BYKdb

Annotate results for A0A1F2PM96

A0A1F2PM96 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F2PM96
DOMAINcd42/227TSAGKEEGKSTTISNLAVTFAQADKRVLLIDADLRLPQISTIFNINKRKNGLSNMLVDEL
PLESLVNKIEKLEKLEILTAGNKHVSPTELLNSEAFGTFIKKCREEYDVILIDTPPVLSF
ADASIISNVVDGVLLVIAAHSTKKATIIEAKKNLDKVGAAVIGVILTKVKFKKNANYYRY
NADKAK
SITEWalker A49/51GKS
SITEWalker A'69/76LLIDADLR
SITE-96/-102MLVDELP
SITEY Cluster218/221YYRY
SITEWalker B151/157ILIDTPP
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDSQNLITLSDPTSFITESYKLLRTNLNFKNLNNRYQVMLVTSAGKEEGKSTTISNLAVTFAQADKRVLLIDADLRLPQI
                                         TSAGKEEGKSTTISNLAVTFAQADKRVLLIDADLRLPQI
                                                GKS                 LLIDADLR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STIFNINKRKNGLSNMLVDELPLESLVNKIEKLEKLEILTAGNKHVSPTELLNSEAFGTFIKKCREEYDVILIDTPPVLS
STIFNINKRKNGLSNMLVDELPLESLVNKIEKLEKLEILTAGNKHVSPTELLNSEAFGTFIKKCREEYDVILIDTPPVLS
                                                                      ILIDTPP   
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
FADASIISNVVDGVLLVIAAHSTKKATIIEAKKNLDKVGAAVIGVILTKVKFKKNANYYRYNADKAK
FADASIISNVVDGVLLVIAAHSTKKATIIEAKKNLDKVGAAVIGVILTKVKFKKNANYYRYNADKAK
                                                         YYRY      
© 1998-2021Legal notice