BYKdb

Annotate results for A0A1F1W0J5

A0A1F1W0J5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F1W0J5
DOMAINtad11/147TPVELQQYLTILKERWSTAAIAAVLVLAVVSTLTLTRTPTYTATNRVFVQTEAGGSVSER
SSGVNFASQQIITYADLAKTPIVLDPVIEELGLDLTADELADRISTTIPEDTLIIDITAS
SVDPEVASAIANATSES
DOMAINcd292/480TSSLSGEGKSSTAINLAQVLAQAGGRVLLVDADLRRPSLATELGLERTVGLTTVLIGDVE
LDDVTQPLETAGLDVLTSGPIPPNPSELLGSEAMRSLLEAASEAYDYVVVDTAPLLAVTD
AVALSRFVDGSLVVAQSDRVKKQQLGEALAKMDSVDARVLGVVVNNAPRDVRDVYTYLPG
EESSEPAVS
SITEWalker A299/301GKS
SITEWalker A'319/326LLVDADLR
SITEWalker B399/405VVVDTAP
SITE-396/-398YDY
SITEY Cluster466/468YTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPEHIDPDEGTPVELQQYLTILKERWSTAAIAAVLVLAVVSTLTLTRTPTYTATNRVFVQTEAGGSVSERSSGVNFASQQ
          TPVELQQYLTILKERWSTAAIAAVLVLAVVSTLTLTRTPTYTATNRVFVQTEAGGSVSERSSGVNFASQQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IITYADLAKTPIVLDPVIEELGLDLTADELADRISTTIPEDTLIIDITASSVDPEVASAIANATSESLRTQVSALEAPTQ
IITYADLAKTPIVLDPVIEELGLDLTADELADRISTTIPEDTLIIDITASSVDPEVASAIANATSES             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAAATGTTEEGLEAVPSTVELTEISAAATPSSPASPNIPRDLALGVLLTLLAGLAAAVVRDFLDNRVRRPADIEALYDLP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIGSIPSVHSSQNVALIAAQKPSSVQAEAYRELRTNLHFMLTADRMNTLLVTSSLSGEGKSSTAINLAQVLAQAGGRVLL
                                                   TSSLSGEGKSSTAINLAQVLAQAGGRVLL
                                                          GKS                 LL
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADLRRPSLATELGLERTVGLTTVLIGDVELDDVTQPLETAGLDVLTSGPIPPNPSELLGSEAMRSLLEAASEAYDYVV
VDADLRRPSLATELGLERTVGLTTVLIGDVELDDVTQPLETAGLDVLTSGPIPPNPSELLGSEAMRSLLEAASEAYDYVV
VDADLR                                                                        VV
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDTAPLLAVTDAVALSRFVDGSLVVAQSDRVKKQQLGEALAKMDSVDARVLGVVVNNAPRDVRDVYTYLPGEESSEPAVS
VDTAPLLAVTDAVALSRFVDGSLVVAQSDRVKKQQLGEALAKMDSVDARVLGVVVNNAPRDVRDVYTYLPGEESSEPAVS
VDTAP                                                            YTY            
       490       500       510       520
....:....|....:....|....:....|....:....|
VVPAEDRPAEAWPEEARPSESSEHRSEEALGAEEATGDRP


© 1998-2020Legal notice