BYKdb

Annotate results for A0A1F0S3J0

A0A1F0S3J0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F0S3J0
DOMAINcd64/252TSSTVSEGKSTVSANVAVTWAQAGKKVLLIDADLRRPTVHATFRTLNLEGVTTVLTGKTK
PSDVAEKTFVDNLDIITSGPVPPNPSELLNSKRMAHLLEWSRTNYDIVVLDAPPVLAVSD
VQVLVPKTDGVVVVTNMGKTLKGDLKRTVEVLKLAKAKILGSVERVRASKGDRGYGYGYG
YGYGYQSND
SITE-120/-122GKT
SITEWalker A'91/98LLIDADLR
SITEWalker B171/177VVLDAPP
SITEY Cluster238/248YGYGYGYGYGY
SITE-201/-203GKT
SITEWalker A71/73GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLNKIFNKFTHRNQKDNETQKNGVMLVAFAEPKHVVAEQFRTVRTNIEFAGAALDQCEVIMFTSSTVSEGKSTVSANVA
                                                               TSSTVSEGKSTVSANVA
                                                                      GKS       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTWAQAGKKVLLIDADLRRPTVHATFRTLNLEGVTTVLTGKTKPSDVAEKTFVDNLDIITSGPVPPNPSELLNSKRMAHL
VTWAQAGKKVLLIDADLRRPTVHATFRTLNLEGVTTVLTGKTKPSDVAEKTFVDNLDIITSGPVPPNPSELLNSKRMAHL
          LLIDADLR                                                              
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEWSRTNYDIVVLDAPPVLAVSDVQVLVPKTDGVVVVTNMGKTLKGDLKRTVEVLKLAKAKILGSVERVRASKGDRGYGY
LEWSRTNYDIVVLDAPPVLAVSDVQVLVPKTDGVVVVTNMGKTLKGDLKRTVEVLKLAKAKILGSVERVRASKGDRGYGY
          VVLDAPP                                                            YGY
       250    
....:....|....
GYGYGYGYQSNDVR
GYGYGYGYQSND  
GYGYGYGY      
© 1998-2020Legal notice