BYKdb

Annotate results for A0A1F2PKV6

A0A1F2PKV6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F2PKV6
DOMAINcd41/231TSSGGSEGKTTILANYGVTLCQSGKRVLIVDCDLRKPQVHRRFELDNTTGLTNLLLKEIK
TVDAFRRIEVPNLFAISAGPIPPNPSEILASRRMAEVIAELKLHFDYILLDTPPLGMVTD
AAVLNPVVDGYIVLASLGSVHRDGLLHVLDTLSKINAHVVGIVANKVPVSKRFSKYGYYS
AYGYYGDESKS
SITEWalker A48/50GKT
SITEWalker A'68/75LIVDCDLR
SITEWalker B148/154ILLDTPP
SITEY Cluster216/225YGYYSAYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQKTIVTHLTPKSPVSEAFRNMRTNILFSDIDNERKVLAITSSGGSEGKTTILANYGVTLCQSGKRVLIVDCDLRKPQVH
                                        TSSGGSEGKTTILANYGVTLCQSGKRVLIVDCDLRKPQVH
                                               GKT                 LIVDCDLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRFELDNTTGLTNLLLKEIKTVDAFRRIEVPNLFAISAGPIPPNPSEILASRRMAEVIAELKLHFDYILLDTPPLGMVTD
RRFELDNTTGLTNLLLKEIKTVDAFRRIEVPNLFAISAGPIPPNPSEILASRRMAEVIAELKLHFDYILLDTPPLGMVTD
                                                                   ILLDTPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAVLNPVVDGYIVLASLGSVHRDGLLHVLDTLSKINAHVVGIVANKVPVSKRFSKYGYYSAYGYYGDESKSDKKAKKEKK
AAVLNPVVDGYIVLASLGSVHRDGLLHVLDTLSKINAHVVGIVANKVPVSKRFSKYGYYSAYGYYGDESKS         
                                                       YGYYSAYGYY               
       250       260         
....:....|....:....|....:....
RWGKAISKPSSEPMIEQNFEQKAEPVSID


© 1998-2021Legal notice