYRLTQAGEYGALPGIFENKLM


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDLTVQLAELRRQHAQAATTFSPDYPTVKQLQNQIDEIERLLAQERARAAERLANDYQAAMRRETLLRRAFADQQAQAGR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAEKSVQYNILKREVDTNKQLYEGLLQRLKEAGMSAGMKASHVRVVDPAQPPDKPAKPSLALNLLLALVLGLGLGLAAVF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQEHFDNSLKTSEDVERFLHLPVLALIPSLESLNGRRRAYGLPTPKRLASRSVVPAAAPLWHLVSGNGEGSTKLGEAFRS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRTSVLLSTPEQAPRLLLTSSAQPGEGKTTVTLNLAISLAQLGERVLLVDADLRRPCIHKAFKMAGGRGLVSYLTGQQEW
                   SSAQPGEGKTTVTLNLAISLAQLGERVLLVDADLRRPCIHKAFKMAGGRGLVSYLTGQQEW
                          GKT                 LLVDADLR                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAVVHPSPVENLDLVICGPIPPNPAELLSSERLRAFLRQALQRYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTP
EAVVHPSPVENLDLVICGPIPPNPAELLSSERLRAFLRQALQRYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTP
                                              VLLDSPP                           
       730       740       750       760       770  
....:....|....:....|....:....|....:....|....:....|..
RELVQRAYVYARDVGANVIGAVLNNLDIRSDDYYYGRYYRYDYYGTGEHPPK
RELVQRAYVYARDVGANVIGAVLNNLDIRSDDYYYGRYYRYDYYGTG     
       YVYARDVGANVIGAVLNNLDIRSDDYYYGRYYRYDYY        

© 1998-2021Legal notice