BYKdb

Annotate results for A0A1F1BTN4

A0A1F1BTN4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F1BTN4
DOMAINcd51/235TSEKPAAGKSIVSANIAITYAQAGYKTLIIDGDMRKPTQHYHFETSNYDGLSNLIIGNSD
FDKAIRSTRVKNLDLLTSGPIPPNPSELIASKRFKKIFEHLQKEYDFILIDTPPIISVTD
AQVFLQYVPNCMLIIDAQKNNRNEVKKAKQLVEQADGHVIGAVLNKTAKEKSSSYYHYYG
DEIKS
SITEWalker A58/60GKS
SITEWalker A'78/85LIIDGDMR
SITEWalker B158/164ILIDTPP
SITE-70/-75YAQAGY
SITEY Cluster225/229YYHYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKRKKEKRKALETPLYVEDNPKSIVSEKVRGIRSNIMFSNAEEIKSVLITSEKPAAGKSIVSANIAITYAQAGYKTLII
                                                  TSEKPAAGKSIVSANIAITYAQAGYKTLII
                                                         GKS                 LII
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGDMRKPTQHYHFETSNYDGLSNLIIGNSDFDKAIRSTRVKNLDLLTSGPIPPNPSELIASKRFKKIFEHLQKEYDFILI
DGDMRKPTQHYHFETSNYDGLSNLIIGNSDFDKAIRSTRVKNLDLLTSGPIPPNPSELIASKRFKKIFEHLQKEYDFILI
DGDMR                                                                        ILI
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
DTPPIISVTDAQVFLQYVPNCMLIIDAQKNNRNEVKKAKQLVEQADGHVIGAVLNKTAKEKSSSYYHYYGDEIKS
DTPPIISVTDAQVFLQYVPNCMLIIDAQKNNRNEVKKAKQLVEQADGHVIGAVLNKTAKEKSSSYYHYYGDEIKS
DTPP                                                            YYHYY      
© 1998-2020Legal notice