BYKdb

Annotate results for A0A1F0RVL0

A0A1F0RVL0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F0RVL0
DOMAINcd62/248TSSAMSEGKSTVAANVAVTWAQAGKKVLLVDADLRRPTVHATFRTLNIDGVTTILTGKTT
AQEVVEETFVDNLSILTSGPIPPNPAELLNSKRMGELIDWAREKFDIVVLDAPPVLAVSD
VQVLVPKTDGVVVIANMGKTLKSDLKRTVEVLKLADAKVLGAVERIKAKRGDKGYGYGYG
YGYGNSK
SITE-118/-120GKT
SITEWalker A'89/96LLVDADLR
SITEWalker B169/175VVLDAPP
SITEY Cluster236/244YGYGYGYGY
SITE-199/-201GKT
SITEWalker A69/71GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKVSLRSILGRNKIDDETQKNGVMLVTFAEPKHAVSEQLRTVKTNIEFAGAALDRCQVIMFTSSAMSEGKSTVAANVAVT
                                                             TSSAMSEGKSTVAANVAVT
                                                                    GKS         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WAQAGKKVLLVDADLRRPTVHATFRTLNIDGVTTILTGKTTAQEVVEETFVDNLSILTSGPIPPNPAELLNSKRMGELID
WAQAGKKVLLVDADLRRPTVHATFRTLNIDGVTTILTGKTTAQEVVEETFVDNLSILTSGPIPPNPAELLNSKRMGELID
        LLVDADLR                                                                
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WAREKFDIVVLDAPPVLAVSDVQVLVPKTDGVVVIANMGKTLKSDLKRTVEVLKLADAKVLGAVERIKAKRGDKGYGYGY
WAREKFDIVVLDAPPVLAVSDVQVLVPKTDGVVVIANMGKTLKSDLKRTVEVLKLADAKVLGAVERIKAKRGDKGYGYGY
        VVLDAPP                                                            YGYGY
        
....:...
GYGYGNSK
GYGYGNSK
GYGY    
© 1998-2020Legal notice