BYKdb

Annotate results for A0A1F1IHY9

A0A1F1IHY9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F1IHY9
DOMAINtad1/135MSLSKAMSMLQRHWMILVAAPLIGVLLAGLWVLTQNPRYASTANALVVVGNSESLGVALT
ADNLAKSKAQQYALLGESRAVSDKAVEELPFDLSSGEALRNVEVASTSGSAQIVVRAEDS
SPERAQQLASAWLGA
DOMAINcd286/474TSAHPGEGKSTVAANLAVPVAESGQRVVLVDGDLRRPVVAENFGLISTVGLTDVVLGRVE
LADALQTVGNRPSLQVLASGPIPPNPSEILASDRFNDLINALAEDALVIIDAPPLLPVTD
AAILARRFDGCLLVVSAGRTTYDEFSKAVSSIRKIDGEVLGAVLNRVPASGTAASAYQYY
GATYYTASQ
SITEWalker A293/295GKS
SITEWalker A'313/320VLVDGDLR
SITEWalker B393/399VIIDAPP
SITEY Cluster462/470YQYYGATYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLSKAMSMLQRHWMILVAAPLIGVLLAGLWVLTQNPRYASTANALVVVGNSESLGVALTADNLAKSKAQQYALLGESRA
MSLSKAMSMLQRHWMILVAAPLIGVLLAGLWVLTQNPRYASTANALVVVGNSESLGVALTADNLAKSKAQQYALLGESRA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSDKAVEELPFDLSSGEALRNVEVASTSGSAQIVVRAEDSSPERAQQLASAWLGALEAQATEVEAGGIAGQSIISLETLS
VSDKAVEELPFDLSSGEALRNVEVASTSGSAQIVVRAEDSSPERAQQLASAWLGA                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DASLPSAPSSPNLPLALSIGGALGLLAGLGVAVVRHVLDNKIRSAAALESRFGLTILGTVPESTRSARNRRRRDGGDVIN


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAGRVDGETSPKQHQDSFRLTESFKELRTNLQFLRPDEAVSIVTVTSAHPGEGKSTVAANLAVPVAESGQRVVLVDGDLR
                                             TSAHPGEGKSTVAANLAVPVAESGQRVVLVDGDLR
                                                    GKS                 VLVDGDLR
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RPVVAENFGLISTVGLTDVVLGRVELADALQTVGNRPSLQVLASGPIPPNPSEILASDRFNDLINALAEDALVIIDAPPL
RPVVAENFGLISTVGLTDVVLGRVELADALQTVGNRPSLQVLASGPIPPNPSEILASDRFNDLINALAEDALVIIDAPPL
                                                                        VIIDAPP 
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPVTDAAILARRFDGCLLVVSAGRTTYDEFSKAVSSIRKIDGEVLGAVLNRVPASGTAASAYQYYGATYYTASQQQDVAG
LPVTDAAILARRFDGCLLVVSAGRTTYDEFSKAVSSIRKIDGEVLGAVLNRVPASGTAASAYQYYGATYYTASQ      
                                                             YQYYGATYY          
  
..
RS


© 1998-2020Legal notice