BYKdb

Annotate results for A0A1F0THV9

A0A1F0THV9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1F0THV9
DOMAINtad1/133MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSG
SNAAKERARSYSAIVSSEAVAKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSP
EQARVLANSALHA
DOMAINcd295/487TSAVPGEGKSTVSLAVARSMASSGQPVILIDADLRRPTVAKKLHINAKIGLTQVLAGQVD
IAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFLVIVDAPPLLPVTDA
SLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGY
ANSYVGYASYYGY
SITE-431/-433GKS
SITEWalker A'322/329ILIDADLR
SITEWalker B401/407VIVDAPP
SITEY Cluster469/487YYGFGYANSYVGYASYYGY
SITEWalker A302/304GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHA                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
                                                      TSAVPGEGKSTVSLAVARSMASSGQP
                                                             GKS                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
 ILIDADLR                                                                       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
VIVDAPP                                                             YYGFGYANSYVG
       490       500  
....:....|....:....|..
YASYYGYSKDGKKKVSSGAHGA
YASYYGY               
YASYYGY               
© 1998-2020Legal notice