BYKdb

Annotate results for A0A1F1LR85

A0A1F1LR85 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F1LR85
DOMAINcd41/230TSTKDNEGKSTVAMNIATSLAALGKRTLLIDADTRNSVFVGRMKIRSKVVGLTHYLAGEA
TVKEIVFGTTEPNLHMILSGPVPPNPTALLQGDSFQELIDVCRHHYDYVIVDTPPLGLVT
DASIVAHQCDASILVVEAGAIKRRAVKKIQELLEHTGAKFLGVILNKVDLKASHYGAYGS
YGNYGNYGKK
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDADTR
SITEWalker B149/155VIVDTPP
SITE-146/-148YDY
SITEY Cluster215/227YGAYGSYGNYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEQVEPRLNKKLISPEAEEYYNAIRTNILFSGKDIKVIAITSTKDNEGKSTVAMNIATSLAALGKRTLLIDADTRNSVFV
                                        TSTKDNEGKSTVAMNIATSLAALGKRTLLIDADTRNSVFV
                                               GKS                 LLIDADTR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRMKIRSKVVGLTHYLAGEATVKEIVFGTTEPNLHMILSGPVPPNPTALLQGDSFQELIDVCRHHYDYVIVDTPPLGLVT
GRMKIRSKVVGLTHYLAGEATVKEIVFGTTEPNLHMILSGPVPPNPTALLQGDSFQELIDVCRHHYDYVIVDTPPLGLVT
                                                                    VIVDTPP     
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
DASIVAHQCDASILVVEAGAIKRRAVKKIQELLEHTGAKFLGVILNKVDLKASHYGAYGSYGNYGNYGKKAE
DASIVAHQCDASILVVEAGAIKRRAVKKIQELLEHTGAKFLGVILNKVDLKASHYGAYGSYGNYGNYGKK  
                                                      YGAYGSYGNYGNY     
© 1998-2020Legal notice