BYKdb

Annotate results for A0A1F2EQC8

A0A1F2EQC8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F2EQC8
DOMAINcd47/237TSSGVWEGKSTVTANTAAVMAQQGLRVLLVDADLRKPTVAKTFNINTTVGLTSLLTDREA
SIMDTVNYVADANIYVLAAGPIPPNPSELLGSNRMAELIDELEEMFDLVIFDTPPILAVT
DAQIVATRVDGVIVVVRSGIANKNDVRKTKELLDVVNANVIGAVYNGEDVSKVGYGYGYG
YGYGYGQTDTD
SITEWalker A54/56GKS
SITEWalker A'74/81LLVDADLR
SITEWalker B155/161VIFDTPP
SITEY Cluster221/231YGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNAEQRRGASLITVTQPKDTISESFRQIRTNIQFSMVDHNFKSIMFTSSGVWEGKSTVTANTAAVMAQQGLRVLLVDADL
                                              TSSGVWEGKSTVTANTAAVMAQQGLRVLLVDADL
                                                     GKS                 LLVDADL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPTVAKTFNINTTVGLTSLLTDREASIMDTVNYVADANIYVLAAGPIPPNPSELLGSNRMAELIDELEEMFDLVIFDTP
RKPTVAKTFNINTTVGLTSLLTDREASIMDTVNYVADANIYVLAAGPIPPNPSELLGSNRMAELIDELEEMFDLVIFDTP
R                                                                         VIFDTP
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
PILAVTDAQIVATRVDGVIVVVRSGIANKNDVRKTKELLDVVNANVIGAVYNGEDVSKVGYGYGYGYGYGYGQTDTD
PILAVTDAQIVATRVDGVIVVVRSGIANKNDVRKTKELLDVVNANVIGAVYNGEDVSKVGYGYGYGYGYGYGQTDTD
P                                                           YGYGYGYGYGY      
© 1998-2020Legal notice