BYKdb

Annotate results for A0A1F1X071

A0A1F1X071 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F1X071
DOMAINtad1/140MTIEDFLRLLLRNLLLLVAGLVLGAATGYGLSFTQSTTYSASALGYVSASAQSDENGDPI
QQASGNMEFQYSKAQSYLPLFNTRAVGQRIVDELGLEASPDEVAGSLQTTLDPNAPIITV
EAVAPTAEEASAIANAAVEA
DOMAINcd274/465TSSAPGEGKSTVAANLARVMARAGQPTLLVDADLRRPMIAQQFSVDGEVGLSQLLAASVS
LEDVAEPTTVPLLTLLPAGQIPPNPSELLGSRRMQELIEELSRQYFVIIDAPPVLAVTDA
QLLTRHSDGAILVAVPGQTRTAAMQKAVEAIRAVNGTVYGAVLNRASTGRLNRLAYGDAV
YGYSAYGKYGYG
SITEWalker A281/283GKS
SITEWalker A'301/308LLVDADLR
SITEWalker B380/386VIIDAPP
SITEY Cluster449/470YGDAVYGYSAYGKYGYGALGGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIEDFLRLLLRNLLLLVAGLVLGAATGYGLSFTQSTTYSASALGYVSASAQSDENGDPIQQASGNMEFQYSKAQSYLPL
MTIEDFLRLLLRNLLLLVAGLVLGAATGYGLSFTQSTTYSASALGYVSASAQSDENGDPIQQASGNMEFQYSKAQSYLPL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FNTRAVGQRIVDELGLEASPDEVAGSLQTTLDPNAPIITVEAVAPTAEEASAIANAAVEATAAEARELETGGNENAAVGV
FNTRAVGQRIVDELGLEASPDEVAGSLQTTLDPNAPIITVEAVAPTAEEASAIANAAVEA                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLTNYQNAVVPGAPVSPDREKFLLAGAAFGLLVALGLAWLRDRNDSRLRTADDVTDVVGLPTLGALPDAKELARGKDGVL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PEPTSFPSREALRKLRTNLRYIDVDNPPRSIVVTSSAPGEGKSTVAANLARVMARAGQPTLLVDADLRRPMIAQQFSVDG
                                 TSSAPGEGKSTVAANLARVMARAGQPTLLVDADLRRPMIAQQFSVDG
                                        GKS                 LLVDADLR            
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVGLSQLLAASVSLEDVAEPTTVPLLTLLPAGQIPPNPSELLGSRRMQELIEELSRQYFVIIDAPPVLAVTDAQLLTRHS
EVGLSQLLAASVSLEDVAEPTTVPLLTLLPAGQIPPNPSELLGSRRMQELIEELSRQYFVIIDAPPVLAVTDAQLLTRHS
                                                           VIIDAPP              
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGAILVAVPGQTRTAAMQKAVEAIRAVNGTVYGAVLNRASTGRLNRLAYGDAVYGYSAYGKYGYGALGGYDESAVVPDAE
DGAILVAVPGQTRTAAMQKAVEAIRAVNGTVYGAVLNRASTGRLNRLAYGDAVYGYSAYGKYGYG               
                                                YGDAVYGYSAYGKYGYGALGGY          
       490       500       510       520       530      
....:....|....:....|....:....|....:....|....:....|....:.
EVDVEQAGGPAEPGPASAPAEPGPVVEPDGHEPEGDSAAAARTSPRGRRAASTWGR


© 1998-2020Legal notice