BYKdb

Annotate results for A0A1F1JVB2

A0A1F1JVB2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F1JVB2
DOMAINtad1/136MTLDDILRLTRRHIITLVLSTLAGIALAAGWVAMQTPVYTATATGVVQASSGTGTVGESL
SGNSLAITKSSAYVTYFSSQPVAERVIKQLNLDTDPAALSSRVSAKVEEETPNITVSAKG
GSPQEAKQLADAVVTE
DOMAINcd295/485TSARMGEGKSTISSNLSYLLAEGGERVILVDADLRRPSVAGIFDIDASVGLTQVLAGTAD
LADAVQPTAHPNLMVLPAGTIPPNPSELLGSQRMRDLIATLTQTHRVILDAPPLLPVTDA
ALLTTAADGAVLVVAAGDTRKEHVERAAANLRNVNANLLGAVINRASVSRLNRILYGEGY
GYGSYGYGAGY
SITEWalker A302/304GKS
SITEWalker A'322/329ILVDADLR
SITEWalker B401/407VILDAPP
SITEY Cluster470/489YGEGYGYGSYGYGAGYGDGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLDDILRLTRRHIITLVLSTLAGIALAAGWVAMQTPVYTATATGVVQASSGTGTVGESLSGNSLAITKSSAYVTYFSSQ
MTLDDILRLTRRHIITLVLSTLAGIALAAGWVAMQTPVYTATATGVVQASSGTGTVGESLSGNSLAITKSSAYVTYFSSQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVAERVIKQLNLDTDPAALSSRVSAKVEEETPNITVSAKGGSPQEAKQLADAVVTETAAYVKDLETKNLTDGPSYPAQQE
PVAERVIKQLNLDTDPAALSSRVSAKVEEETPNITVSAKGGSPQEAKQLADAVVTE                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSSDESSSQKDKEQRTPATSILPLASADLPSSPTEPQPARALVLGGLAGLALGYLIAWFRHRQDTRIRTQEDIEEASGGT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STLGLIPANEALSSPERAVRDSGEVDFATREALRQFRTNLRFVNVDHAPKSIVVTSARMGEGKSTISSNLSYLLAEGGER
                                                      TSARMGEGKSTISSNLSYLLAEGGER
                                                             GKS                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VILVDADLRRPSVAGIFDIDASVGLTQVLAGTADLADAVQPTAHPNLMVLPAGTIPPNPSELLGSQRMRDLIATLTQTHR
VILVDADLRRPSVAGIFDIDASVGLTQVLAGTADLADAVQPTAHPNLMVLPAGTIPPNPSELLGSQRMRDLIATLTQTHR
 ILVDADLR                                                                       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VILDAPPLLPVTDAALLTTAADGAVLVVAAGDTRKEHVERAAANLRNVNANLLGAVINRASVSRLNRILYGEGYGYGSYG
VILDAPPLLPVTDAALLTTAADGAVLVVAAGDTRKEHVERAAANLRNVNANLLGAVINRASVSRLNRILYGEGYGYGSYG
VILDAPP                                                              YGEGYGYGSYG
       490       500    
....:....|....:....|....
YGAGYGDGYGDDKKSRKRRKRRKK
YGAGY                   
YGAGYGDGY               
© 1998-2020Legal notice